--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -839.16 -851.97
2 -838.68 -851.79
--------------------------------------
TOTAL -838.89 -851.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.304420 0.004249 0.192208 0.436590 0.295201 867.53 937.34 1.000
r(A<->C){all} 0.087069 0.001616 0.013860 0.160857 0.082410 553.39 620.23 1.000
r(A<->G){all} 0.157403 0.002704 0.069745 0.263839 0.151584 497.65 528.29 1.001
r(A<->T){all} 0.100707 0.001639 0.026705 0.177595 0.096963 349.86 400.34 1.002
r(C<->G){all} 0.053979 0.001010 0.003957 0.117868 0.048972 525.66 679.42 1.001
r(C<->T){all} 0.542941 0.006004 0.404741 0.705339 0.542053 440.86 467.87 1.001
r(G<->T){all} 0.057900 0.001009 0.005587 0.120305 0.052467 398.34 539.83 1.000
pi(A){all} 0.267532 0.000490 0.223611 0.308719 0.267272 1089.42 1190.71 1.001
pi(C){all} 0.260152 0.000492 0.217138 0.303646 0.259480 1168.94 1334.97 1.001
pi(G){all} 0.227061 0.000475 0.186221 0.271200 0.226350 1137.35 1178.08 1.000
pi(T){all} 0.245256 0.000473 0.201398 0.286221 0.245012 1236.80 1282.96 1.000
alpha{1,2} 0.120502 0.011230 0.000061 0.294930 0.100671 1067.70 1113.04 1.000
alpha{3} 2.309624 1.642257 0.473627 4.929037 2.024246 1259.95 1319.39 1.000
pinvar{all} 0.472338 0.013584 0.237283 0.681523 0.479801 1168.29 1183.77 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -820.335273
Model 2: PositiveSelection -820.253820
Model 7: beta -820.510799
Model 8: beta&w>1 -820.258936
Model 2 vs 1 .162906
Model 8 vs 7 .503726
-- Starting log on Tue Oct 25 21:14:53 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=9, Len=119
C1 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNIQYPIKWRCIYT
C2 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C3 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C4 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C5 MDYVSLLNQVWQKQVNSAHEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C6 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C7 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C8 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C9 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGTLQYPIKWRCIYT
*****************::******:***:*******.:* *********
C1 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C2 FAGYTGTSTEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C3 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C4 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C5 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C6 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C7 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C8 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C9 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
*******:*****.***************: ****** *********::*
C1 RYDASKSYFYTQTSSSSNE
C2 RYDASKSYFYTETSSSSNE
C3 RYDASKSYFYTQTSSSSHE
C4 RYDASKSYFYTQTSSSSHE
C5 RYDASKSYFYTKTPSSPEE
C6 RYDASKSYFYTETSSSSDE
C7 RYDASKSYFYTETSSSSDE
C8 RYDASKSYFYTETSSSSDE
C9 RYDASKSYFYTETSSSSDE
***********:*.**..*
-- Starting log on Tue Oct 25 21:15:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=9, Len=119
C1 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNIQYPIKWRCIYT
C2 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C3 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C4 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C5 MDYVSLLNQVWQKQVNSAHEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C6 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C7 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C8 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C9 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGTLQYPIKWRCIYT
*****************::******:***:*******.:* *********
C1 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C2 FAGYTGTSTEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C3 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C4 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C5 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C6 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C7 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C8 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C9 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
*******:*****.***************: ****** *********::*
C1 RYDASKSYFYTQTSSSSNE
C2 RYDASKSYFYTETSSSSNE
C3 RYDASKSYFYTQTSSSSHE
C4 RYDASKSYFYTQTSSSSHE
C5 RYDASKSYFYTKTPSSPEE
C6 RYDASKSYFYTETSSSSDE
C7 RYDASKSYFYTETSSSSDE
C8 RYDASKSYFYTETSSSSDE
C9 RYDASKSYFYTETSSSSDE
***********:*.**..*
-- Starting log on Tue Oct 25 21:28:51 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/gapped_alignment/codeml,TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 9 taxa and 357 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666733333
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 299225236
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4000349257
Seed = 319654610
Swapseed = 1666733333
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 14 unique site patterns
Division 2 has 10 unique site patterns
Division 3 has 33 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1044.831169 -- 32.479477
Chain 2 -- -1058.451510 -- 32.479477
Chain 3 -- -1040.661485 -- 32.479477
Chain 4 -- -1060.231316 -- 32.479477
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -990.487699 -- 32.479477
Chain 2 -- -1061.091204 -- 32.479477
Chain 3 -- -1013.665448 -- 32.479477
Chain 4 -- -1053.163384 -- 32.479477
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1044.831] (-1058.452) (-1040.661) (-1060.231) * [-990.488] (-1061.091) (-1013.665) (-1053.163)
1000 -- [-852.761] (-864.690) (-871.147) (-863.529) * (-867.264) (-865.180) (-870.589) [-867.375] -- 0:00:00
2000 -- [-858.316] (-862.715) (-867.361) (-852.006) * (-864.268) (-861.778) (-866.094) [-856.617] -- 0:08:19
3000 -- (-863.117) [-848.498] (-854.667) (-852.869) * (-856.762) [-853.913] (-852.793) (-848.374) -- 0:05:32
4000 -- (-854.076) (-845.450) [-854.474] (-850.134) * [-853.593] (-857.028) (-847.683) (-848.639) -- 0:04:09
5000 -- (-856.660) [-842.934] (-851.504) (-845.738) * (-853.558) (-850.677) (-842.163) [-846.621] -- 0:03:19
Average standard deviation of split frequencies: 0.078567
6000 -- (-845.782) (-840.886) (-843.778) [-839.775] * [-840.854] (-847.679) (-836.369) (-852.312) -- 0:05:31
7000 -- (-846.987) [-840.907] (-852.226) (-849.899) * (-854.536) (-843.396) [-842.456] (-850.783) -- 0:04:43
8000 -- (-845.368) [-845.513] (-838.299) (-845.916) * [-844.365] (-855.460) (-841.321) (-852.154) -- 0:04:08
9000 -- (-842.878) (-853.237) (-839.955) [-844.513] * [-848.774] (-852.793) (-850.497) (-840.930) -- 0:03:40
10000 -- (-840.348) (-846.461) [-842.599] (-842.194) * (-858.214) (-845.252) (-855.921) [-841.420] -- 0:04:57
Average standard deviation of split frequencies: 0.070711
11000 -- (-843.161) (-847.179) [-844.838] (-843.647) * (-842.562) (-846.470) (-846.688) [-841.620] -- 0:04:29
12000 -- (-840.805) (-856.370) [-842.742] (-841.973) * (-848.046) [-845.902] (-847.991) (-839.697) -- 0:04:07
13000 -- (-844.434) (-855.111) (-851.392) [-845.870] * (-847.144) (-847.626) [-845.503] (-843.357) -- 0:03:47
14000 -- (-850.129) (-847.428) (-845.524) [-839.468] * (-845.403) (-848.410) [-844.382] (-845.027) -- 0:04:41
15000 -- [-842.610] (-842.932) (-845.939) (-848.851) * (-849.899) [-839.559] (-849.634) (-847.729) -- 0:04:22
Average standard deviation of split frequencies: 0.047140
16000 -- [-841.716] (-843.310) (-850.238) (-847.148) * [-847.058] (-847.354) (-845.158) (-854.090) -- 0:04:06
17000 -- (-848.790) (-846.333) [-841.859] (-851.357) * (-856.687) [-842.629] (-843.618) (-841.467) -- 0:03:51
18000 -- (-845.777) [-845.425] (-845.770) (-849.996) * (-841.950) (-849.725) [-840.681] (-853.539) -- 0:04:32
19000 -- (-845.249) (-840.418) [-848.876] (-855.519) * [-838.600] (-851.583) (-840.826) (-859.606) -- 0:04:18
20000 -- (-846.285) [-838.973] (-847.345) (-850.480) * [-841.626] (-851.496) (-852.490) (-845.164) -- 0:04:05
Average standard deviation of split frequencies: 0.018248
21000 -- (-844.218) (-848.212) [-842.566] (-847.380) * [-843.975] (-847.664) (-840.298) (-850.537) -- 0:03:53
22000 -- (-845.328) [-846.556] (-847.675) (-845.598) * (-856.935) (-854.315) [-843.628] (-842.942) -- 0:04:26
23000 -- (-850.085) [-840.921] (-843.055) (-847.561) * [-841.216] (-844.743) (-843.377) (-837.774) -- 0:04:14
24000 -- (-847.502) (-839.116) [-842.122] (-849.020) * [-841.971] (-844.612) (-841.924) (-844.174) -- 0:04:04
25000 -- (-846.672) [-836.694] (-845.401) (-854.028) * (-847.547) (-849.759) (-841.726) [-841.843] -- 0:03:54
Average standard deviation of split frequencies: 0.034614
26000 -- (-848.916) (-842.914) [-836.252] (-850.684) * [-845.210] (-850.476) (-851.835) (-845.770) -- 0:04:22
27000 -- (-842.577) (-848.595) [-849.263] (-842.365) * (-844.726) (-847.331) (-841.345) [-843.845] -- 0:04:12
28000 -- (-842.197) (-843.132) [-844.829] (-843.770) * (-846.305) (-841.338) [-842.203] (-847.345) -- 0:04:03
29000 -- [-842.843] (-843.063) (-846.806) (-855.013) * (-848.535) (-847.154) (-841.494) [-842.201] -- 0:03:54
30000 -- [-847.389] (-852.031) (-843.627) (-854.481) * (-845.030) (-846.645) [-841.575] (-839.234) -- 0:04:18
Average standard deviation of split frequencies: 0.029346
31000 -- (-850.385) [-846.131] (-842.921) (-849.669) * (-844.534) (-839.834) (-850.732) [-841.483] -- 0:04:10
32000 -- (-846.067) [-841.636] (-843.067) (-853.574) * (-841.812) [-841.720] (-841.846) (-847.830) -- 0:04:02
33000 -- (-841.185) [-840.744] (-850.486) (-853.187) * (-841.701) [-841.940] (-839.627) (-849.425) -- 0:03:54
34000 -- [-838.007] (-845.448) (-852.934) (-843.972) * (-852.326) (-843.211) [-841.900] (-846.937) -- 0:04:15
35000 -- (-844.009) (-846.296) (-844.274) [-840.133] * (-849.166) (-848.603) [-845.452] (-852.145) -- 0:04:08
Average standard deviation of split frequencies: 0.032141
36000 -- (-851.074) (-854.776) [-838.592] (-845.264) * (-844.268) (-842.304) [-845.220] (-849.606) -- 0:04:01
37000 -- (-852.129) (-840.520) [-843.043] (-852.153) * (-852.488) (-851.037) (-845.459) [-847.527] -- 0:03:54
38000 -- (-844.125) [-840.769] (-845.321) (-843.797) * [-852.315] (-842.624) (-850.379) (-843.505) -- 0:04:13
39000 -- [-837.797] (-846.446) (-846.814) (-842.462) * (-859.640) (-841.587) [-837.673] (-849.510) -- 0:04:06
40000 -- (-843.662) (-848.130) [-840.249] (-842.176) * (-853.020) (-843.746) [-845.702] (-857.097) -- 0:04:00
Average standard deviation of split frequencies: 0.040045
41000 -- (-860.670) (-847.778) (-848.634) [-845.556] * (-854.450) (-844.397) (-837.968) [-848.797] -- 0:03:53
42000 -- (-850.038) (-845.388) [-842.444] (-843.461) * (-850.569) (-854.375) (-852.548) [-851.667] -- 0:04:10
43000 -- (-845.373) [-852.100] (-845.103) (-844.300) * [-846.497] (-847.192) (-849.369) (-846.865) -- 0:04:04
44000 -- (-844.581) (-841.301) (-850.973) [-843.405] * (-848.582) (-845.248) [-839.593] (-841.478) -- 0:03:59
45000 -- (-847.455) [-844.402] (-840.165) (-849.072) * [-842.518] (-850.035) (-840.963) (-846.902) -- 0:03:53
Average standard deviation of split frequencies: 0.039128
46000 -- (-845.284) (-841.830) [-836.531] (-843.292) * (-856.559) [-841.167] (-841.303) (-838.789) -- 0:04:08
47000 -- (-841.077) [-842.628] (-849.666) (-845.612) * (-845.291) (-852.998) (-854.973) [-841.222] -- 0:04:03
48000 -- [-840.586] (-840.256) (-845.532) (-842.225) * [-842.508] (-840.973) (-839.044) (-842.377) -- 0:03:58
49000 -- (-846.021) (-846.210) (-847.738) [-841.928] * (-839.637) (-842.008) [-840.528] (-841.280) -- 0:03:52
50000 -- (-841.804) (-854.790) [-834.250] (-842.085) * (-843.556) (-842.380) [-848.071] (-843.188) -- 0:04:06
Average standard deviation of split frequencies: 0.043983
51000 -- (-843.899) (-851.261) (-844.234) [-845.901] * (-849.006) (-840.813) (-849.575) [-843.067] -- 0:04:01
52000 -- (-840.179) (-869.058) (-846.744) [-843.926] * (-845.310) (-842.812) (-843.929) [-839.724] -- 0:03:57
53000 -- [-845.890] (-845.117) (-850.270) (-843.939) * [-842.746] (-843.963) (-838.955) (-851.589) -- 0:03:52
54000 -- (-844.640) (-850.122) [-834.343] (-839.845) * (-846.620) (-846.212) [-839.918] (-849.380) -- 0:04:05
55000 -- (-850.516) (-845.019) [-839.783] (-844.198) * [-849.719] (-851.456) (-842.154) (-847.121) -- 0:04:00
Average standard deviation of split frequencies: 0.047447
56000 -- (-844.628) [-846.889] (-838.825) (-847.029) * [-840.271] (-838.582) (-847.049) (-847.456) -- 0:03:56
57000 -- (-845.969) [-846.503] (-853.611) (-838.467) * (-851.117) [-844.207] (-845.734) (-851.446) -- 0:03:51
58000 -- (-839.872) (-844.288) (-845.339) [-837.129] * (-847.190) (-856.860) (-845.232) [-846.847] -- 0:04:03
59000 -- [-842.473] (-844.070) (-844.749) (-848.938) * (-844.512) (-842.318) (-845.053) [-836.415] -- 0:03:59
60000 -- [-846.184] (-845.935) (-851.801) (-847.339) * (-849.216) (-844.560) (-853.090) [-838.454] -- 0:03:55
Average standard deviation of split frequencies: 0.045210
61000 -- [-845.175] (-845.692) (-839.438) (-847.153) * (-847.398) (-851.581) (-850.380) [-838.748] -- 0:04:06
62000 -- (-850.032) (-845.387) [-842.002] (-840.300) * (-852.098) (-846.817) [-842.702] (-839.692) -- 0:04:02
63000 -- (-841.778) (-842.570) [-850.201] (-843.230) * (-851.714) (-849.033) [-844.855] (-845.451) -- 0:03:57
64000 -- (-841.577) (-845.627) (-847.648) [-848.144] * (-851.413) [-843.272] (-843.166) (-840.502) -- 0:03:54
65000 -- (-844.365) [-839.178] (-854.384) (-849.141) * (-846.848) [-837.765] (-842.606) (-841.709) -- 0:04:04
Average standard deviation of split frequencies: 0.035712
66000 -- [-839.806] (-840.603) (-848.887) (-850.648) * [-844.966] (-847.896) (-852.949) (-848.160) -- 0:04:00
67000 -- (-849.209) [-843.785] (-839.672) (-837.594) * (-848.516) (-846.858) [-848.098] (-841.034) -- 0:03:56
68000 -- [-840.025] (-843.237) (-843.349) (-848.184) * (-844.600) (-849.592) [-839.828] (-846.605) -- 0:03:53
69000 -- (-845.256) (-843.293) (-846.865) [-839.035] * (-846.273) (-841.313) (-861.026) [-844.609] -- 0:04:02
70000 -- [-837.521] (-844.475) (-846.970) (-853.140) * (-843.858) (-840.432) (-847.938) [-841.693] -- 0:03:59
Average standard deviation of split frequencies: 0.040025
71000 -- (-845.804) (-852.708) [-850.349] (-840.313) * (-842.121) (-848.922) [-847.009] (-839.138) -- 0:03:55
72000 -- [-842.631] (-854.273) (-844.842) (-849.775) * [-840.415] (-846.738) (-843.014) (-842.659) -- 0:03:52
73000 -- (-845.441) [-844.862] (-849.493) (-847.713) * (-841.135) [-843.476] (-849.516) (-846.148) -- 0:04:01
74000 -- (-847.000) [-843.050] (-848.239) (-852.129) * [-843.496] (-846.014) (-851.480) (-840.321) -- 0:03:57
75000 -- [-852.641] (-845.902) (-844.521) (-842.777) * (-852.040) (-845.034) [-843.297] (-843.747) -- 0:03:54
Average standard deviation of split frequencies: 0.038344
76000 -- [-845.732] (-847.031) (-847.373) (-842.274) * (-847.198) (-851.232) [-837.753] (-849.999) -- 0:04:03
77000 -- (-840.981) [-844.306] (-849.569) (-847.527) * (-844.641) [-845.572] (-845.010) (-847.577) -- 0:03:59
78000 -- (-840.120) (-842.505) (-845.276) [-842.259] * (-846.595) [-838.268] (-843.459) (-843.590) -- 0:03:56
79000 -- (-841.541) (-842.587) (-850.551) [-844.940] * (-846.979) (-847.640) (-844.885) [-844.917] -- 0:03:53
80000 -- (-847.391) (-851.831) [-839.624] (-847.188) * (-843.904) (-844.393) [-846.023] (-852.799) -- 0:04:01
Average standard deviation of split frequencies: 0.034001
81000 -- (-857.233) [-846.420] (-842.271) (-844.004) * (-850.293) (-843.335) (-841.397) [-838.812] -- 0:03:58
82000 -- [-835.497] (-849.219) (-843.011) (-844.075) * (-841.343) [-843.123] (-835.875) (-844.387) -- 0:03:55
83000 -- (-846.052) [-844.207] (-848.245) (-853.319) * (-843.054) (-855.650) [-844.875] (-847.257) -- 0:03:52
84000 -- [-841.471] (-843.397) (-849.517) (-853.272) * [-835.332] (-848.177) (-847.675) (-852.408) -- 0:03:59
85000 -- (-842.017) [-844.834] (-854.298) (-842.986) * (-853.179) (-845.102) (-838.745) [-844.139] -- 0:03:56
Average standard deviation of split frequencies: 0.036377
86000 -- [-844.490] (-845.853) (-855.546) (-846.520) * (-843.286) (-850.471) [-842.952] (-844.262) -- 0:03:53
87000 -- (-839.947) [-847.509] (-848.259) (-845.830) * [-838.913] (-844.832) (-846.283) (-846.148) -- 0:03:50
88000 -- [-848.788] (-850.975) (-842.622) (-839.831) * (-853.751) [-853.061] (-843.340) (-855.876) -- 0:03:58
89000 -- [-838.116] (-843.727) (-848.634) (-847.343) * [-842.543] (-846.909) (-843.206) (-851.846) -- 0:03:55
90000 -- (-853.902) (-847.871) [-840.892] (-847.965) * [-843.357] (-848.039) (-845.162) (-847.108) -- 0:03:52
Average standard deviation of split frequencies: 0.034032
91000 -- (-847.062) (-839.903) [-844.108] (-849.235) * (-843.250) [-842.556] (-842.496) (-847.998) -- 0:03:49
92000 -- (-845.133) (-842.576) (-855.336) [-843.200] * (-846.576) (-839.960) [-839.080] (-852.905) -- 0:03:56
93000 -- (-845.096) (-839.119) [-845.450] (-843.275) * [-843.014] (-847.704) (-853.682) (-852.461) -- 0:03:54
94000 -- (-846.150) [-843.074] (-845.748) (-843.013) * (-840.331) (-836.419) [-840.446] (-848.099) -- 0:03:51
95000 -- (-844.383) [-843.646] (-837.252) (-843.626) * (-837.571) (-846.567) (-845.383) [-845.576] -- 0:03:58
Average standard deviation of split frequencies: 0.031248
96000 -- (-844.317) (-840.548) [-843.568] (-849.056) * [-844.093] (-843.441) (-851.230) (-844.885) -- 0:03:55
97000 -- (-841.718) [-837.305] (-839.476) (-854.820) * (-842.980) (-853.544) [-847.249] (-840.578) -- 0:03:52
98000 -- (-850.997) [-846.819] (-849.676) (-847.748) * (-863.604) [-842.980] (-851.895) (-844.175) -- 0:03:50
99000 -- (-847.419) (-846.186) [-840.995] (-851.697) * (-855.634) (-838.237) [-847.398] (-841.433) -- 0:03:56
100000 -- [-844.861] (-846.643) (-847.928) (-846.791) * [-835.034] (-846.332) (-846.179) (-842.406) -- 0:03:53
Average standard deviation of split frequencies: 0.028097
101000 -- [-839.270] (-858.424) (-843.015) (-849.013) * [-842.979] (-846.212) (-849.192) (-841.668) -- 0:03:51
102000 -- (-839.660) (-850.748) [-836.620] (-844.269) * (-847.721) [-844.933] (-850.974) (-854.284) -- 0:03:48
103000 -- (-849.333) (-846.880) [-840.980] (-861.276) * [-846.426] (-851.085) (-846.740) (-842.782) -- 0:03:55
104000 -- (-843.272) (-853.935) [-840.676] (-842.284) * [-843.855] (-854.997) (-838.319) (-847.131) -- 0:03:52
105000 -- (-840.105) (-849.441) (-843.519) [-840.279] * [-843.429] (-844.401) (-841.774) (-845.143) -- 0:03:50
Average standard deviation of split frequencies: 0.027492
106000 -- [-843.229] (-841.793) (-845.350) (-846.790) * (-845.911) [-839.426] (-845.027) (-853.486) -- 0:03:47
107000 -- [-837.253] (-847.420) (-843.218) (-848.742) * (-847.318) (-843.443) (-846.694) [-838.337] -- 0:03:53
108000 -- (-842.920) [-843.997] (-849.570) (-846.258) * [-844.280] (-854.842) (-853.882) (-849.916) -- 0:03:51
109000 -- [-843.619] (-846.585) (-841.647) (-847.230) * (-846.024) [-844.495] (-842.813) (-842.406) -- 0:03:48
110000 -- (-847.295) (-847.223) (-845.107) [-839.288] * [-839.057] (-849.167) (-851.016) (-848.985) -- 0:03:46
Average standard deviation of split frequencies: 0.027107
111000 -- (-843.809) (-845.568) (-844.249) [-841.198] * (-852.444) (-841.390) (-851.867) [-844.036] -- 0:03:52
112000 -- (-851.462) (-847.001) [-842.252] (-836.616) * (-848.477) [-841.450] (-843.870) (-844.919) -- 0:03:49
113000 -- (-841.654) [-844.356] (-847.445) (-836.772) * (-848.429) (-841.382) [-847.482] (-851.970) -- 0:03:47
114000 -- [-839.702] (-841.318) (-841.198) (-844.585) * [-838.189] (-841.841) (-846.508) (-844.094) -- 0:03:45
115000 -- (-854.508) (-849.805) [-839.437] (-848.075) * (-852.551) (-850.645) (-839.648) [-842.612] -- 0:03:50
Average standard deviation of split frequencies: 0.029555
116000 -- (-844.960) [-845.876] (-849.217) (-843.725) * (-850.123) (-838.956) [-847.192] (-846.718) -- 0:03:48
117000 -- (-838.438) [-844.072] (-844.752) (-849.186) * (-839.541) (-844.928) [-844.151] (-848.256) -- 0:03:46
118000 -- (-837.650) (-847.194) (-841.743) [-845.489] * (-840.892) (-852.691) [-840.251] (-845.534) -- 0:03:44
119000 -- (-846.790) (-848.121) [-839.346] (-844.122) * (-849.847) (-845.336) [-844.930] (-848.436) -- 0:03:49
120000 -- [-843.883] (-847.367) (-844.985) (-846.274) * [-844.529] (-846.988) (-837.126) (-847.058) -- 0:03:47
Average standard deviation of split frequencies: 0.029122
121000 -- (-856.875) [-843.418] (-838.619) (-848.409) * (-846.700) (-836.574) (-845.898) [-845.978] -- 0:03:45
122000 -- [-842.990] (-846.064) (-847.603) (-850.605) * (-842.107) (-841.207) [-849.734] (-858.302) -- 0:03:50
123000 -- (-843.941) [-841.477] (-842.960) (-847.194) * (-838.300) [-836.715] (-841.124) (-846.225) -- 0:03:48
124000 -- (-842.801) [-838.646] (-839.205) (-845.666) * (-840.665) (-836.346) [-842.092] (-842.947) -- 0:03:46
125000 -- (-848.503) (-857.310) [-844.761] (-846.172) * (-842.297) [-844.226] (-839.119) (-853.966) -- 0:03:44
Average standard deviation of split frequencies: 0.026189
126000 -- (-844.771) [-839.995] (-846.312) (-847.086) * (-842.252) (-849.308) [-840.189] (-849.637) -- 0:03:48
127000 -- (-847.114) (-851.714) [-838.963] (-840.112) * (-842.617) [-844.276] (-843.756) (-846.364) -- 0:03:46
128000 -- (-842.108) (-845.929) [-845.727] (-848.888) * (-852.180) (-840.063) [-844.734] (-841.547) -- 0:03:44
129000 -- (-843.931) [-841.736] (-846.247) (-846.973) * (-838.584) (-847.584) [-840.970] (-840.534) -- 0:03:42
130000 -- (-846.622) (-849.020) (-847.483) [-841.645] * (-855.006) (-841.952) [-838.486] (-842.262) -- 0:03:47
Average standard deviation of split frequencies: 0.022630
131000 -- (-846.663) (-847.088) (-841.275) [-843.206] * [-844.512] (-847.385) (-841.432) (-850.465) -- 0:03:45
132000 -- (-841.523) (-840.701) (-842.705) [-840.050] * [-841.575] (-844.291) (-842.590) (-838.661) -- 0:03:43
133000 -- (-843.904) (-846.065) [-838.635] (-856.257) * (-851.394) [-848.073] (-839.608) (-846.562) -- 0:03:41
134000 -- (-847.060) (-843.194) [-840.666] (-843.507) * (-845.194) (-850.973) (-835.883) [-842.525] -- 0:03:46
135000 -- (-839.619) (-853.320) (-846.913) [-842.563] * (-844.815) (-857.378) (-844.679) [-845.221] -- 0:03:44
Average standard deviation of split frequencies: 0.020797
136000 -- (-849.802) (-848.507) (-849.441) [-842.672] * (-841.973) (-858.115) (-842.593) [-840.969] -- 0:03:42
137000 -- (-844.350) (-846.113) (-850.501) [-840.402] * (-851.390) (-846.292) [-838.413] (-845.216) -- 0:03:46
138000 -- (-849.247) (-847.834) [-843.151] (-846.031) * [-847.807] (-853.654) (-838.874) (-857.751) -- 0:03:44
139000 -- [-844.004] (-848.553) (-847.768) (-844.263) * (-848.472) (-845.178) (-847.675) [-844.354] -- 0:03:42
140000 -- (-845.888) (-841.396) (-849.881) [-843.694] * [-844.866] (-847.616) (-844.121) (-845.729) -- 0:03:41
Average standard deviation of split frequencies: 0.022118
141000 -- [-841.152] (-843.899) (-842.916) (-848.648) * [-843.239] (-842.249) (-850.178) (-845.206) -- 0:03:45
142000 -- (-837.921) (-842.975) (-855.058) [-842.512] * (-839.350) (-842.136) [-841.796] (-844.147) -- 0:03:43
143000 -- (-843.769) [-846.266] (-848.054) (-844.840) * (-841.640) [-847.269] (-843.304) (-848.377) -- 0:03:41
144000 -- [-835.346] (-850.605) (-846.377) (-838.403) * [-838.982] (-839.954) (-853.268) (-846.078) -- 0:03:39
145000 -- (-845.596) (-840.634) (-845.668) [-840.046] * [-847.909] (-841.068) (-849.833) (-840.944) -- 0:03:44
Average standard deviation of split frequencies: 0.017758
146000 -- (-852.829) (-847.382) [-839.836] (-849.903) * [-839.249] (-843.198) (-849.438) (-843.205) -- 0:03:42
147000 -- [-837.304] (-843.395) (-849.679) (-840.245) * (-839.410) [-839.058] (-843.334) (-848.892) -- 0:03:40
148000 -- (-852.686) (-857.300) (-843.722) [-841.126] * (-844.580) (-848.283) (-854.687) [-837.125] -- 0:03:38
149000 -- (-843.785) (-848.231) [-844.247] (-846.351) * (-842.238) (-840.385) (-851.855) [-846.807] -- 0:03:42
150000 -- [-842.586] (-850.317) (-846.820) (-842.759) * (-851.484) [-844.680] (-855.903) (-838.916) -- 0:03:40
Average standard deviation of split frequencies: 0.016270
151000 -- (-841.762) (-854.318) [-835.946] (-842.155) * (-844.459) (-852.847) (-850.817) [-849.743] -- 0:03:39
152000 -- [-838.156] (-854.896) (-846.737) (-843.355) * (-849.531) (-850.541) (-847.595) [-847.515] -- 0:03:37
153000 -- (-841.966) (-848.836) (-848.614) [-842.193] * (-840.895) (-847.215) [-845.855] (-843.991) -- 0:03:41
154000 -- (-838.376) (-851.700) (-853.901) [-843.505] * (-843.601) [-842.374] (-848.187) (-843.272) -- 0:03:39
155000 -- (-841.608) (-848.421) (-843.440) [-847.693] * (-840.907) [-849.026] (-844.779) (-850.574) -- 0:03:38
Average standard deviation of split frequencies: 0.015109
156000 -- (-850.819) (-854.943) [-843.697] (-843.679) * [-842.703] (-850.791) (-851.762) (-846.246) -- 0:03:36
157000 -- (-840.572) (-854.735) (-849.747) [-841.895] * (-844.808) (-857.135) [-846.002] (-838.772) -- 0:03:40
158000 -- (-842.171) (-840.863) (-850.090) [-845.265] * [-843.190] (-844.963) (-852.885) (-839.532) -- 0:03:38
159000 -- (-848.088) (-845.239) [-847.555] (-853.777) * (-846.988) (-843.395) [-848.669] (-843.445) -- 0:03:36
160000 -- (-849.823) [-853.087] (-848.627) (-846.194) * [-842.789] (-844.005) (-837.444) (-852.191) -- 0:03:35
Average standard deviation of split frequencies: 0.015550
161000 -- (-844.287) [-839.658] (-843.120) (-848.184) * (-844.586) (-853.249) [-846.969] (-843.161) -- 0:03:38
162000 -- [-846.312] (-842.174) (-849.943) (-846.596) * (-850.929) [-838.784] (-865.613) (-840.369) -- 0:03:37
163000 -- (-851.062) (-841.416) [-842.780] (-844.618) * (-846.825) (-839.576) [-843.693] (-848.603) -- 0:03:35
164000 -- [-843.246] (-845.177) (-844.734) (-839.965) * (-843.823) (-844.690) (-841.012) [-838.307] -- 0:03:34
165000 -- [-846.168] (-847.231) (-840.026) (-855.347) * [-840.327] (-842.318) (-837.330) (-851.759) -- 0:03:37
Average standard deviation of split frequencies: 0.017607
166000 -- [-852.322] (-848.862) (-849.813) (-843.079) * (-844.557) (-855.393) [-841.369] (-847.241) -- 0:03:36
167000 -- [-845.416] (-842.927) (-847.759) (-843.666) * (-843.543) [-842.330] (-848.121) (-843.958) -- 0:03:34
168000 -- (-843.628) [-841.489] (-842.737) (-850.157) * (-847.681) [-836.978] (-857.400) (-842.666) -- 0:03:32
169000 -- (-851.102) [-837.966] (-845.090) (-845.239) * (-844.672) (-841.509) [-837.261] (-841.548) -- 0:03:36
170000 -- (-858.204) (-838.799) [-841.381] (-844.951) * (-842.580) (-848.526) (-848.254) [-849.768] -- 0:03:34
Average standard deviation of split frequencies: 0.017678
171000 -- (-851.011) (-841.307) (-848.983) [-842.381] * (-845.747) [-845.093] (-843.180) (-847.354) -- 0:03:33
172000 -- (-845.145) (-838.308) (-842.670) [-846.584] * [-847.496] (-854.708) (-848.844) (-842.715) -- 0:03:31
173000 -- [-841.645] (-844.095) (-844.355) (-853.043) * [-847.318] (-851.196) (-854.960) (-850.021) -- 0:03:35
174000 -- (-843.412) (-845.444) [-844.233] (-837.379) * (-843.075) [-848.837] (-844.205) (-841.714) -- 0:03:33
175000 -- (-847.726) (-845.828) (-846.308) [-845.694] * (-840.389) (-850.785) [-843.313] (-842.802) -- 0:03:32
Average standard deviation of split frequencies: 0.017142
176000 -- (-843.852) (-849.043) [-843.557] (-845.748) * (-844.167) (-849.118) [-850.555] (-848.442) -- 0:03:30
177000 -- [-844.496] (-836.515) (-851.659) (-843.180) * [-837.752] (-840.652) (-844.143) (-841.894) -- 0:03:33
178000 -- [-850.396] (-848.317) (-844.924) (-843.458) * (-848.796) [-844.958] (-841.319) (-846.769) -- 0:03:32
179000 -- [-846.112] (-848.983) (-844.901) (-843.515) * (-844.655) [-840.642] (-841.951) (-839.651) -- 0:03:30
180000 -- [-845.061] (-845.414) (-840.777) (-847.930) * [-849.635] (-841.411) (-848.870) (-843.279) -- 0:03:29
Average standard deviation of split frequencies: 0.015656
181000 -- (-850.370) [-845.710] (-849.010) (-848.828) * (-843.848) (-849.122) [-843.550] (-844.564) -- 0:03:32
182000 -- (-843.786) (-844.628) (-851.160) [-845.019] * (-851.851) (-845.601) (-847.549) [-840.787] -- 0:03:31
183000 -- (-844.335) (-848.921) (-848.251) [-849.192] * (-844.750) [-848.347] (-848.279) (-842.431) -- 0:03:29
184000 -- (-841.666) (-848.229) (-849.672) [-847.776] * (-836.784) (-845.825) [-844.520] (-845.862) -- 0:03:28
185000 -- (-845.260) (-848.269) [-844.689] (-852.955) * (-839.135) [-838.158] (-841.605) (-850.920) -- 0:03:31
Average standard deviation of split frequencies: 0.015207
186000 -- [-839.412] (-846.485) (-845.870) (-854.411) * (-844.217) (-851.270) [-844.408] (-841.488) -- 0:03:30
187000 -- (-846.957) (-839.704) (-843.447) [-842.542] * (-853.560) (-846.940) (-845.063) [-847.791] -- 0:03:28
188000 -- (-839.302) (-842.656) (-843.881) [-848.993] * (-847.076) (-847.306) [-846.553] (-845.332) -- 0:03:31
189000 -- (-842.562) (-842.911) [-841.293] (-844.567) * (-854.535) (-852.177) (-843.229) [-837.577] -- 0:03:30
190000 -- (-854.227) (-839.981) (-844.842) [-838.459] * [-842.185] (-852.389) (-846.895) (-845.432) -- 0:03:28
Average standard deviation of split frequencies: 0.015059
191000 -- (-843.496) (-842.529) (-846.396) [-848.931] * [-848.527] (-847.191) (-846.208) (-841.452) -- 0:03:27
192000 -- (-842.131) [-845.302] (-840.553) (-843.668) * [-844.197] (-845.014) (-840.525) (-838.441) -- 0:03:30
193000 -- (-836.921) (-850.129) (-848.091) [-841.007] * [-846.387] (-851.324) (-843.223) (-853.655) -- 0:03:29
194000 -- (-846.532) [-841.550] (-844.520) (-842.384) * [-838.825] (-850.398) (-841.517) (-848.517) -- 0:03:27
195000 -- [-845.834] (-841.428) (-846.675) (-854.298) * (-849.158) (-845.928) [-841.148] (-849.180) -- 0:03:26
Average standard deviation of split frequencies: 0.012463
196000 -- (-849.020) [-836.217] (-841.235) (-860.437) * (-843.911) (-845.896) (-841.790) [-841.505] -- 0:03:29
197000 -- (-846.273) (-843.351) [-851.024] (-846.897) * (-846.712) (-846.946) (-839.876) [-844.273] -- 0:03:27
198000 -- (-849.689) (-844.981) (-844.456) [-844.367] * [-847.947] (-851.468) (-849.602) (-845.379) -- 0:03:26
199000 -- (-844.523) (-847.112) (-849.981) [-839.534] * (-840.738) (-843.734) (-843.173) [-838.070] -- 0:03:25
200000 -- (-844.012) (-836.540) (-843.783) [-844.039] * (-847.261) (-844.568) (-844.940) [-845.956] -- 0:03:27
Average standard deviation of split frequencies: 0.011319
201000 -- (-842.458) [-841.358] (-845.288) (-840.658) * (-840.116) (-842.307) (-837.721) [-843.915] -- 0:03:26
202000 -- (-846.617) (-841.890) (-843.448) [-839.096] * (-850.025) [-844.768] (-839.679) (-837.038) -- 0:03:25
203000 -- (-848.589) (-841.368) (-843.151) [-844.109] * (-844.945) [-840.326] (-842.295) (-855.822) -- 0:03:24
204000 -- (-856.396) (-839.059) (-842.873) [-842.467] * (-847.806) [-845.005] (-840.291) (-851.399) -- 0:03:26
205000 -- (-855.823) (-845.524) [-838.651] (-839.058) * (-838.601) (-840.381) [-840.435] (-844.357) -- 0:03:25
Average standard deviation of split frequencies: 0.008945
206000 -- (-845.379) (-845.161) (-846.738) [-844.633] * [-846.222] (-851.655) (-844.781) (-854.190) -- 0:03:24
207000 -- [-840.765] (-850.844) (-843.264) (-844.621) * (-850.717) (-852.158) [-849.905] (-847.785) -- 0:03:23
208000 -- (-852.623) [-842.273] (-845.074) (-848.608) * (-847.903) (-847.120) [-843.381] (-839.793) -- 0:03:25
209000 -- (-848.397) [-848.119] (-839.351) (-836.637) * (-842.425) (-840.401) [-842.987] (-850.774) -- 0:03:24
210000 -- (-849.114) (-849.048) [-837.018] (-846.109) * (-843.092) (-852.073) (-852.974) [-839.157] -- 0:03:23
Average standard deviation of split frequencies: 0.009764
211000 -- [-850.775] (-847.047) (-846.971) (-849.297) * (-849.215) (-848.531) [-840.287] (-842.380) -- 0:03:21
212000 -- [-842.950] (-843.567) (-849.920) (-844.190) * [-844.132] (-844.340) (-844.718) (-843.320) -- 0:03:24
213000 -- (-841.553) [-839.685] (-851.251) (-836.321) * (-847.241) (-857.573) (-851.686) [-847.092] -- 0:03:23
214000 -- (-843.419) [-846.587] (-850.442) (-842.563) * (-843.700) (-846.151) [-847.945] (-837.231) -- 0:03:22
215000 -- [-839.177] (-844.477) (-851.297) (-841.183) * (-842.591) [-835.892] (-846.163) (-849.813) -- 0:03:20
Average standard deviation of split frequencies: 0.009325
216000 -- (-846.848) [-844.497] (-851.920) (-838.188) * [-839.357] (-842.454) (-842.938) (-850.866) -- 0:03:23
217000 -- (-843.554) (-844.934) [-840.678] (-856.027) * [-840.733] (-846.899) (-843.489) (-849.858) -- 0:03:22
218000 -- (-843.693) [-839.724] (-852.347) (-840.851) * [-842.472] (-843.667) (-844.513) (-850.824) -- 0:03:20
219000 -- (-841.065) (-845.608) (-848.921) [-842.994] * [-847.566] (-847.604) (-849.511) (-852.846) -- 0:03:19
220000 -- (-844.397) (-845.474) [-844.571] (-847.604) * [-841.021] (-838.173) (-842.727) (-848.011) -- 0:03:22
Average standard deviation of split frequencies: 0.011264
221000 -- (-841.045) (-839.753) [-848.684] (-848.305) * (-853.617) (-847.307) [-839.589] (-843.980) -- 0:03:20
222000 -- [-849.762] (-849.165) (-846.313) (-842.066) * (-842.578) (-843.098) [-839.473] (-850.067) -- 0:03:19
223000 -- [-839.806] (-849.183) (-852.923) (-847.933) * [-842.947] (-843.336) (-840.892) (-838.038) -- 0:03:18
224000 -- [-848.126] (-844.143) (-845.443) (-847.505) * [-841.236] (-845.780) (-847.692) (-844.641) -- 0:03:20
225000 -- (-851.709) (-855.844) (-855.722) [-847.390] * [-838.041] (-843.898) (-841.282) (-843.842) -- 0:03:19
Average standard deviation of split frequencies: 0.011946
226000 -- (-848.125) (-852.348) [-841.879] (-844.912) * [-846.822] (-847.640) (-850.992) (-844.275) -- 0:03:18
227000 -- (-848.885) (-845.965) [-839.412] (-848.715) * (-843.040) [-850.703] (-840.662) (-848.528) -- 0:03:17
228000 -- (-842.317) (-850.398) (-845.067) [-840.085] * (-844.935) (-844.479) [-843.801] (-840.603) -- 0:03:19
229000 -- (-846.579) [-852.954] (-840.892) (-844.448) * (-851.966) [-844.727] (-846.451) (-844.297) -- 0:03:18
230000 -- (-852.602) [-846.520] (-839.349) (-845.727) * (-840.845) (-846.816) [-846.425] (-842.047) -- 0:03:17
Average standard deviation of split frequencies: 0.011890
231000 -- (-848.369) (-850.791) (-847.604) [-849.125] * [-840.285] (-843.599) (-855.033) (-847.844) -- 0:03:16
232000 -- (-844.254) [-850.136] (-846.586) (-842.684) * (-848.900) [-844.665] (-850.717) (-846.019) -- 0:03:18
233000 -- (-849.886) [-842.279] (-842.674) (-849.855) * (-845.220) [-842.243] (-857.238) (-838.209) -- 0:03:17
234000 -- (-840.102) [-841.125] (-846.922) (-851.198) * (-844.813) [-843.194] (-844.403) (-838.748) -- 0:03:16
235000 -- [-843.004] (-837.901) (-852.401) (-844.007) * [-844.511] (-842.547) (-843.555) (-846.794) -- 0:03:15
Average standard deviation of split frequencies: 0.009806
236000 -- [-839.814] (-841.634) (-845.410) (-840.800) * (-846.767) (-842.787) (-847.244) [-839.452] -- 0:03:17
237000 -- [-836.235] (-844.341) (-850.451) (-853.856) * (-850.122) (-843.764) [-843.725] (-845.376) -- 0:03:16
238000 -- (-845.768) [-842.122] (-846.478) (-843.251) * [-845.818] (-843.015) (-844.366) (-855.854) -- 0:03:15
239000 -- (-850.466) (-843.625) [-837.071] (-844.781) * (-846.283) [-842.651] (-849.086) (-842.111) -- 0:03:14
240000 -- (-841.641) (-848.102) [-836.447] (-837.461) * (-849.550) [-842.448] (-841.424) (-847.866) -- 0:03:16
Average standard deviation of split frequencies: 0.009081
241000 -- (-844.673) [-840.274] (-836.008) (-849.334) * (-845.487) (-843.203) [-847.051] (-842.481) -- 0:03:15
242000 -- [-845.093] (-852.255) (-842.841) (-840.723) * (-842.612) [-846.712] (-844.625) (-848.475) -- 0:03:14
243000 -- (-842.083) (-846.260) [-846.154] (-838.613) * (-837.499) (-842.383) (-838.208) [-843.607] -- 0:03:13
244000 -- [-847.682] (-844.212) (-843.505) (-841.373) * [-846.612] (-851.016) (-845.797) (-854.725) -- 0:03:15
245000 -- [-854.006] (-839.302) (-852.175) (-850.984) * (-850.110) (-847.225) (-860.129) [-840.216] -- 0:03:14
Average standard deviation of split frequencies: 0.008362
246000 -- [-843.435] (-849.788) (-844.459) (-843.868) * (-850.437) (-852.376) [-843.148] (-854.642) -- 0:03:13
247000 -- [-849.811] (-843.194) (-839.696) (-850.852) * [-840.119] (-841.864) (-856.917) (-848.686) -- 0:03:12
248000 -- (-848.005) (-845.329) [-846.254] (-841.890) * (-843.303) (-840.841) [-847.664] (-843.001) -- 0:03:14
249000 -- (-843.558) (-860.511) [-845.392] (-846.589) * (-848.877) (-850.822) (-847.423) [-836.132] -- 0:03:13
250000 -- [-840.399] (-849.488) (-849.040) (-847.484) * (-843.720) (-856.941) (-843.714) [-842.337] -- 0:03:12
Average standard deviation of split frequencies: 0.009403
251000 -- [-843.380] (-837.776) (-848.180) (-845.588) * (-846.502) (-843.913) (-850.861) [-838.969] -- 0:03:10
252000 -- (-849.019) (-843.460) [-839.715] (-843.926) * (-853.866) (-840.832) [-839.607] (-845.154) -- 0:03:12
253000 -- [-844.197] (-848.939) (-849.611) (-837.081) * (-845.647) [-837.797] (-846.120) (-843.896) -- 0:03:11
254000 -- (-843.417) [-843.974] (-846.665) (-854.342) * (-852.743) (-847.113) (-843.977) [-841.662] -- 0:03:10
255000 -- [-843.712] (-854.193) (-841.409) (-840.284) * (-843.947) [-839.364] (-850.575) (-842.037) -- 0:03:09
Average standard deviation of split frequencies: 0.011551
256000 -- (-847.516) [-846.052] (-849.627) (-839.483) * [-837.949] (-840.685) (-837.642) (-847.529) -- 0:03:11
257000 -- (-839.444) (-844.714) [-843.781] (-847.653) * (-841.989) (-844.375) (-852.381) [-839.899] -- 0:03:10
258000 -- (-845.830) [-840.493] (-844.858) (-841.109) * (-847.751) [-844.821] (-847.260) (-850.495) -- 0:03:09
259000 -- (-841.421) [-839.981] (-846.509) (-846.599) * (-849.451) [-844.449] (-846.125) (-851.112) -- 0:03:11
260000 -- (-847.144) (-836.413) (-846.411) [-845.103] * (-843.769) (-843.836) (-840.046) [-851.440] -- 0:03:10
Average standard deviation of split frequencies: 0.012824
261000 -- (-850.857) (-847.258) (-842.108) [-841.824] * (-847.812) (-841.695) (-848.402) [-843.262] -- 0:03:09
262000 -- [-837.837] (-848.353) (-843.378) (-843.794) * (-847.172) [-844.815] (-853.580) (-841.619) -- 0:03:08
263000 -- (-839.935) (-844.656) [-837.890] (-849.593) * (-843.497) (-849.610) [-843.061] (-842.309) -- 0:03:10
264000 -- [-842.156] (-846.623) (-848.772) (-850.190) * [-841.953] (-845.777) (-842.790) (-843.180) -- 0:03:09
265000 -- (-841.102) [-838.849] (-845.784) (-843.252) * (-843.935) (-842.182) (-847.047) [-836.822] -- 0:03:08
Average standard deviation of split frequencies: 0.012889
266000 -- (-847.856) (-842.549) [-848.097] (-837.937) * [-847.034] (-841.739) (-842.992) (-833.337) -- 0:03:07
267000 -- [-844.529] (-840.843) (-845.769) (-838.938) * (-847.800) (-837.204) (-847.136) [-846.823] -- 0:03:09
268000 -- [-839.023] (-846.164) (-840.388) (-844.216) * [-840.135] (-845.013) (-838.721) (-852.128) -- 0:03:08
269000 -- (-845.106) [-843.749] (-843.947) (-844.448) * (-845.971) [-843.888] (-852.064) (-845.787) -- 0:03:07
270000 -- (-851.013) (-848.293) [-837.107] (-839.982) * [-844.273] (-841.969) (-843.338) (-843.798) -- 0:03:06
Average standard deviation of split frequencies: 0.012508
271000 -- (-842.258) [-839.111] (-849.521) (-844.400) * (-840.429) (-842.408) [-838.533] (-839.986) -- 0:03:08
272000 -- [-838.466] (-851.057) (-846.021) (-844.386) * (-844.315) (-846.317) (-849.627) [-841.519] -- 0:03:07
273000 -- (-846.512) [-843.795] (-846.884) (-845.156) * (-851.616) [-838.706] (-849.955) (-847.576) -- 0:03:06
274000 -- (-839.961) (-851.367) (-845.701) [-843.318] * (-845.388) [-851.314] (-844.066) (-850.498) -- 0:03:05
275000 -- [-847.005] (-848.889) (-850.161) (-838.447) * [-843.859] (-849.469) (-842.614) (-856.117) -- 0:03:07
Average standard deviation of split frequencies: 0.012266
276000 -- [-848.133] (-837.985) (-846.545) (-848.737) * [-849.032] (-839.689) (-847.416) (-848.963) -- 0:03:06
277000 -- (-841.389) [-846.932] (-847.128) (-844.479) * [-837.850] (-840.454) (-846.066) (-847.005) -- 0:03:05
278000 -- (-848.893) [-839.654] (-845.552) (-843.143) * (-853.133) (-847.490) (-845.120) [-839.619] -- 0:03:06
279000 -- (-845.106) (-851.757) [-841.176] (-844.308) * (-845.176) (-844.724) (-845.318) [-848.347] -- 0:03:06
280000 -- (-847.033) [-845.417] (-850.556) (-848.513) * [-842.532] (-841.469) (-849.072) (-847.433) -- 0:03:05
Average standard deviation of split frequencies: 0.012368
281000 -- (-851.683) (-857.346) [-840.228] (-848.301) * [-841.449] (-851.820) (-847.897) (-851.471) -- 0:03:04
282000 -- (-850.876) [-842.053] (-846.980) (-845.670) * [-847.960] (-848.932) (-841.203) (-849.219) -- 0:03:05
283000 -- (-860.086) [-842.167] (-856.061) (-842.343) * (-846.818) (-853.445) [-842.604] (-838.665) -- 0:03:04
284000 -- (-844.951) [-843.731] (-846.565) (-848.827) * (-850.169) (-848.209) [-844.839] (-845.363) -- 0:03:04
285000 -- (-861.041) (-837.871) [-846.579] (-841.380) * (-843.553) [-838.202] (-844.254) (-848.200) -- 0:03:03
Average standard deviation of split frequencies: 0.012587
286000 -- (-846.149) [-841.398] (-850.340) (-843.912) * (-844.649) (-836.853) (-835.981) [-848.190] -- 0:03:04
287000 -- (-841.286) (-856.683) [-845.281] (-842.239) * (-838.984) (-852.470) [-841.502] (-842.052) -- 0:03:03
288000 -- [-847.210] (-847.499) (-852.191) (-845.108) * (-845.935) (-846.724) [-840.655] (-847.472) -- 0:03:02
289000 -- (-843.815) (-855.984) [-846.035] (-848.914) * (-851.937) [-847.635] (-841.190) (-849.206) -- 0:03:02
290000 -- (-848.875) (-847.895) (-848.077) [-845.099] * [-847.991] (-845.696) (-848.827) (-848.774) -- 0:03:03
Average standard deviation of split frequencies: 0.013122
291000 -- (-846.205) (-844.593) [-843.620] (-849.932) * (-840.804) (-853.672) [-840.056] (-857.198) -- 0:03:02
292000 -- [-843.506] (-850.146) (-842.672) (-844.417) * [-846.386] (-853.060) (-837.570) (-842.698) -- 0:03:01
293000 -- (-847.810) (-857.020) (-849.336) [-841.063] * (-849.728) (-845.097) (-843.184) [-837.101] -- 0:03:00
294000 -- [-847.804] (-851.647) (-854.134) (-854.184) * (-845.120) (-851.007) (-846.905) [-840.109] -- 0:03:02
295000 -- (-851.212) (-846.003) (-855.193) [-846.125] * (-845.404) (-847.368) (-849.909) [-843.767] -- 0:03:01
Average standard deviation of split frequencies: 0.013030
296000 -- (-839.546) (-854.377) (-845.792) [-839.603] * (-851.968) (-843.277) [-838.867] (-849.738) -- 0:03:00
297000 -- [-841.792] (-844.156) (-849.168) (-844.782) * (-847.107) [-838.448] (-839.597) (-846.509) -- 0:02:59
298000 -- (-845.007) (-844.673) (-844.638) [-847.626] * (-847.332) (-839.330) [-844.073] (-846.227) -- 0:03:01
299000 -- (-848.823) (-856.201) (-850.870) [-843.818] * (-856.783) (-843.147) [-844.246] (-847.794) -- 0:03:00
300000 -- (-844.106) (-853.815) [-850.256] (-840.094) * (-853.381) (-847.466) [-840.894] (-849.806) -- 0:02:59
Average standard deviation of split frequencies: 0.013398
301000 -- [-843.328] (-844.506) (-842.646) (-847.911) * (-845.495) (-845.790) [-846.735] (-848.717) -- 0:02:58
302000 -- [-839.064] (-849.805) (-853.062) (-842.923) * (-848.958) (-840.595) [-843.011] (-849.271) -- 0:03:00
303000 -- (-849.892) [-841.164] (-847.949) (-841.833) * (-845.605) (-847.069) [-840.948] (-848.843) -- 0:02:59
304000 -- (-849.445) (-844.424) (-836.323) [-851.737] * (-841.014) (-848.286) [-844.289] (-838.674) -- 0:02:58
305000 -- [-842.184] (-846.135) (-843.500) (-848.815) * (-847.419) (-848.419) [-840.453] (-845.611) -- 0:02:57
Average standard deviation of split frequencies: 0.011484
306000 -- (-849.798) (-848.247) (-844.092) [-844.281] * (-844.823) [-840.650] (-841.607) (-848.128) -- 0:02:59
307000 -- (-846.794) (-842.236) (-843.688) [-845.385] * (-843.478) (-840.118) [-848.078] (-850.933) -- 0:02:58
308000 -- (-840.181) [-848.103] (-851.731) (-852.105) * (-850.259) [-848.515] (-841.351) (-850.588) -- 0:02:57
309000 -- [-840.770] (-854.730) (-841.047) (-845.727) * (-847.508) (-844.115) [-847.856] (-843.489) -- 0:02:56
310000 -- (-843.789) (-853.203) [-846.590] (-846.570) * [-839.427] (-846.322) (-845.174) (-847.017) -- 0:02:58
Average standard deviation of split frequencies: 0.012415
311000 -- [-848.590] (-845.973) (-846.015) (-844.564) * (-850.409) [-842.334] (-843.043) (-851.572) -- 0:02:57
312000 -- (-840.417) (-845.755) (-853.974) [-847.223] * (-850.320) [-840.920] (-836.388) (-851.078) -- 0:02:56
313000 -- (-835.478) (-843.734) [-843.038] (-846.976) * [-844.111] (-847.747) (-849.965) (-848.455) -- 0:02:55
314000 -- (-845.735) (-838.594) (-847.777) [-840.691] * (-843.690) (-841.473) [-839.930] (-855.456) -- 0:02:56
315000 -- [-841.326] (-843.851) (-845.038) (-839.156) * (-840.740) (-848.217) (-846.967) [-838.253] -- 0:02:56
Average standard deviation of split frequencies: 0.011934
316000 -- (-841.224) (-854.493) (-843.703) [-848.543] * (-849.899) (-840.409) (-847.406) [-843.955] -- 0:02:55
317000 -- [-844.005] (-846.332) (-842.204) (-842.422) * (-846.502) (-843.835) [-846.971] (-844.936) -- 0:02:54
318000 -- (-844.078) [-845.553] (-853.977) (-845.844) * (-842.982) [-843.492] (-847.514) (-848.823) -- 0:02:55
319000 -- (-844.153) [-843.232] (-855.794) (-854.951) * (-838.704) (-849.845) (-838.862) [-838.743] -- 0:02:55
320000 -- (-844.595) (-842.409) [-846.049] (-843.780) * (-845.870) (-845.468) [-839.960] (-840.052) -- 0:02:54
Average standard deviation of split frequencies: 0.012562
321000 -- (-845.480) [-838.253] (-852.189) (-842.227) * (-838.830) (-848.689) [-842.292] (-858.531) -- 0:02:55
322000 -- [-840.654] (-849.162) (-843.631) (-842.457) * (-845.246) (-849.532) [-839.325] (-844.476) -- 0:02:54
323000 -- (-843.473) (-842.171) (-846.589) [-842.212] * (-849.692) [-840.764] (-852.071) (-845.884) -- 0:02:53
324000 -- (-845.250) (-850.369) (-847.558) [-848.700] * [-845.989] (-847.076) (-844.850) (-860.957) -- 0:02:53
325000 -- (-858.501) (-853.730) [-851.560] (-842.787) * [-841.539] (-853.090) (-847.848) (-846.285) -- 0:02:54
Average standard deviation of split frequencies: 0.011963
326000 -- (-844.988) (-848.296) [-847.967] (-851.820) * [-841.896] (-851.900) (-849.096) (-845.268) -- 0:02:53
327000 -- (-847.654) (-845.100) [-842.513] (-843.349) * (-842.783) (-838.915) [-845.815] (-847.790) -- 0:02:52
328000 -- (-851.437) [-844.798] (-846.385) (-852.069) * (-852.395) [-850.517] (-846.093) (-847.834) -- 0:02:52
329000 -- (-844.102) [-843.907] (-847.140) (-838.196) * (-840.380) [-847.346] (-842.875) (-841.386) -- 0:02:53
330000 -- [-842.188] (-842.630) (-838.465) (-846.042) * (-850.004) (-842.648) [-848.035] (-847.558) -- 0:02:52
Average standard deviation of split frequencies: 0.012183
331000 -- [-839.934] (-847.073) (-842.857) (-845.319) * (-839.273) [-842.777] (-853.902) (-842.733) -- 0:02:51
332000 -- (-840.595) [-842.912] (-840.734) (-844.317) * [-843.952] (-849.006) (-855.037) (-844.927) -- 0:02:51
333000 -- (-841.399) [-842.778] (-846.672) (-843.215) * [-844.291] (-846.469) (-844.874) (-837.660) -- 0:02:52
334000 -- (-847.171) (-842.351) [-836.118] (-844.999) * (-854.980) (-849.174) (-840.462) [-838.130] -- 0:02:51
335000 -- [-842.965] (-849.880) (-839.808) (-848.590) * (-841.906) (-849.297) [-846.285] (-858.488) -- 0:02:50
Average standard deviation of split frequencies: 0.012117
336000 -- (-839.887) [-842.739] (-841.864) (-849.497) * (-842.679) [-847.726] (-839.040) (-842.659) -- 0:02:49
337000 -- (-844.328) [-841.586] (-846.388) (-846.089) * [-842.224] (-843.479) (-845.078) (-847.689) -- 0:02:51
338000 -- [-845.125] (-844.495) (-844.803) (-844.604) * (-851.383) (-844.468) (-846.530) [-842.510] -- 0:02:50
339000 -- [-845.509] (-845.888) (-840.763) (-848.709) * [-840.682] (-842.848) (-841.467) (-849.625) -- 0:02:49
340000 -- (-844.065) (-844.796) [-844.415] (-845.837) * (-849.547) (-847.385) [-840.260] (-839.931) -- 0:02:48
Average standard deviation of split frequencies: 0.010944
341000 -- (-845.962) (-840.023) (-841.142) [-845.312] * (-839.605) [-846.641] (-841.049) (-847.880) -- 0:02:50
342000 -- (-843.867) (-848.677) [-844.045] (-838.970) * (-844.445) (-843.727) [-837.123] (-846.373) -- 0:02:49
343000 -- [-844.331] (-848.322) (-839.269) (-840.357) * (-844.608) (-856.456) [-839.188] (-843.584) -- 0:02:48
344000 -- [-845.823] (-851.922) (-847.986) (-841.701) * (-845.638) [-843.636] (-844.686) (-850.560) -- 0:02:47
345000 -- (-850.859) (-840.598) (-854.570) [-843.645] * (-850.515) (-846.814) (-840.206) [-846.609] -- 0:02:48
Average standard deviation of split frequencies: 0.011643
346000 -- (-856.558) (-847.256) [-855.281] (-840.358) * (-847.861) [-849.211] (-840.170) (-843.071) -- 0:02:48
347000 -- (-845.898) (-847.701) (-845.421) [-842.382] * (-839.140) (-850.871) (-839.335) [-847.417] -- 0:02:47
348000 -- (-850.483) (-839.685) [-843.017] (-842.825) * (-842.169) [-838.093] (-847.546) (-854.104) -- 0:02:46
349000 -- [-847.307] (-842.228) (-848.971) (-842.590) * (-853.082) [-844.300] (-843.272) (-844.828) -- 0:02:47
350000 -- (-855.442) (-843.419) (-854.453) [-839.899] * (-852.148) [-848.625] (-842.314) (-861.705) -- 0:02:47
Average standard deviation of split frequencies: 0.013443
351000 -- (-848.898) (-848.250) [-839.214] (-857.589) * [-851.013] (-849.853) (-839.011) (-844.129) -- 0:02:46
352000 -- (-844.289) (-849.029) (-844.350) [-839.202] * (-842.750) (-850.352) [-837.350] (-843.537) -- 0:02:47
353000 -- [-848.070] (-841.683) (-839.325) (-841.018) * (-848.263) [-846.683] (-844.902) (-839.563) -- 0:02:46
354000 -- (-852.560) (-845.412) (-844.938) [-842.687] * (-848.913) [-844.673] (-845.809) (-851.991) -- 0:02:46
355000 -- [-851.309] (-846.110) (-845.691) (-839.211) * (-846.225) (-853.993) (-845.973) [-857.271] -- 0:02:45
Average standard deviation of split frequencies: 0.012760
356000 -- (-841.069) [-838.438] (-851.630) (-847.311) * (-850.034) (-867.820) [-847.026] (-849.183) -- 0:02:46
357000 -- [-845.616] (-844.857) (-845.004) (-845.467) * (-844.512) (-839.256) (-847.347) [-844.587] -- 0:02:45
358000 -- (-843.527) (-841.248) (-856.163) [-843.354] * (-848.741) (-851.687) [-847.749] (-854.453) -- 0:02:44
359000 -- (-849.048) (-843.812) (-847.253) [-842.143] * (-843.216) (-844.311) [-838.834] (-848.397) -- 0:02:44
360000 -- (-852.071) (-841.877) [-839.618] (-848.188) * [-841.980] (-842.490) (-845.868) (-851.845) -- 0:02:45
Average standard deviation of split frequencies: 0.012714
361000 -- (-847.716) (-844.605) [-847.468] (-841.582) * (-849.186) (-848.631) [-837.119] (-856.088) -- 0:02:44
362000 -- (-845.283) (-841.534) [-839.925] (-849.849) * (-858.708) (-845.048) [-840.599] (-842.371) -- 0:02:43
363000 -- (-843.996) (-846.146) [-840.509] (-842.818) * (-856.367) (-845.864) [-839.001] (-847.236) -- 0:02:43
364000 -- (-849.271) (-845.329) [-843.769] (-843.018) * (-846.036) (-851.445) [-842.750] (-844.581) -- 0:02:44
365000 -- (-852.674) (-844.705) (-845.038) [-841.912] * (-849.381) (-849.240) [-843.963] (-844.609) -- 0:02:43
Average standard deviation of split frequencies: 0.012412
366000 -- (-852.820) [-837.012] (-846.299) (-837.103) * [-848.546] (-844.129) (-841.220) (-843.250) -- 0:02:42
367000 -- (-842.434) (-845.535) (-842.187) [-842.914] * (-847.889) (-844.976) (-848.215) [-852.245] -- 0:02:42
368000 -- (-849.051) (-847.928) [-844.862] (-841.640) * [-839.343] (-847.789) (-847.352) (-838.578) -- 0:02:43
369000 -- (-848.439) [-840.977] (-848.746) (-847.291) * (-851.064) (-836.846) [-845.330] (-843.472) -- 0:02:42
370000 -- (-847.952) (-846.083) (-845.457) [-845.147] * (-842.488) (-845.468) (-843.857) [-843.011] -- 0:02:41
Average standard deviation of split frequencies: 0.012833
371000 -- (-844.109) (-845.652) (-842.902) [-846.393] * (-847.116) (-842.658) [-839.453] (-848.193) -- 0:02:41
372000 -- [-849.232] (-843.087) (-842.503) (-856.139) * (-849.844) (-854.203) (-844.754) [-846.128] -- 0:02:42
373000 -- (-848.176) (-846.929) [-838.826] (-849.246) * (-845.441) [-844.942] (-850.570) (-840.289) -- 0:02:41
374000 -- [-840.759] (-846.641) (-846.179) (-844.953) * (-842.050) (-851.188) [-846.597] (-847.756) -- 0:02:40
375000 -- (-846.270) [-849.371] (-849.221) (-838.171) * [-843.843] (-846.981) (-843.246) (-844.970) -- 0:02:40
Average standard deviation of split frequencies: 0.013107
376000 -- [-853.469] (-852.221) (-855.334) (-843.176) * (-840.105) (-847.618) [-847.866] (-857.374) -- 0:02:40
377000 -- [-842.644] (-842.937) (-843.437) (-839.626) * (-853.868) (-845.454) [-841.311] (-854.026) -- 0:02:40
378000 -- [-841.776] (-839.144) (-837.995) (-848.256) * (-847.856) (-844.186) (-847.073) [-848.596] -- 0:02:39
379000 -- (-843.505) (-843.330) (-845.065) [-841.022] * [-846.552] (-845.493) (-844.984) (-850.588) -- 0:02:38
380000 -- (-846.566) (-849.098) (-843.746) [-841.716] * (-840.973) [-839.185] (-845.536) (-843.174) -- 0:02:39
Average standard deviation of split frequencies: 0.013172
381000 -- [-840.733] (-851.409) (-854.328) (-841.674) * (-846.828) (-843.840) [-838.471] (-849.354) -- 0:02:39
382000 -- [-837.470] (-848.069) (-850.374) (-844.630) * (-837.579) (-849.901) (-844.785) [-844.581] -- 0:02:38
383000 -- (-844.195) [-851.034] (-846.525) (-850.251) * (-845.247) (-847.627) (-844.969) [-841.765] -- 0:02:37
384000 -- (-854.308) (-844.403) (-841.092) [-837.764] * [-844.527] (-843.244) (-838.571) (-842.409) -- 0:02:38
385000 -- (-854.178) (-847.210) [-849.542] (-847.193) * [-846.568] (-850.365) (-847.658) (-846.292) -- 0:02:38
Average standard deviation of split frequencies: 0.012102
386000 -- (-853.349) [-847.010] (-843.710) (-849.894) * (-846.460) [-844.409] (-844.851) (-844.750) -- 0:02:37
387000 -- (-840.750) (-847.316) [-844.386] (-840.238) * (-853.068) (-854.272) (-844.330) [-841.959] -- 0:02:36
388000 -- (-845.266) (-854.284) (-842.269) [-842.796] * (-844.996) (-853.000) [-843.377] (-842.128) -- 0:02:37
389000 -- (-854.966) [-843.189] (-843.809) (-844.073) * (-852.205) (-843.148) [-849.824] (-845.140) -- 0:02:37
390000 -- (-846.849) (-848.497) (-842.344) [-846.273] * [-839.856] (-839.845) (-844.296) (-847.661) -- 0:02:36
Average standard deviation of split frequencies: 0.011189
391000 -- (-844.528) (-842.688) [-847.314] (-841.369) * [-844.095] (-838.748) (-848.198) (-848.051) -- 0:02:37
392000 -- (-845.283) (-844.131) [-840.423] (-850.474) * [-843.786] (-837.691) (-839.868) (-839.171) -- 0:02:36
393000 -- (-843.655) (-845.377) (-842.332) [-841.870] * (-843.129) (-843.688) [-843.425] (-848.551) -- 0:02:35
394000 -- (-842.868) [-842.696] (-849.268) (-854.479) * (-843.685) (-841.984) [-842.576] (-847.100) -- 0:02:35
395000 -- (-842.573) (-844.910) [-852.515] (-847.472) * (-858.187) (-844.906) (-846.935) [-844.839] -- 0:02:36
Average standard deviation of split frequencies: 0.010173
396000 -- (-844.461) (-848.404) [-840.949] (-848.365) * (-842.107) (-853.102) (-842.435) [-843.948] -- 0:02:35
397000 -- (-840.144) [-841.103] (-851.090) (-848.471) * (-838.935) [-850.908] (-843.780) (-849.437) -- 0:02:34
398000 -- [-839.239] (-842.519) (-847.600) (-844.899) * [-842.752] (-846.655) (-842.551) (-846.431) -- 0:02:34
399000 -- (-846.559) (-837.762) [-851.905] (-846.297) * [-837.323] (-847.461) (-844.559) (-853.668) -- 0:02:35
400000 -- (-841.112) (-844.386) [-837.786] (-850.757) * (-847.187) [-839.579] (-845.575) (-849.361) -- 0:02:34
Average standard deviation of split frequencies: 0.010696
401000 -- [-845.409] (-841.168) (-848.519) (-843.568) * (-850.721) [-842.626] (-846.737) (-846.362) -- 0:02:33
402000 -- (-844.664) [-838.653] (-845.094) (-847.274) * (-846.451) (-850.080) [-844.960] (-845.856) -- 0:02:33
403000 -- (-836.317) (-837.249) [-838.448] (-847.240) * (-841.189) (-848.714) [-840.511] (-848.787) -- 0:02:34
404000 -- [-853.282] (-843.007) (-842.702) (-850.839) * (-847.855) (-842.922) [-847.613] (-851.498) -- 0:02:33
405000 -- (-848.205) (-841.823) (-845.254) [-839.822] * (-837.454) (-848.125) [-845.868] (-846.962) -- 0:02:32
Average standard deviation of split frequencies: 0.011189
406000 -- (-845.855) (-845.481) (-842.174) [-842.791] * [-844.712] (-839.752) (-847.460) (-846.393) -- 0:02:32
407000 -- (-848.276) (-859.909) (-838.966) [-843.055] * (-841.489) (-843.590) (-845.931) [-836.193] -- 0:02:32
408000 -- [-844.456] (-846.409) (-849.291) (-851.090) * [-846.228] (-847.434) (-856.455) (-841.226) -- 0:02:32
409000 -- (-851.710) (-845.644) [-854.283] (-851.984) * (-846.029) (-846.314) [-839.497] (-853.647) -- 0:02:31
410000 -- (-845.597) [-840.667] (-846.588) (-847.525) * (-848.668) [-845.010] (-844.544) (-843.114) -- 0:02:31
Average standard deviation of split frequencies: 0.010957
411000 -- (-842.945) [-839.318] (-841.582) (-853.093) * [-839.635] (-840.981) (-837.747) (-851.934) -- 0:02:31
412000 -- (-840.714) (-849.197) [-839.524] (-843.352) * (-838.924) [-839.599] (-845.403) (-842.390) -- 0:02:31
413000 -- (-844.230) [-845.256] (-847.272) (-844.368) * (-847.811) [-846.032] (-853.430) (-852.891) -- 0:02:30
414000 -- (-840.290) (-846.127) (-844.903) [-839.786] * [-846.904] (-848.477) (-839.991) (-852.187) -- 0:02:30
415000 -- (-843.346) (-847.727) (-840.724) [-839.607] * (-847.278) (-850.690) (-843.308) [-842.401] -- 0:02:30
Average standard deviation of split frequencies: 0.011641
416000 -- (-843.842) (-841.839) [-840.686] (-844.532) * [-841.599] (-835.714) (-850.313) (-849.394) -- 0:02:30
417000 -- (-853.598) (-836.245) [-841.515] (-842.197) * [-841.617] (-843.144) (-850.675) (-840.736) -- 0:02:29
418000 -- (-853.281) [-844.041] (-843.483) (-841.437) * (-847.535) [-841.092] (-843.603) (-844.905) -- 0:02:28
419000 -- [-849.955] (-846.269) (-845.914) (-846.287) * (-847.268) (-850.038) (-842.461) [-846.868] -- 0:02:29
420000 -- (-849.764) [-843.467] (-839.379) (-853.623) * (-837.277) (-848.488) [-838.957] (-842.509) -- 0:02:29
Average standard deviation of split frequencies: 0.011410
421000 -- (-846.293) (-859.331) [-843.190] (-849.706) * (-841.920) [-837.569] (-848.616) (-844.527) -- 0:02:28
422000 -- [-848.520] (-852.941) (-851.898) (-855.314) * (-852.043) (-841.072) (-846.674) [-846.494] -- 0:02:27
423000 -- [-843.299] (-855.549) (-851.188) (-848.664) * (-837.180) [-845.043] (-852.220) (-850.006) -- 0:02:28
424000 -- (-847.209) (-844.603) [-845.310] (-854.450) * (-855.505) (-851.715) [-844.512] (-843.094) -- 0:02:28
425000 -- (-851.814) (-863.577) [-843.265] (-855.397) * (-857.330) [-842.466] (-845.834) (-848.059) -- 0:02:27
Average standard deviation of split frequencies: 0.011871
426000 -- (-836.080) [-841.250] (-845.214) (-860.597) * [-847.779] (-849.275) (-843.614) (-845.806) -- 0:02:26
427000 -- (-856.634) [-853.323] (-846.049) (-846.873) * [-848.133] (-847.074) (-850.520) (-846.539) -- 0:02:27
428000 -- (-858.499) (-842.708) [-842.596] (-863.481) * (-842.287) [-844.614] (-850.665) (-842.768) -- 0:02:27
429000 -- (-846.407) (-846.186) (-848.445) [-849.892] * (-846.150) (-852.903) [-841.501] (-839.863) -- 0:02:26
430000 -- (-843.732) [-840.686] (-839.275) (-853.037) * (-844.162) (-852.234) (-850.636) [-837.185] -- 0:02:25
Average standard deviation of split frequencies: 0.012837
431000 -- (-846.647) (-846.872) [-847.321] (-850.675) * [-846.201] (-837.080) (-860.873) (-846.684) -- 0:02:26
432000 -- [-843.750] (-841.691) (-846.025) (-847.168) * (-848.997) [-843.862] (-847.011) (-846.447) -- 0:02:25
433000 -- (-846.064) (-848.591) (-844.181) [-847.356] * (-850.647) (-842.655) (-848.642) [-844.597] -- 0:02:25
434000 -- [-849.333] (-839.193) (-848.304) (-844.086) * [-847.000] (-853.679) (-841.743) (-843.499) -- 0:02:26
435000 -- (-846.506) [-846.751] (-841.335) (-839.930) * (-858.230) (-849.876) (-848.941) [-839.825] -- 0:02:25
Average standard deviation of split frequencies: 0.012778
436000 -- (-844.195) (-848.951) [-841.303] (-844.026) * (-850.228) (-844.720) (-844.338) [-847.688] -- 0:02:24
437000 -- (-853.729) (-840.716) [-840.422] (-847.609) * (-849.964) [-835.969] (-845.124) (-848.257) -- 0:02:24
438000 -- (-848.997) (-850.875) [-843.487] (-845.818) * (-851.617) (-844.978) [-840.929] (-838.430) -- 0:02:24
439000 -- (-843.085) (-843.962) (-839.691) [-843.499] * (-852.745) (-841.569) (-849.434) [-838.814] -- 0:02:24
440000 -- (-854.072) [-843.140] (-845.375) (-848.816) * (-845.443) [-844.835] (-857.371) (-846.801) -- 0:02:23
Average standard deviation of split frequencies: 0.013226
441000 -- (-848.182) (-845.488) [-842.497] (-844.653) * [-844.998] (-849.580) (-844.390) (-845.168) -- 0:02:23
442000 -- (-847.366) [-839.707] (-841.269) (-843.507) * (-851.205) [-844.708] (-843.229) (-845.980) -- 0:02:23
443000 -- [-843.069] (-845.455) (-845.726) (-849.217) * (-849.647) (-851.258) [-840.626] (-845.939) -- 0:02:23
444000 -- (-850.352) [-840.605] (-839.177) (-851.229) * (-844.939) [-841.794] (-844.198) (-847.847) -- 0:02:22
445000 -- [-845.856] (-839.740) (-849.408) (-848.197) * (-845.214) [-840.549] (-846.360) (-853.348) -- 0:02:22
Average standard deviation of split frequencies: 0.013068
446000 -- (-843.537) [-838.672] (-840.042) (-841.328) * (-843.601) (-840.116) (-846.219) [-849.898] -- 0:02:22
447000 -- (-842.140) (-845.393) [-841.400] (-846.137) * [-841.902] (-845.634) (-852.125) (-840.784) -- 0:02:22
448000 -- (-844.123) (-853.329) (-848.975) [-840.552] * [-839.382] (-847.161) (-844.678) (-846.217) -- 0:02:21
449000 -- (-836.449) (-844.973) (-843.542) [-844.028] * (-841.028) (-843.639) [-847.628] (-849.307) -- 0:02:21
450000 -- [-845.850] (-838.560) (-847.421) (-854.972) * (-841.266) (-847.078) (-845.826) [-839.491] -- 0:02:21
Average standard deviation of split frequencies: 0.012647
451000 -- (-850.786) (-845.738) [-840.638] (-840.873) * (-848.541) (-849.072) [-848.646] (-846.232) -- 0:02:21
452000 -- (-842.910) (-850.778) [-844.729] (-849.637) * (-844.073) (-851.299) (-847.709) [-848.984] -- 0:02:20
453000 -- [-848.107] (-846.860) (-847.265) (-846.031) * (-842.302) (-848.867) (-849.782) [-843.242] -- 0:02:20
454000 -- (-846.342) (-848.826) [-840.157] (-837.986) * (-850.231) (-853.719) [-842.439] (-842.913) -- 0:02:20
455000 -- [-837.753] (-840.905) (-849.276) (-840.817) * (-843.311) (-854.006) (-848.130) [-838.507] -- 0:02:20
Average standard deviation of split frequencies: 0.012311
456000 -- (-844.481) [-840.752] (-846.267) (-857.732) * (-842.465) [-845.569] (-838.931) (-853.476) -- 0:02:19
457000 -- [-840.335] (-845.762) (-843.238) (-842.325) * (-851.006) (-850.652) [-837.552] (-849.131) -- 0:02:19
458000 -- (-838.990) (-848.662) [-839.967] (-849.875) * (-845.112) [-844.672] (-843.475) (-839.130) -- 0:02:19
459000 -- (-841.083) (-844.285) [-842.488] (-841.890) * (-848.029) [-852.119] (-841.460) (-841.032) -- 0:02:19
460000 -- (-839.791) (-844.835) [-840.511] (-839.267) * (-858.312) [-842.802] (-845.181) (-845.797) -- 0:02:18
Average standard deviation of split frequencies: 0.012745
461000 -- (-843.227) (-845.670) [-844.709] (-848.631) * (-849.481) (-849.258) [-838.821] (-849.388) -- 0:02:17
462000 -- (-847.555) [-844.976] (-846.926) (-847.545) * (-853.630) (-838.949) (-839.803) [-845.228] -- 0:02:18
463000 -- (-850.201) (-842.203) [-844.187] (-844.211) * [-838.631] (-841.350) (-845.513) (-838.175) -- 0:02:18
464000 -- (-844.409) [-842.780] (-850.749) (-849.774) * [-844.842] (-846.012) (-845.813) (-841.438) -- 0:02:17
465000 -- (-846.210) [-842.815] (-845.432) (-841.851) * [-842.316] (-843.362) (-845.437) (-844.173) -- 0:02:16
Average standard deviation of split frequencies: 0.013243
466000 -- (-845.634) (-840.236) [-839.780] (-857.341) * (-848.359) (-857.383) [-842.717] (-843.004) -- 0:02:17
467000 -- (-853.302) [-843.094] (-843.757) (-839.262) * (-846.112) [-848.861] (-843.454) (-845.938) -- 0:02:16
468000 -- (-847.773) (-848.651) (-860.054) [-854.401] * (-862.968) (-851.020) [-842.670] (-845.503) -- 0:02:16
469000 -- (-844.599) (-850.386) (-840.985) [-846.425] * [-847.429] (-840.469) (-842.388) (-846.907) -- 0:02:15
470000 -- (-845.348) (-844.349) [-847.097] (-849.082) * (-840.599) (-845.372) [-839.776] (-847.349) -- 0:02:16
Average standard deviation of split frequencies: 0.012201
471000 -- [-842.590] (-847.005) (-848.218) (-844.067) * (-849.222) [-850.353] (-853.100) (-844.225) -- 0:02:15
472000 -- (-843.440) (-856.080) (-843.848) [-842.913] * (-847.149) [-843.564] (-850.411) (-847.240) -- 0:02:15
473000 -- [-845.035] (-841.602) (-841.574) (-847.928) * [-844.400] (-846.735) (-861.262) (-847.527) -- 0:02:14
474000 -- [-839.242] (-841.781) (-843.563) (-846.078) * (-846.260) (-839.347) (-857.070) [-839.162] -- 0:02:15
475000 -- (-842.740) (-847.182) (-840.436) [-844.345] * [-843.178] (-847.397) (-843.014) (-851.533) -- 0:02:14
Average standard deviation of split frequencies: 0.012424
476000 -- [-835.884] (-843.572) (-850.456) (-848.300) * (-844.834) (-838.227) (-841.434) [-843.432] -- 0:02:14
477000 -- (-842.364) [-844.245] (-838.536) (-843.158) * (-847.286) (-845.810) (-849.309) [-842.175] -- 0:02:13
478000 -- (-846.479) (-843.500) [-838.306] (-843.123) * (-843.899) (-841.038) [-849.356] (-839.418) -- 0:02:14
479000 -- (-840.109) (-842.293) [-844.813] (-854.151) * (-839.473) [-848.510] (-858.097) (-848.240) -- 0:02:13
480000 -- (-842.593) [-838.936] (-847.597) (-854.266) * [-845.634] (-845.399) (-844.255) (-847.275) -- 0:02:13
Average standard deviation of split frequencies: 0.012036
481000 -- (-842.476) (-849.871) [-837.320] (-856.040) * (-840.930) [-849.792] (-855.569) (-843.913) -- 0:02:12
482000 -- (-846.706) [-842.173] (-840.382) (-848.047) * (-844.827) (-851.841) (-849.102) [-838.357] -- 0:02:13
483000 -- (-854.684) (-849.542) (-839.684) [-845.976] * [-845.534] (-846.175) (-847.062) (-846.218) -- 0:02:12
484000 -- [-847.110] (-842.854) (-842.138) (-850.205) * (-844.623) (-842.395) [-839.202] (-853.263) -- 0:02:12
485000 -- (-852.382) (-846.717) (-841.114) [-849.479] * (-843.371) (-845.407) (-844.501) [-848.033] -- 0:02:11
Average standard deviation of split frequencies: 0.011375
486000 -- (-850.454) (-855.119) [-836.908] (-844.842) * (-848.968) (-840.336) (-846.798) [-837.228] -- 0:02:12
487000 -- [-845.970] (-846.916) (-853.603) (-846.554) * (-841.605) (-847.481) (-848.086) [-838.530] -- 0:02:11
488000 -- (-840.916) (-843.995) (-852.069) [-841.888] * [-845.435] (-845.603) (-847.475) (-839.160) -- 0:02:11
489000 -- (-845.424) (-844.692) (-841.134) [-840.206] * (-838.876) (-846.421) [-853.760] (-846.985) -- 0:02:10
490000 -- [-845.120] (-842.065) (-848.157) (-854.476) * (-846.690) [-840.587] (-844.812) (-851.851) -- 0:02:11
Average standard deviation of split frequencies: 0.011704
491000 -- (-849.614) [-841.821] (-845.486) (-845.337) * [-847.086] (-842.987) (-839.398) (-838.684) -- 0:02:10
492000 -- (-843.598) [-850.327] (-838.283) (-842.017) * (-852.246) [-839.147] (-841.478) (-845.601) -- 0:02:10
493000 -- (-845.173) [-846.766] (-844.735) (-850.197) * (-839.403) (-840.577) (-847.898) [-843.927] -- 0:02:10
494000 -- (-850.371) [-839.027] (-849.630) (-846.171) * (-843.292) [-847.445] (-846.348) (-855.838) -- 0:02:10
495000 -- (-843.102) [-843.152] (-845.832) (-848.864) * (-838.411) (-848.943) [-843.506] (-845.861) -- 0:02:09
Average standard deviation of split frequencies: 0.011923
496000 -- (-843.533) (-857.193) (-847.256) [-846.113] * (-849.123) (-850.041) (-840.022) [-848.006] -- 0:02:09
497000 -- (-840.571) (-840.251) [-840.745] (-840.466) * (-849.120) (-854.801) [-846.312] (-841.844) -- 0:02:09
498000 -- [-840.496] (-849.161) (-842.758) (-846.342) * (-846.279) (-852.309) (-848.271) [-846.645] -- 0:02:09
499000 -- [-841.235] (-856.556) (-839.536) (-844.360) * [-844.190] (-845.789) (-842.613) (-849.574) -- 0:02:08
500000 -- [-838.447] (-849.652) (-844.496) (-849.119) * (-846.917) (-849.435) [-840.260] (-850.305) -- 0:02:08
Average standard deviation of split frequencies: 0.011641
501000 -- [-852.815] (-848.214) (-839.792) (-852.407) * (-844.635) (-846.202) (-846.916) [-846.054] -- 0:02:08
502000 -- (-841.003) [-842.928] (-843.016) (-847.963) * (-837.517) [-849.661] (-850.921) (-848.485) -- 0:02:07
503000 -- (-845.220) (-847.304) [-840.931] (-845.644) * [-843.153] (-853.653) (-840.329) (-844.481) -- 0:02:07
504000 -- (-848.838) (-846.227) [-843.357] (-847.342) * (-846.203) (-845.736) [-844.140] (-853.979) -- 0:02:06
505000 -- (-846.909) (-840.587) (-847.430) [-839.921] * (-852.057) (-841.537) (-838.341) [-836.559] -- 0:02:07
Average standard deviation of split frequencies: 0.009909
506000 -- (-846.145) (-852.110) (-852.109) [-848.022] * (-851.860) (-852.807) (-849.952) [-839.470] -- 0:02:06
507000 -- [-843.963] (-843.725) (-842.264) (-843.784) * (-854.051) [-842.027] (-840.870) (-838.660) -- 0:02:06
508000 -- [-846.757] (-842.550) (-840.418) (-845.540) * [-842.443] (-845.919) (-845.074) (-841.669) -- 0:02:05
509000 -- (-857.426) (-849.482) [-844.472] (-850.501) * (-852.679) (-853.323) (-849.977) [-841.011] -- 0:02:06
510000 -- (-843.037) (-850.908) (-839.363) [-851.996] * [-845.325] (-852.034) (-851.386) (-848.221) -- 0:02:05
Average standard deviation of split frequencies: 0.010826
511000 -- (-843.832) [-843.199] (-841.566) (-848.956) * (-848.288) (-838.810) [-849.989] (-852.139) -- 0:02:05
512000 -- (-841.707) (-846.095) (-840.427) [-848.426] * (-851.286) [-839.504] (-849.074) (-844.830) -- 0:02:04
513000 -- (-845.620) (-847.653) (-845.153) [-847.812] * (-835.141) (-843.646) [-843.188] (-845.310) -- 0:02:05
514000 -- (-844.425) [-845.777] (-840.690) (-844.706) * (-847.837) (-844.759) (-840.901) [-843.418] -- 0:02:04
515000 -- (-848.422) [-840.582] (-842.762) (-841.191) * (-845.053) (-847.323) (-845.870) [-838.494] -- 0:02:04
Average standard deviation of split frequencies: 0.010797
516000 -- (-846.251) (-842.775) (-847.249) [-841.898] * (-845.527) (-839.496) [-840.775] (-847.241) -- 0:02:03
517000 -- (-849.965) [-842.186] (-842.253) (-847.111) * (-850.273) (-856.242) (-837.521) [-847.736] -- 0:02:04
518000 -- (-848.346) (-849.429) [-845.178] (-839.449) * (-840.794) (-844.330) (-842.374) [-845.705] -- 0:02:03
519000 -- (-846.747) [-845.098] (-842.699) (-847.454) * (-842.677) (-854.902) (-841.295) [-844.550] -- 0:02:03
520000 -- (-844.053) (-842.499) [-843.224] (-851.993) * (-841.828) (-847.025) [-844.190] (-852.075) -- 0:02:03
Average standard deviation of split frequencies: 0.010782
521000 -- (-839.414) [-848.601] (-849.899) (-843.458) * [-852.441] (-839.955) (-842.082) (-844.879) -- 0:02:03
522000 -- (-842.308) [-850.439] (-843.094) (-847.575) * (-847.247) (-843.874) [-844.772] (-853.435) -- 0:02:02
523000 -- (-856.026) [-841.869] (-852.237) (-840.644) * (-851.894) (-853.133) (-849.608) [-841.740] -- 0:02:02
524000 -- (-849.003) (-861.387) [-842.593] (-845.521) * (-842.946) (-843.295) (-848.092) [-843.279] -- 0:02:02
525000 -- [-843.055] (-847.393) (-844.806) (-849.207) * (-842.342) (-846.635) [-846.364] (-846.124) -- 0:02:02
Average standard deviation of split frequencies: 0.010917
526000 -- (-842.515) [-843.729] (-841.793) (-847.861) * [-845.494] (-843.478) (-846.899) (-847.286) -- 0:02:01
527000 -- (-851.980) (-849.582) [-853.429] (-843.742) * (-838.829) (-844.707) (-843.530) [-842.723] -- 0:02:01
528000 -- [-840.686] (-849.101) (-851.465) (-835.809) * (-838.910) (-845.453) (-847.682) [-842.996] -- 0:02:01
529000 -- (-845.112) (-857.207) (-841.975) [-845.966] * [-840.499] (-846.571) (-841.655) (-846.270) -- 0:02:01
530000 -- (-849.005) (-842.793) [-842.321] (-846.236) * [-842.748] (-843.779) (-857.129) (-841.083) -- 0:02:00
Average standard deviation of split frequencies: 0.009933
531000 -- (-849.172) [-839.827] (-847.662) (-844.025) * (-844.821) [-836.270] (-847.313) (-839.010) -- 0:02:00
532000 -- (-846.487) [-838.706] (-847.752) (-841.463) * [-840.699] (-840.560) (-844.098) (-844.416) -- 0:02:00
533000 -- (-846.157) (-844.868) [-848.107] (-847.310) * (-847.532) (-844.503) [-845.921] (-842.640) -- 0:02:00
534000 -- (-849.354) [-845.024] (-846.510) (-841.778) * (-842.407) (-852.664) [-848.676] (-842.853) -- 0:01:59
535000 -- (-847.577) (-838.624) (-846.222) [-841.028] * (-852.131) (-850.691) (-850.921) [-839.638] -- 0:01:59
Average standard deviation of split frequencies: 0.009514
536000 -- (-851.908) (-849.001) (-841.745) [-837.705] * (-852.486) (-842.357) (-851.252) [-848.755] -- 0:01:59
537000 -- [-841.875] (-847.697) (-840.691) (-861.834) * (-837.615) [-847.076] (-850.297) (-848.251) -- 0:01:58
538000 -- (-844.692) (-842.295) [-838.383] (-862.194) * (-852.271) (-849.835) [-843.176] (-845.881) -- 0:01:58
539000 -- (-844.837) [-847.429] (-836.764) (-847.024) * [-842.616] (-846.174) (-844.763) (-843.089) -- 0:01:58
540000 -- (-841.118) [-847.835] (-846.271) (-848.553) * (-845.900) (-843.473) (-844.365) [-843.802] -- 0:01:58
Average standard deviation of split frequencies: 0.009195
541000 -- (-856.945) (-846.520) [-845.161] (-846.673) * (-840.957) [-837.117] (-851.203) (-852.628) -- 0:01:57
542000 -- (-839.708) (-841.141) [-838.711] (-840.638) * (-848.280) (-851.561) (-851.786) [-843.772] -- 0:01:57
543000 -- (-843.039) [-846.849] (-852.571) (-846.187) * (-842.742) (-845.685) [-843.691] (-839.358) -- 0:01:56
544000 -- (-844.106) [-842.006] (-854.113) (-847.446) * (-844.349) [-837.366] (-843.495) (-839.802) -- 0:01:57
545000 -- (-845.392) (-842.603) (-852.877) [-842.604] * [-848.863] (-839.253) (-842.999) (-848.257) -- 0:01:56
Average standard deviation of split frequencies: 0.009497
546000 -- (-843.391) (-841.109) (-849.366) [-852.124] * (-841.881) (-855.210) (-840.200) [-843.719] -- 0:01:56
547000 -- [-842.614] (-840.452) (-840.258) (-842.995) * (-850.410) [-844.493] (-847.281) (-843.940) -- 0:01:55
548000 -- (-844.975) (-858.557) (-842.937) [-845.426] * (-848.398) (-853.630) (-840.529) [-843.058] -- 0:01:56
549000 -- [-847.355] (-848.889) (-842.701) (-849.215) * (-843.483) (-846.746) [-841.593] (-845.153) -- 0:01:55
550000 -- (-846.859) [-845.343] (-844.687) (-843.438) * (-841.312) [-836.415] (-847.475) (-845.585) -- 0:01:55
Average standard deviation of split frequencies: 0.009961
551000 -- [-842.729] (-850.203) (-845.255) (-847.072) * (-837.512) [-842.717] (-853.064) (-850.404) -- 0:01:55
552000 -- [-841.861] (-837.118) (-839.357) (-845.569) * (-840.664) (-846.371) (-842.325) [-844.684] -- 0:01:55
553000 -- (-842.394) [-840.248] (-840.799) (-850.708) * (-848.348) (-851.015) [-842.578] (-842.100) -- 0:01:54
554000 -- (-845.686) (-843.603) (-841.955) [-849.864] * (-839.527) (-849.639) (-861.980) [-844.440] -- 0:01:54
555000 -- (-844.347) (-842.597) (-840.735) [-842.745] * [-842.826] (-853.618) (-839.568) (-842.578) -- 0:01:54
Average standard deviation of split frequencies: 0.009943
556000 -- [-838.600] (-843.510) (-844.524) (-844.738) * (-841.329) [-838.888] (-849.636) (-850.717) -- 0:01:54
557000 -- (-842.809) (-847.604) (-845.179) [-845.554] * (-842.620) [-840.296] (-847.683) (-844.179) -- 0:01:53
558000 -- (-846.493) [-842.070] (-842.491) (-845.392) * (-854.634) (-843.117) (-844.551) [-841.383] -- 0:01:53
559000 -- (-845.084) (-845.451) (-849.689) [-846.344] * (-852.583) (-845.193) (-846.082) [-840.252] -- 0:01:53
560000 -- (-841.040) (-853.597) [-843.415] (-843.529) * (-845.420) (-846.357) (-850.260) [-847.120] -- 0:01:53
Average standard deviation of split frequencies: 0.009937
561000 -- (-853.400) (-846.010) [-841.535] (-845.131) * (-850.337) (-841.316) (-857.004) [-849.102] -- 0:01:52
562000 -- [-844.099] (-840.627) (-845.802) (-843.436) * (-845.173) (-854.319) (-845.772) [-840.574] -- 0:01:52
563000 -- (-847.502) (-842.007) [-840.620] (-853.027) * (-846.998) [-841.522] (-844.205) (-847.286) -- 0:01:52
564000 -- (-843.831) (-843.279) (-846.601) [-838.065] * (-845.672) (-843.203) [-844.802] (-852.338) -- 0:01:52
565000 -- (-850.301) [-843.083] (-837.316) (-839.006) * (-840.904) (-845.978) [-842.742] (-848.448) -- 0:01:51
Average standard deviation of split frequencies: 0.009464
566000 -- (-838.595) (-841.235) [-839.878] (-846.474) * (-849.573) (-850.699) [-843.357] (-849.112) -- 0:01:51
567000 -- [-843.655] (-846.639) (-848.454) (-840.181) * (-852.905) (-851.466) (-848.138) [-843.458] -- 0:01:51
568000 -- (-850.593) (-843.236) (-844.945) [-857.085] * (-842.666) [-850.046] (-842.102) (-844.173) -- 0:01:51
569000 -- (-843.656) [-841.266] (-842.819) (-848.247) * (-839.858) [-841.947] (-845.873) (-843.837) -- 0:01:50
570000 -- (-844.995) (-843.765) [-838.064] (-841.767) * (-845.432) (-838.215) [-845.478] (-844.681) -- 0:01:50
Average standard deviation of split frequencies: 0.009988
571000 -- (-841.326) (-843.418) (-848.260) [-845.078] * [-848.659] (-845.924) (-849.014) (-841.089) -- 0:01:50
572000 -- (-845.030) (-847.203) [-835.480] (-838.488) * (-842.098) (-852.151) [-838.641] (-843.184) -- 0:01:49
573000 -- (-850.359) (-840.757) [-843.429] (-848.842) * (-841.329) [-844.780] (-853.027) (-849.362) -- 0:01:49
574000 -- (-849.967) (-846.737) (-841.311) [-838.058] * [-839.017] (-854.729) (-850.494) (-838.965) -- 0:01:49
575000 -- [-841.489] (-837.370) (-845.123) (-852.674) * (-841.824) [-848.247] (-853.905) (-839.432) -- 0:01:49
Average standard deviation of split frequencies: 0.010193
576000 -- [-844.575] (-843.157) (-847.380) (-845.599) * (-848.501) (-848.714) (-849.727) [-843.532] -- 0:01:48
577000 -- (-850.375) (-847.309) [-835.304] (-839.946) * [-842.166] (-854.286) (-843.140) (-844.016) -- 0:01:48
578000 -- (-847.406) (-843.872) (-836.922) [-847.105] * (-850.742) [-843.844] (-844.863) (-840.600) -- 0:01:48
579000 -- (-838.750) (-848.239) (-839.349) [-840.206] * (-838.435) [-842.984] (-849.274) (-847.997) -- 0:01:48
580000 -- [-838.584] (-843.556) (-848.689) (-848.174) * [-836.604] (-843.284) (-839.933) (-844.699) -- 0:01:47
Average standard deviation of split frequencies: 0.009816
581000 -- (-850.133) (-844.906) [-846.422] (-851.105) * [-847.450] (-837.979) (-853.106) (-846.901) -- 0:01:47
582000 -- (-845.961) [-843.372] (-845.249) (-849.251) * [-847.097] (-843.572) (-850.999) (-850.269) -- 0:01:47
583000 -- [-840.729] (-843.631) (-844.844) (-844.140) * (-847.508) [-838.886] (-840.514) (-846.704) -- 0:01:47
584000 -- (-842.706) (-843.058) [-843.645] (-841.327) * (-839.611) (-849.521) [-844.235] (-841.027) -- 0:01:46
585000 -- (-848.488) [-846.146] (-844.560) (-850.435) * (-837.584) (-847.555) (-848.114) [-843.310] -- 0:01:46
Average standard deviation of split frequencies: 0.009726
586000 -- (-848.983) [-845.829] (-849.744) (-851.275) * (-848.274) (-849.219) (-848.506) [-842.380] -- 0:01:45
587000 -- [-845.433] (-842.896) (-842.990) (-842.826) * (-855.015) (-838.537) [-839.043] (-841.630) -- 0:01:46
588000 -- (-847.113) (-843.507) (-843.450) [-848.970] * [-852.200] (-839.102) (-851.428) (-840.552) -- 0:01:45
589000 -- (-840.478) [-846.310] (-848.640) (-840.773) * [-838.813] (-845.959) (-847.552) (-845.443) -- 0:01:45
590000 -- [-840.268] (-847.146) (-852.230) (-844.716) * (-848.677) (-846.618) [-843.408] (-843.184) -- 0:01:44
Average standard deviation of split frequencies: 0.009505
591000 -- [-843.500] (-843.014) (-846.457) (-845.073) * (-841.842) [-838.498] (-845.815) (-849.246) -- 0:01:45
592000 -- [-842.213] (-850.009) (-851.340) (-841.197) * (-844.690) (-841.076) (-842.587) [-848.324] -- 0:01:44
593000 -- [-837.998] (-841.985) (-845.733) (-846.208) * (-844.993) [-842.600] (-841.872) (-848.511) -- 0:01:44
594000 -- [-838.266] (-848.897) (-855.541) (-849.989) * [-845.762] (-846.895) (-840.614) (-845.784) -- 0:01:44
595000 -- (-838.850) [-842.454] (-836.569) (-850.726) * (-843.176) (-837.613) [-839.860] (-854.331) -- 0:01:44
Average standard deviation of split frequencies: 0.009348
596000 -- (-842.179) (-846.594) [-839.821] (-849.337) * (-844.849) (-845.329) [-836.053] (-849.694) -- 0:01:43
597000 -- (-845.116) [-843.898] (-842.117) (-841.894) * (-841.874) (-851.012) [-835.938] (-842.830) -- 0:01:43
598000 -- [-834.757] (-846.539) (-844.025) (-840.189) * [-843.030] (-851.381) (-850.029) (-837.366) -- 0:01:43
599000 -- (-839.102) (-851.264) (-843.002) [-839.804] * [-840.906] (-845.575) (-856.116) (-851.525) -- 0:01:43
600000 -- (-848.501) [-840.600] (-846.241) (-848.575) * (-851.740) (-840.897) [-842.866] (-845.671) -- 0:01:42
Average standard deviation of split frequencies: 0.008918
601000 -- (-840.608) (-858.084) (-851.416) [-854.354] * (-850.352) (-849.705) (-840.181) [-841.775] -- 0:01:42
602000 -- (-838.117) [-848.283] (-844.860) (-844.233) * (-841.597) (-855.727) [-845.796] (-850.914) -- 0:01:42
603000 -- (-861.706) (-849.461) (-838.921) [-842.438] * [-837.088] (-843.784) (-854.221) (-844.766) -- 0:01:42
604000 -- (-845.524) (-847.071) [-840.623] (-844.639) * [-844.062] (-846.443) (-844.963) (-845.659) -- 0:01:41
605000 -- (-852.974) (-844.317) [-841.266] (-847.152) * (-837.346) [-842.763] (-848.084) (-860.006) -- 0:01:41
Average standard deviation of split frequencies: 0.008769
606000 -- (-850.271) [-840.994] (-843.746) (-846.541) * (-842.901) (-846.392) (-843.692) [-845.667] -- 0:01:41
607000 -- (-843.462) (-843.078) [-846.628] (-845.889) * (-840.928) (-855.353) (-847.872) [-841.401] -- 0:01:41
608000 -- [-839.744] (-846.094) (-843.954) (-846.054) * (-846.463) [-841.243] (-851.208) (-849.654) -- 0:01:40
609000 -- (-846.871) (-847.498) (-846.888) [-840.288] * (-836.631) (-844.960) (-841.018) [-840.095] -- 0:01:40
610000 -- (-844.929) [-842.998] (-845.953) (-843.207) * (-849.489) [-841.832] (-855.724) (-842.287) -- 0:01:40
Average standard deviation of split frequencies: 0.008211
611000 -- (-841.101) (-846.932) [-836.741] (-841.667) * [-844.717] (-855.162) (-848.311) (-845.225) -- 0:01:39
612000 -- (-848.115) (-844.369) [-842.037] (-836.358) * (-850.813) (-844.137) (-843.826) [-841.029] -- 0:01:39
613000 -- (-849.985) (-850.753) [-839.820] (-851.676) * (-843.446) (-848.833) [-842.120] (-845.018) -- 0:01:39
614000 -- (-839.932) [-842.510] (-851.314) (-837.111) * [-843.156] (-837.826) (-840.898) (-846.581) -- 0:01:39
615000 -- (-846.525) (-845.634) (-841.634) [-845.934] * [-840.638] (-864.117) (-845.927) (-842.233) -- 0:01:38
Average standard deviation of split frequencies: 0.008418
616000 -- (-843.241) (-840.837) [-841.799] (-846.396) * (-852.808) (-842.161) (-848.519) [-840.232] -- 0:01:38
617000 -- (-839.529) (-850.518) [-847.987] (-847.491) * (-850.472) (-842.163) [-842.107] (-849.102) -- 0:01:38
618000 -- [-845.216] (-845.469) (-840.741) (-849.175) * [-837.446] (-844.074) (-855.310) (-849.677) -- 0:01:38
619000 -- (-850.569) (-848.252) (-839.997) [-847.322] * [-841.021] (-848.522) (-847.564) (-847.102) -- 0:01:37
620000 -- [-842.051] (-844.658) (-845.260) (-846.286) * [-838.311] (-856.587) (-840.612) (-844.288) -- 0:01:37
Average standard deviation of split frequencies: 0.008078
621000 -- (-842.846) (-842.870) (-847.180) [-839.424] * (-843.424) (-855.094) (-841.093) [-836.507] -- 0:01:37
622000 -- [-840.635] (-841.637) (-847.016) (-842.880) * [-836.685] (-840.186) (-852.487) (-844.493) -- 0:01:37
623000 -- (-844.370) [-843.188] (-842.308) (-841.692) * (-846.191) (-841.966) [-847.612] (-845.822) -- 0:01:36
624000 -- (-846.215) (-850.875) [-846.245] (-851.678) * [-839.879] (-843.421) (-846.022) (-841.118) -- 0:01:36
625000 -- (-844.857) (-842.219) [-839.763] (-846.074) * [-839.042] (-843.038) (-841.615) (-839.543) -- 0:01:36
Average standard deviation of split frequencies: 0.007941
626000 -- (-844.581) (-845.911) (-847.105) [-843.707] * (-845.083) [-851.623] (-846.933) (-841.105) -- 0:01:36
627000 -- (-852.789) (-839.546) [-838.037] (-843.761) * (-852.491) [-842.193] (-843.949) (-849.452) -- 0:01:35
628000 -- (-844.540) (-846.641) [-846.358] (-858.443) * (-841.807) [-841.702] (-842.209) (-857.032) -- 0:01:35
629000 -- (-844.108) [-850.166] (-847.149) (-841.978) * [-841.156] (-845.245) (-843.857) (-837.130) -- 0:01:35
630000 -- (-840.446) [-841.916] (-847.930) (-852.245) * [-845.070] (-850.045) (-840.158) (-850.515) -- 0:01:35
Average standard deviation of split frequencies: 0.007475
631000 -- (-847.014) [-843.706] (-844.618) (-845.802) * (-847.349) (-845.564) (-847.645) [-844.872] -- 0:01:34
632000 -- [-843.834] (-845.208) (-845.441) (-851.720) * (-843.001) (-841.818) (-846.026) [-839.818] -- 0:01:34
633000 -- [-841.622] (-843.771) (-843.516) (-849.807) * (-843.936) [-838.953] (-845.238) (-848.871) -- 0:01:34
634000 -- [-842.192] (-843.194) (-841.659) (-845.541) * [-849.576] (-843.078) (-846.573) (-859.481) -- 0:01:34
635000 -- (-847.450) [-840.049] (-838.457) (-850.594) * [-851.356] (-852.349) (-847.838) (-840.247) -- 0:01:33
Average standard deviation of split frequencies: 0.007884
636000 -- (-851.109) [-841.316] (-841.281) (-848.203) * (-849.397) (-848.408) (-848.189) [-845.153] -- 0:01:33
637000 -- (-852.129) [-838.697] (-855.259) (-850.199) * (-841.572) [-843.501] (-847.128) (-843.771) -- 0:01:33
638000 -- (-840.108) (-850.739) [-838.781] (-848.136) * (-843.025) (-848.945) (-848.555) [-840.671] -- 0:01:33
639000 -- [-851.653] (-840.107) (-837.136) (-847.050) * (-848.190) (-853.451) (-841.457) [-839.844] -- 0:01:32
640000 -- (-851.292) (-840.418) [-840.535] (-843.733) * (-843.863) (-844.887) [-846.347] (-848.290) -- 0:01:32
Average standard deviation of split frequencies: 0.008295
641000 -- (-843.837) (-846.430) [-846.426] (-841.028) * (-849.882) (-842.769) [-840.595] (-842.787) -- 0:01:32
642000 -- (-847.381) (-843.580) (-849.797) [-841.469] * (-840.493) [-845.015] (-847.270) (-843.556) -- 0:01:32
643000 -- (-847.353) (-843.411) [-843.409] (-851.626) * (-840.672) [-844.649] (-844.190) (-847.144) -- 0:01:31
644000 -- (-853.661) [-848.104] (-843.563) (-847.001) * (-847.822) (-842.663) [-840.148] (-845.197) -- 0:01:31
645000 -- [-842.710] (-864.864) (-853.631) (-846.263) * (-853.424) (-843.265) [-847.806] (-843.595) -- 0:01:31
Average standard deviation of split frequencies: 0.008160
646000 -- (-851.966) (-842.412) (-846.550) [-839.500] * (-847.739) [-847.684] (-845.110) (-844.543) -- 0:01:30
647000 -- (-849.180) (-841.918) [-844.005] (-848.708) * [-841.079] (-845.152) (-840.745) (-850.394) -- 0:01:30
648000 -- (-843.005) (-852.893) [-842.108] (-843.508) * [-843.848] (-845.294) (-841.908) (-843.170) -- 0:01:30
649000 -- [-840.355] (-854.747) (-839.036) (-858.175) * [-850.576] (-843.261) (-849.344) (-842.840) -- 0:01:30
650000 -- (-858.937) [-841.918] (-847.394) (-850.098) * (-845.234) [-845.192] (-844.494) (-847.352) -- 0:01:29
Average standard deviation of split frequencies: 0.007706
651000 -- (-837.162) [-840.691] (-844.940) (-840.217) * (-844.315) [-848.572] (-847.763) (-848.018) -- 0:01:29
652000 -- [-843.850] (-839.186) (-842.237) (-845.041) * (-845.252) (-854.719) [-844.219] (-850.521) -- 0:01:29
653000 -- (-851.189) [-849.834] (-841.607) (-852.078) * (-837.839) [-843.425] (-854.588) (-844.344) -- 0:01:29
654000 -- (-842.409) (-843.995) (-841.378) [-844.850] * (-841.100) [-835.037] (-855.235) (-843.385) -- 0:01:28
655000 -- (-846.060) (-844.298) [-844.908] (-847.995) * [-842.434] (-841.462) (-849.238) (-855.597) -- 0:01:28
Average standard deviation of split frequencies: 0.007251
656000 -- [-837.173] (-842.739) (-843.931) (-843.554) * [-844.456] (-840.475) (-847.579) (-846.593) -- 0:01:28
657000 -- (-849.380) (-851.820) (-840.609) [-843.804] * (-848.513) [-847.427] (-842.440) (-844.811) -- 0:01:28
658000 -- (-847.101) (-843.966) [-840.124] (-846.296) * (-855.947) [-842.018] (-845.070) (-853.809) -- 0:01:27
659000 -- (-855.495) (-847.858) (-842.153) [-841.394] * (-846.799) (-842.130) (-850.503) [-843.423] -- 0:01:27
660000 -- [-849.704] (-837.344) (-841.487) (-850.354) * [-845.049] (-845.864) (-852.306) (-845.904) -- 0:01:27
Average standard deviation of split frequencies: 0.007460
661000 -- (-848.608) (-843.986) (-842.621) [-843.042] * (-847.003) (-839.914) (-851.020) [-841.363] -- 0:01:27
662000 -- (-847.174) (-850.331) (-845.943) [-840.372] * (-848.819) [-845.884] (-844.288) (-847.321) -- 0:01:26
663000 -- (-844.862) [-838.751] (-845.683) (-856.248) * (-846.458) (-854.012) (-853.808) [-847.976] -- 0:01:26
664000 -- (-849.641) [-845.722] (-854.829) (-841.001) * (-852.096) (-847.884) (-858.380) [-847.282] -- 0:01:26
665000 -- [-843.055] (-858.801) (-859.798) (-848.213) * (-852.203) (-845.547) [-839.756] (-838.646) -- 0:01:26
Average standard deviation of split frequencies: 0.007786
666000 -- (-856.241) (-844.776) (-849.851) [-843.235] * (-852.556) (-850.322) (-841.550) [-835.931] -- 0:01:25
667000 -- [-841.726] (-849.940) (-851.168) (-848.167) * (-844.858) (-836.087) [-843.272] (-837.851) -- 0:01:25
668000 -- (-839.842) [-840.436] (-846.351) (-844.872) * (-846.614) (-844.166) [-839.404] (-841.720) -- 0:01:25
669000 -- (-845.846) [-843.063] (-856.079) (-842.945) * [-853.143] (-838.713) (-846.855) (-845.505) -- 0:01:25
670000 -- (-844.499) (-850.286) [-839.026] (-842.278) * (-842.037) (-838.041) (-846.479) [-846.971] -- 0:01:24
Average standard deviation of split frequencies: 0.007029
671000 -- (-852.274) (-844.724) (-843.452) [-845.689] * (-840.715) [-841.954] (-850.427) (-846.317) -- 0:01:24
672000 -- (-841.832) [-846.408] (-844.148) (-860.254) * [-843.853] (-841.703) (-842.249) (-841.217) -- 0:01:24
673000 -- (-843.622) [-841.883] (-842.955) (-849.612) * (-840.513) [-847.473] (-850.468) (-846.392) -- 0:01:24
674000 -- [-848.459] (-848.041) (-843.305) (-844.303) * (-850.728) [-842.833] (-844.256) (-850.114) -- 0:01:23
675000 -- (-849.032) [-838.314] (-841.819) (-853.703) * (-842.537) (-840.122) (-839.889) [-839.579] -- 0:01:23
Average standard deviation of split frequencies: 0.007164
676000 -- (-845.058) (-848.382) [-843.846] (-848.420) * (-844.540) (-842.128) (-850.608) [-840.703] -- 0:01:23
677000 -- (-843.973) [-845.049] (-846.112) (-845.217) * (-838.793) [-841.598] (-845.096) (-850.036) -- 0:01:23
678000 -- [-844.372] (-860.187) (-847.011) (-849.592) * [-845.490] (-849.366) (-844.028) (-849.181) -- 0:01:22
679000 -- [-842.202] (-844.837) (-847.670) (-846.796) * (-843.743) (-855.188) (-844.795) [-844.308] -- 0:01:22
680000 -- (-847.032) (-842.332) [-841.473] (-842.385) * [-843.513] (-849.773) (-842.187) (-851.551) -- 0:01:22
Average standard deviation of split frequencies: 0.006296
681000 -- [-844.707] (-845.282) (-842.187) (-841.322) * (-841.844) [-845.573] (-847.081) (-855.921) -- 0:01:21
682000 -- (-840.778) (-855.319) (-841.833) [-844.880] * [-842.658] (-837.494) (-847.138) (-840.703) -- 0:01:21
683000 -- [-844.287] (-851.089) (-841.333) (-845.126) * [-838.319] (-847.867) (-845.726) (-844.007) -- 0:01:21
684000 -- (-850.225) (-846.627) [-841.235] (-844.262) * [-848.599] (-845.125) (-856.876) (-844.964) -- 0:01:21
685000 -- (-844.626) (-844.195) [-843.967] (-840.672) * [-843.692] (-851.331) (-848.836) (-842.889) -- 0:01:20
Average standard deviation of split frequencies: 0.006934
686000 -- [-840.825] (-848.987) (-852.062) (-849.119) * (-842.667) (-843.627) (-843.410) [-847.447] -- 0:01:20
687000 -- [-845.762] (-842.257) (-849.500) (-845.702) * (-849.052) [-843.573] (-846.811) (-838.839) -- 0:01:20
688000 -- (-843.787) (-841.287) [-844.487] (-847.377) * (-836.877) (-846.508) [-841.570] (-843.967) -- 0:01:20
689000 -- (-843.727) [-845.366] (-847.827) (-843.872) * (-844.361) (-844.975) [-840.639] (-844.310) -- 0:01:19
690000 -- (-842.544) [-843.772] (-844.220) (-849.335) * (-847.973) (-846.528) (-841.164) [-847.173] -- 0:01:19
Average standard deviation of split frequencies: 0.006763
691000 -- (-837.953) [-838.157] (-839.215) (-853.820) * (-846.677) (-836.312) (-844.402) [-846.436] -- 0:01:19
692000 -- (-848.979) [-847.485] (-840.524) (-842.632) * (-845.958) [-835.828] (-842.297) (-843.331) -- 0:01:19
693000 -- [-837.872] (-836.451) (-847.962) (-845.069) * [-849.542] (-840.427) (-836.201) (-845.476) -- 0:01:18
694000 -- (-845.443) (-842.057) (-846.962) [-839.992] * (-852.318) [-844.555] (-844.959) (-845.437) -- 0:01:18
695000 -- (-844.923) (-849.784) (-850.614) [-848.090] * [-849.650] (-854.329) (-846.676) (-844.816) -- 0:01:18
Average standard deviation of split frequencies: 0.006588
696000 -- (-842.264) (-845.784) [-845.640] (-845.252) * (-840.957) (-849.815) (-845.172) [-849.495] -- 0:01:18
697000 -- (-841.379) (-857.780) (-841.012) [-840.289] * (-847.020) (-846.029) (-847.949) [-838.757] -- 0:01:17
698000 -- (-843.237) (-846.937) (-842.557) [-839.200] * (-850.851) (-854.146) [-838.057] (-844.038) -- 0:01:17
699000 -- [-842.102] (-842.729) (-837.798) (-836.380) * (-852.483) (-850.075) [-837.844] (-850.552) -- 0:01:17
700000 -- [-843.793] (-848.406) (-843.457) (-846.951) * (-846.948) [-842.510] (-845.465) (-852.002) -- 0:01:17
Average standard deviation of split frequencies: 0.006667
701000 -- (-845.657) [-843.255] (-847.401) (-846.418) * (-846.525) [-843.686] (-846.654) (-846.803) -- 0:01:16
702000 -- (-846.085) (-847.824) (-838.882) [-842.034] * (-849.687) [-839.078] (-844.415) (-839.992) -- 0:01:16
703000 -- (-846.244) [-840.746] (-845.069) (-853.431) * (-846.431) (-842.956) (-839.534) [-840.019] -- 0:01:16
704000 -- (-841.344) (-844.331) [-841.138] (-845.183) * (-839.833) (-843.041) [-840.870] (-845.232) -- 0:01:16
705000 -- [-844.384] (-846.786) (-846.717) (-846.018) * (-845.512) [-837.625] (-847.112) (-837.027) -- 0:01:15
Average standard deviation of split frequencies: 0.006799
706000 -- [-843.674] (-853.068) (-847.153) (-843.376) * (-850.445) [-840.613] (-840.477) (-843.919) -- 0:01:15
707000 -- (-849.466) (-849.928) [-843.404] (-842.819) * [-835.874] (-837.719) (-843.164) (-849.066) -- 0:01:15
708000 -- (-845.394) (-838.756) [-847.570] (-851.062) * (-851.412) (-850.237) [-848.246] (-846.737) -- 0:01:15
709000 -- (-847.194) (-851.765) [-849.032] (-843.333) * (-843.046) (-850.484) (-842.728) [-846.636] -- 0:01:14
710000 -- (-842.459) (-844.985) (-845.580) [-841.210] * (-846.101) [-839.577] (-854.858) (-850.488) -- 0:01:14
Average standard deviation of split frequencies: 0.006633
711000 -- (-854.651) (-842.984) (-849.394) [-843.756] * (-848.383) (-837.945) (-845.909) [-845.977] -- 0:01:13
712000 -- [-842.148] (-847.631) (-844.541) (-859.863) * (-856.653) [-854.659] (-851.180) (-844.017) -- 0:01:14
713000 -- (-849.491) [-847.948] (-839.329) (-850.458) * [-840.975] (-847.079) (-847.505) (-849.394) -- 0:01:13
714000 -- (-842.935) (-847.309) [-841.782] (-847.277) * (-847.505) (-849.095) [-843.011] (-851.761) -- 0:01:13
715000 -- [-844.084] (-845.061) (-846.278) (-854.206) * (-845.389) (-844.730) (-845.180) [-847.896] -- 0:01:12
Average standard deviation of split frequencies: 0.006644
716000 -- (-844.675) [-845.782] (-850.580) (-848.206) * [-844.968] (-851.351) (-841.599) (-847.980) -- 0:01:12
717000 -- [-841.391] (-846.881) (-842.848) (-845.099) * [-839.682] (-840.930) (-841.070) (-844.409) -- 0:01:12
718000 -- (-842.663) [-851.016] (-848.386) (-844.448) * [-840.246] (-843.103) (-846.689) (-845.638) -- 0:01:12
719000 -- (-846.144) (-845.100) (-848.714) [-841.992] * (-846.676) (-845.321) (-849.802) [-844.596] -- 0:01:11
720000 -- (-845.628) (-848.897) [-843.231] (-846.669) * [-843.758] (-846.346) (-847.734) (-854.744) -- 0:01:11
Average standard deviation of split frequencies: 0.006779
721000 -- [-851.284] (-854.990) (-850.809) (-837.386) * (-848.461) (-838.204) [-843.606] (-848.340) -- 0:01:11
722000 -- (-846.947) [-846.743] (-845.380) (-847.051) * [-839.443] (-837.785) (-857.399) (-846.769) -- 0:01:11
723000 -- [-838.390] (-841.627) (-838.588) (-850.027) * [-844.588] (-845.315) (-842.082) (-838.941) -- 0:01:10
724000 -- (-853.940) [-842.853] (-841.472) (-847.113) * (-840.956) (-836.687) [-840.839] (-844.410) -- 0:01:10
725000 -- [-841.277] (-839.653) (-849.715) (-849.177) * (-843.294) (-845.104) (-846.566) [-850.140] -- 0:01:10
Average standard deviation of split frequencies: 0.007024
726000 -- (-841.505) (-847.417) [-840.989] (-840.620) * (-839.560) (-852.400) (-837.092) [-836.384] -- 0:01:10
727000 -- (-840.643) (-844.051) (-845.323) [-848.127] * (-842.507) [-842.325] (-845.492) (-840.678) -- 0:01:09
728000 -- (-851.611) (-847.173) [-837.070] (-843.274) * (-847.555) (-840.401) (-844.454) [-839.868] -- 0:01:09
729000 -- [-852.382] (-845.710) (-845.444) (-841.943) * (-847.709) (-848.725) [-844.326] (-840.740) -- 0:01:09
730000 -- (-845.575) [-853.672] (-850.568) (-847.565) * (-847.199) (-844.741) (-838.381) [-846.675] -- 0:01:09
Average standard deviation of split frequencies: 0.007625
731000 -- (-850.809) [-837.463] (-846.081) (-845.005) * [-849.311] (-847.726) (-846.009) (-840.965) -- 0:01:09
732000 -- (-849.058) (-840.801) [-848.802] (-844.473) * (-842.814) (-851.701) (-842.160) [-842.639] -- 0:01:08
733000 -- (-844.882) [-847.414] (-840.814) (-839.822) * [-848.720] (-855.972) (-844.840) (-845.378) -- 0:01:08
734000 -- [-843.429] (-860.878) (-854.681) (-838.957) * (-845.438) [-843.612] (-848.959) (-843.158) -- 0:01:08
735000 -- (-847.292) [-849.812] (-850.742) (-844.894) * (-843.634) (-845.451) [-837.490] (-849.218) -- 0:01:08
Average standard deviation of split frequencies: 0.007453
736000 -- (-841.481) (-844.905) (-848.000) [-848.292] * (-836.435) [-845.178] (-851.893) (-846.652) -- 0:01:07
737000 -- [-843.668] (-849.039) (-848.615) (-849.423) * [-840.788] (-844.507) (-847.718) (-842.342) -- 0:01:07
738000 -- (-844.247) (-847.634) [-844.126] (-843.633) * (-844.159) (-847.891) (-852.506) [-839.766] -- 0:01:07
739000 -- (-842.588) (-851.175) [-845.839] (-850.811) * (-848.226) [-840.062] (-858.575) (-846.151) -- 0:01:07
740000 -- (-839.805) (-836.533) [-843.480] (-844.424) * (-846.572) [-838.959] (-847.863) (-855.179) -- 0:01:06
Average standard deviation of split frequencies: 0.006654
741000 -- (-848.159) (-853.573) (-837.139) [-847.269] * (-852.025) [-843.316] (-842.485) (-840.437) -- 0:01:06
742000 -- (-842.451) (-843.604) (-842.555) [-841.012] * (-847.727) (-838.367) (-845.527) [-850.988] -- 0:01:06
743000 -- (-840.120) (-850.126) (-846.134) [-839.018] * (-845.653) [-835.669] (-841.071) (-851.322) -- 0:01:06
744000 -- (-851.171) (-848.524) [-843.202] (-848.254) * (-846.444) [-845.091] (-852.442) (-855.617) -- 0:01:05
745000 -- (-841.513) (-845.464) (-854.239) [-845.302] * (-847.973) (-843.155) [-843.361] (-848.611) -- 0:01:05
Average standard deviation of split frequencies: 0.006664
746000 -- [-843.654] (-849.828) (-849.494) (-838.161) * (-851.789) [-841.057] (-845.190) (-847.235) -- 0:01:05
747000 -- (-846.640) (-849.641) [-843.233] (-842.838) * (-846.205) (-850.095) [-846.129] (-848.090) -- 0:01:05
748000 -- (-848.736) [-846.944] (-842.349) (-847.723) * (-851.566) (-850.065) [-842.722] (-849.228) -- 0:01:04
749000 -- (-846.292) (-848.039) (-847.034) [-843.395] * [-843.434] (-847.920) (-845.871) (-844.823) -- 0:01:04
750000 -- [-846.566] (-851.391) (-853.222) (-843.030) * [-838.743] (-842.295) (-847.152) (-836.767) -- 0:01:04
Average standard deviation of split frequencies: 0.007193
751000 -- [-844.474] (-843.182) (-839.480) (-839.790) * [-837.980] (-851.458) (-845.089) (-843.123) -- 0:01:03
752000 -- [-841.905] (-848.235) (-856.518) (-841.383) * (-834.632) (-841.898) (-846.817) [-843.767] -- 0:01:03
753000 -- (-844.454) [-845.572] (-848.483) (-841.902) * (-844.502) (-852.730) [-840.377] (-852.084) -- 0:01:03
754000 -- (-848.737) [-847.705] (-850.338) (-847.523) * (-840.728) (-843.381) (-848.646) [-839.482] -- 0:01:02
755000 -- [-840.845] (-849.394) (-844.303) (-846.913) * [-841.370] (-848.050) (-847.054) (-849.316) -- 0:01:02
Average standard deviation of split frequencies: 0.006916
756000 -- (-840.905) (-862.343) [-841.605] (-853.819) * (-847.901) (-841.757) (-847.857) [-841.828] -- 0:01:02
757000 -- (-840.047) (-856.546) (-853.014) [-839.504] * (-845.893) (-842.931) [-853.957] (-845.593) -- 0:01:02
758000 -- (-843.718) (-860.838) [-839.103] (-850.049) * [-842.395] (-841.760) (-849.232) (-847.358) -- 0:01:01
759000 -- [-842.256] (-850.033) (-846.933) (-849.360) * [-852.324] (-840.404) (-842.967) (-848.691) -- 0:01:01
760000 -- [-850.691] (-841.958) (-843.772) (-839.694) * (-852.690) (-840.369) (-845.332) [-846.710] -- 0:01:01
Average standard deviation of split frequencies: 0.006592
761000 -- (-843.258) (-845.247) [-851.576] (-841.251) * (-846.880) (-844.115) [-854.628] (-843.300) -- 0:01:01
762000 -- (-850.044) (-843.559) [-840.683] (-844.652) * (-846.879) (-848.138) (-841.920) [-844.085] -- 0:01:00
763000 -- (-845.519) (-850.262) (-842.321) [-844.365] * (-841.732) (-834.410) [-841.805] (-838.885) -- 0:01:00
764000 -- (-848.244) (-838.682) (-845.344) [-849.248] * (-847.366) (-845.287) (-845.122) [-842.680] -- 0:01:00
765000 -- [-840.078] (-855.380) (-847.801) (-842.621) * (-844.168) [-845.637] (-839.381) (-848.872) -- 0:01:00
Average standard deviation of split frequencies: 0.005986
766000 -- (-846.947) (-839.955) [-840.701] (-852.447) * (-847.056) (-843.149) [-838.553] (-844.814) -- 0:00:59
767000 -- (-838.831) [-852.128] (-843.469) (-849.069) * [-847.302] (-843.683) (-843.373) (-838.415) -- 0:00:59
768000 -- (-835.975) [-848.680] (-842.369) (-837.814) * [-837.275] (-852.568) (-849.067) (-852.173) -- 0:00:59
769000 -- (-838.951) (-856.559) [-841.083] (-836.151) * (-844.106) (-854.436) [-838.114] (-841.191) -- 0:00:59
770000 -- (-840.951) (-844.527) [-842.106] (-855.542) * (-843.849) (-850.051) (-847.222) [-839.429] -- 0:00:58
Average standard deviation of split frequencies: 0.005783
771000 -- (-847.605) (-847.661) [-847.376] (-856.567) * (-840.383) (-850.066) [-846.684] (-847.471) -- 0:00:58
772000 -- [-846.252] (-850.369) (-847.044) (-847.573) * (-845.400) (-843.689) (-841.614) [-841.305] -- 0:00:58
773000 -- [-848.185] (-843.544) (-864.673) (-850.272) * (-846.575) [-841.136] (-842.402) (-840.738) -- 0:00:58
774000 -- (-838.317) (-848.832) (-851.105) [-848.305] * (-847.474) [-843.479] (-852.078) (-854.801) -- 0:00:57
775000 -- [-836.244] (-853.063) (-849.116) (-843.069) * (-860.132) (-855.927) [-840.374] (-840.563) -- 0:00:57
Average standard deviation of split frequencies: 0.005467
776000 -- (-842.648) (-847.085) (-847.879) [-840.184] * (-845.108) (-847.284) (-847.222) [-856.569] -- 0:00:57
777000 -- [-847.245] (-851.627) (-845.630) (-847.222) * (-850.397) [-840.600] (-847.903) (-842.447) -- 0:00:57
778000 -- [-840.873] (-853.620) (-854.058) (-852.379) * (-842.785) (-840.452) [-839.627] (-846.656) -- 0:00:56
779000 -- [-844.364] (-850.046) (-839.510) (-845.235) * [-842.273] (-841.822) (-846.391) (-842.927) -- 0:00:56
780000 -- (-849.903) (-841.974) [-839.474] (-846.485) * (-844.035) (-848.831) [-850.677] (-847.338) -- 0:00:56
Average standard deviation of split frequencies: 0.005984
781000 -- (-851.231) [-842.954] (-845.795) (-850.714) * [-838.695] (-856.834) (-845.912) (-841.302) -- 0:00:56
782000 -- (-842.749) (-840.729) (-843.313) [-844.070] * (-838.077) (-849.556) [-844.178] (-848.593) -- 0:00:55
783000 -- [-841.694] (-846.185) (-843.471) (-846.182) * (-852.033) (-844.547) [-847.745] (-846.824) -- 0:00:55
784000 -- (-845.315) (-851.024) [-848.620] (-849.584) * (-844.214) [-843.697] (-849.186) (-841.832) -- 0:00:55
785000 -- (-850.374) [-843.722] (-847.631) (-842.963) * (-852.118) (-844.664) (-846.137) [-847.069] -- 0:00:55
Average standard deviation of split frequencies: 0.006052
786000 -- [-839.836] (-845.305) (-839.662) (-841.309) * (-852.779) [-845.339] (-846.064) (-846.551) -- 0:00:54
787000 -- [-841.940] (-847.872) (-838.667) (-843.068) * (-847.602) (-844.321) [-842.275] (-844.705) -- 0:00:54
788000 -- [-840.446] (-859.437) (-849.808) (-846.309) * [-846.874] (-851.909) (-841.851) (-844.684) -- 0:00:54
789000 -- [-837.604] (-836.134) (-846.870) (-846.268) * [-842.769] (-847.839) (-847.583) (-853.744) -- 0:00:54
790000 -- (-846.303) (-847.338) [-842.456] (-845.100) * (-847.970) (-842.560) (-841.947) [-848.836] -- 0:00:53
Average standard deviation of split frequencies: 0.005637
791000 -- (-849.713) [-841.390] (-845.438) (-842.037) * (-847.380) (-856.411) (-844.729) [-843.695] -- 0:00:53
792000 -- [-836.672] (-840.644) (-850.927) (-847.012) * (-845.416) (-857.175) (-852.932) [-836.381] -- 0:00:53
793000 -- (-839.395) [-845.437] (-843.731) (-843.337) * (-844.297) (-850.824) (-847.672) [-848.301] -- 0:00:52
794000 -- (-840.398) (-847.346) (-848.793) [-844.563] * (-846.871) (-842.876) [-843.320] (-844.679) -- 0:00:52
795000 -- (-844.964) (-844.905) (-844.578) [-842.861] * (-854.896) [-845.338] (-845.129) (-843.112) -- 0:00:52
Average standard deviation of split frequencies: 0.005168
796000 -- (-838.565) (-848.860) (-846.324) [-840.056] * (-843.321) [-839.421] (-847.107) (-845.038) -- 0:00:52
797000 -- [-847.336] (-847.835) (-842.061) (-839.657) * (-842.655) (-860.089) (-843.675) [-839.392] -- 0:00:51
798000 -- (-855.649) (-852.751) [-842.086] (-847.682) * (-842.718) [-854.110] (-847.320) (-841.827) -- 0:00:51
799000 -- (-844.161) (-848.888) [-845.706] (-848.375) * (-847.271) (-845.665) (-850.943) [-843.289] -- 0:00:51
800000 -- (-854.789) (-844.706) (-838.088) [-846.329] * (-841.706) (-839.174) (-840.404) [-844.790] -- 0:00:51
Average standard deviation of split frequencies: 0.004764
801000 -- (-853.910) (-847.170) [-847.154] (-845.115) * [-845.102] (-843.895) (-839.536) (-845.999) -- 0:00:50
802000 -- (-841.154) (-850.336) (-839.868) [-847.830] * (-843.585) (-839.110) [-838.405] (-844.098) -- 0:00:50
803000 -- [-845.261] (-845.210) (-839.941) (-842.564) * (-857.198) (-840.220) [-847.922] (-848.697) -- 0:00:50
804000 -- (-840.753) (-842.466) [-840.573] (-840.742) * (-850.395) [-836.777] (-843.811) (-839.517) -- 0:00:50
805000 -- (-846.118) (-849.067) (-838.554) [-842.386] * (-851.752) [-840.926] (-843.501) (-839.145) -- 0:00:49
Average standard deviation of split frequencies: 0.004360
806000 -- (-844.560) (-841.234) [-841.360] (-843.027) * (-842.265) (-848.266) (-845.016) [-841.434] -- 0:00:49
807000 -- (-845.622) (-842.859) (-844.331) [-845.394] * (-841.997) (-846.416) (-844.343) [-840.126] -- 0:00:49
808000 -- (-838.672) (-841.336) [-842.756] (-849.198) * (-841.319) (-850.054) (-845.042) [-842.049] -- 0:00:49
809000 -- [-841.867] (-844.542) (-844.160) (-849.580) * (-842.287) [-846.206] (-841.917) (-845.789) -- 0:00:48
810000 -- [-841.245] (-845.890) (-840.539) (-842.157) * (-843.361) (-847.495) (-840.459) [-842.358] -- 0:00:48
Average standard deviation of split frequencies: 0.004652
811000 -- (-839.506) [-841.020] (-854.089) (-854.457) * (-843.491) (-850.246) [-845.927] (-844.152) -- 0:00:48
812000 -- (-842.736) (-843.581) [-838.586] (-849.381) * [-839.678] (-842.258) (-841.001) (-843.879) -- 0:00:48
813000 -- (-839.609) (-846.222) [-844.223] (-849.239) * [-842.783] (-843.350) (-844.273) (-845.557) -- 0:00:47
814000 -- (-850.616) (-846.519) [-838.818] (-842.454) * (-859.454) (-843.591) (-839.055) [-844.379] -- 0:00:47
815000 -- (-849.291) (-844.570) [-840.436] (-842.329) * (-843.048) [-843.455] (-840.929) (-849.639) -- 0:00:47
Average standard deviation of split frequencies: 0.004254
816000 -- (-846.640) (-850.776) [-845.392] (-853.326) * [-846.958] (-839.003) (-859.588) (-841.428) -- 0:00:47
817000 -- (-839.279) (-845.588) [-840.619] (-855.416) * (-848.906) (-848.447) [-840.599] (-853.343) -- 0:00:46
818000 -- [-848.227] (-846.919) (-846.041) (-849.293) * (-849.153) (-839.415) [-846.166] (-844.604) -- 0:00:46
819000 -- [-840.764] (-851.677) (-850.388) (-838.691) * (-842.977) (-838.152) (-841.561) [-843.545] -- 0:00:46
820000 -- (-844.631) [-843.299] (-847.233) (-838.693) * (-846.851) [-840.429] (-845.805) (-842.018) -- 0:00:46
Average standard deviation of split frequencies: 0.003969
821000 -- (-847.156) (-854.291) (-845.086) [-843.598] * (-854.997) (-846.103) (-839.887) [-843.528] -- 0:00:45
822000 -- (-842.826) [-842.528] (-843.953) (-843.637) * (-851.972) (-849.390) (-850.673) [-842.083] -- 0:00:45
823000 -- (-849.948) (-850.747) (-844.058) [-843.487] * (-844.649) [-846.229] (-848.189) (-844.883) -- 0:00:45
824000 -- (-841.463) (-839.930) [-849.096] (-846.119) * (-848.890) (-844.187) [-847.758] (-844.920) -- 0:00:45
825000 -- [-842.021] (-844.404) (-849.572) (-840.207) * [-843.396] (-849.545) (-841.982) (-841.456) -- 0:00:44
Average standard deviation of split frequencies: 0.004514
826000 -- (-845.123) [-842.056] (-852.674) (-847.802) * [-838.062] (-843.725) (-843.580) (-840.550) -- 0:00:44
827000 -- (-839.495) (-855.121) [-838.336] (-853.495) * (-846.157) (-843.038) (-843.771) [-838.409] -- 0:00:44
828000 -- (-852.892) (-844.013) (-840.251) [-844.945] * (-840.689) [-841.357] (-843.145) (-845.405) -- 0:00:44
829000 -- (-841.665) [-838.297] (-839.881) (-846.329) * (-845.625) (-843.617) (-850.601) [-839.556] -- 0:00:43
830000 -- [-840.813] (-843.107) (-838.917) (-845.329) * (-852.245) [-845.291] (-839.864) (-848.100) -- 0:00:43
Average standard deviation of split frequencies: 0.004746
831000 -- (-844.329) [-850.425] (-842.493) (-846.270) * (-846.894) [-842.413] (-860.537) (-843.241) -- 0:00:43
832000 -- (-848.680) [-843.483] (-842.846) (-843.598) * [-841.487] (-849.369) (-846.696) (-844.519) -- 0:00:43
833000 -- (-852.007) (-848.007) [-842.921] (-835.832) * (-845.472) (-849.064) [-843.392] (-842.013) -- 0:00:42
834000 -- (-848.271) (-844.234) (-848.392) [-838.634] * (-844.784) (-842.442) [-844.888] (-845.026) -- 0:00:42
835000 -- (-855.348) (-842.140) [-847.485] (-849.652) * (-846.065) (-848.518) (-852.101) [-848.570] -- 0:00:42
Average standard deviation of split frequencies: 0.004819
836000 -- [-846.171] (-837.755) (-845.311) (-841.248) * (-840.310) [-843.504] (-846.895) (-845.510) -- 0:00:41
837000 -- (-850.340) [-839.649] (-847.621) (-849.689) * (-843.118) (-866.180) [-837.212] (-851.764) -- 0:00:41
838000 -- [-841.208] (-841.689) (-838.948) (-843.247) * [-842.434] (-844.504) (-851.734) (-849.582) -- 0:00:41
839000 -- (-849.206) [-846.502] (-846.160) (-852.777) * (-851.918) [-846.880] (-862.251) (-848.915) -- 0:00:41
840000 -- (-846.135) (-847.231) (-851.593) [-846.264] * (-847.753) (-847.985) [-839.863] (-843.272) -- 0:00:40
Average standard deviation of split frequencies: 0.004384
841000 -- [-839.633] (-844.110) (-847.966) (-845.283) * (-849.946) (-841.640) [-840.563] (-846.779) -- 0:00:40
842000 -- (-845.654) (-849.842) [-843.926] (-848.259) * (-853.004) (-842.106) [-842.198] (-843.499) -- 0:00:40
843000 -- (-856.013) (-844.945) (-850.419) [-841.604] * (-853.741) (-843.527) (-848.335) [-848.887] -- 0:00:40
844000 -- [-846.277] (-842.381) (-850.375) (-841.725) * (-845.781) (-844.586) (-846.494) [-847.878] -- 0:00:39
845000 -- [-839.776] (-845.803) (-850.146) (-843.911) * (-839.140) [-837.522] (-850.380) (-849.826) -- 0:00:39
Average standard deviation of split frequencies: 0.004255
846000 -- (-841.385) (-853.488) [-842.717] (-850.833) * (-844.538) (-847.096) (-859.594) [-843.936] -- 0:00:39
847000 -- (-841.856) (-853.960) [-845.923] (-847.789) * (-842.274) [-841.922] (-847.009) (-845.575) -- 0:00:39
848000 -- (-844.623) (-853.498) (-853.424) [-841.463] * (-844.921) (-844.252) (-841.296) [-842.344] -- 0:00:38
849000 -- (-851.384) (-847.157) (-845.270) [-842.145] * (-841.131) (-848.943) (-839.545) [-844.879] -- 0:00:38
850000 -- [-843.781] (-851.373) (-851.203) (-852.149) * [-847.352] (-849.734) (-847.793) (-844.511) -- 0:00:38
Average standard deviation of split frequencies: 0.004181
851000 -- (-844.386) (-846.926) (-837.267) [-846.465] * (-847.593) (-841.126) (-845.715) [-844.626] -- 0:00:38
852000 -- (-848.952) (-847.647) [-842.703] (-848.302) * (-841.118) (-843.189) (-843.973) [-838.397] -- 0:00:37
853000 -- (-845.629) (-858.608) [-838.408] (-847.090) * (-849.686) (-843.681) (-843.953) [-839.767] -- 0:00:37
854000 -- (-847.912) (-843.837) [-839.827] (-844.352) * [-837.524] (-850.977) (-847.782) (-846.650) -- 0:00:37
855000 -- [-845.137] (-844.144) (-841.199) (-847.074) * (-846.132) (-851.464) [-848.231] (-850.817) -- 0:00:37
Average standard deviation of split frequencies: 0.003755
856000 -- (-855.608) (-845.225) [-852.678] (-844.356) * (-845.655) (-852.000) [-842.452] (-844.240) -- 0:00:36
857000 -- (-849.682) [-845.843] (-843.518) (-851.495) * [-840.624] (-850.945) (-849.186) (-854.031) -- 0:00:36
858000 -- (-845.796) (-856.557) (-845.567) [-840.334] * [-842.963] (-845.740) (-837.508) (-847.116) -- 0:00:36
859000 -- (-846.577) [-845.733] (-848.810) (-850.480) * (-839.943) [-838.384] (-842.716) (-848.293) -- 0:00:36
860000 -- (-846.530) (-840.608) (-843.360) [-842.744] * (-842.629) (-850.459) [-841.428] (-842.543) -- 0:00:35
Average standard deviation of split frequencies: 0.003784
861000 -- (-842.630) (-844.245) [-838.490] (-843.355) * (-849.404) [-838.815] (-846.928) (-848.818) -- 0:00:35
862000 -- (-845.972) (-844.724) (-845.502) [-849.216] * (-843.896) (-848.686) (-840.035) [-841.326] -- 0:00:35
863000 -- (-837.914) [-842.243] (-847.485) (-848.192) * (-842.094) [-848.324] (-847.317) (-849.281) -- 0:00:35
864000 -- (-847.888) (-843.857) [-842.120] (-845.724) * (-850.603) (-847.083) (-849.645) [-838.216] -- 0:00:34
865000 -- (-844.629) (-841.199) (-842.357) [-849.990] * (-850.683) [-851.955] (-848.379) (-851.468) -- 0:00:34
Average standard deviation of split frequencies: 0.003860
866000 -- (-845.453) (-845.523) (-842.781) [-847.955] * (-848.416) (-845.949) [-844.259] (-842.188) -- 0:00:34
867000 -- [-838.926] (-842.327) (-850.253) (-849.974) * [-841.942] (-850.174) (-844.515) (-839.639) -- 0:00:34
868000 -- (-849.618) (-848.022) [-846.298] (-846.301) * (-838.273) (-844.913) [-839.505] (-851.723) -- 0:00:33
869000 -- [-849.591] (-852.507) (-837.462) (-840.148) * (-843.283) [-835.976] (-844.430) (-848.178) -- 0:00:33
870000 -- (-841.166) (-843.815) (-843.573) [-845.805] * (-846.679) (-840.946) [-841.100] (-845.905) -- 0:00:33
Average standard deviation of split frequencies: 0.004085
871000 -- (-844.891) [-840.696] (-850.032) (-842.436) * (-847.755) [-837.909] (-848.768) (-852.716) -- 0:00:33
872000 -- (-850.237) [-842.809] (-859.123) (-842.263) * [-837.135] (-851.359) (-845.528) (-843.894) -- 0:00:32
873000 -- (-846.961) [-845.058] (-846.864) (-850.956) * (-841.528) (-849.536) [-842.600] (-842.104) -- 0:00:32
874000 -- (-845.685) (-850.751) [-840.955] (-851.565) * [-843.080] (-861.572) (-847.997) (-845.662) -- 0:00:32
875000 -- (-841.312) (-842.213) [-843.266] (-847.866) * (-843.360) (-845.460) [-838.915] (-846.324) -- 0:00:32
Average standard deviation of split frequencies: 0.004305
876000 -- (-856.239) (-845.074) (-841.391) [-839.301] * (-849.268) (-839.630) (-839.717) [-846.613] -- 0:00:31
877000 -- (-847.602) (-853.070) [-837.017] (-842.976) * (-845.510) (-849.116) (-840.418) [-844.173] -- 0:00:31
878000 -- (-848.186) (-844.013) (-840.698) [-839.786] * [-839.888] (-844.266) (-840.089) (-861.224) -- 0:00:31
879000 -- (-848.803) (-851.596) [-842.510] (-847.267) * (-847.690) (-855.336) (-845.164) [-838.996] -- 0:00:30
880000 -- (-844.711) (-843.382) (-848.018) [-842.319] * (-849.242) [-840.435] (-843.111) (-839.277) -- 0:00:30
Average standard deviation of split frequencies: 0.004136
881000 -- (-849.644) [-848.275] (-841.347) (-844.968) * [-841.748] (-842.289) (-844.253) (-847.330) -- 0:00:30
882000 -- (-842.905) (-846.025) [-839.343] (-846.484) * [-842.682] (-839.183) (-848.724) (-848.789) -- 0:00:30
883000 -- [-847.814] (-852.942) (-843.569) (-846.892) * [-846.548] (-839.427) (-850.931) (-848.829) -- 0:00:29
884000 -- (-845.630) (-848.370) (-839.303) [-839.382] * (-847.416) (-848.110) (-854.053) [-839.284] -- 0:00:29
885000 -- (-841.538) (-851.788) (-837.892) [-842.535] * (-844.493) (-841.656) [-848.323] (-843.177) -- 0:00:29
Average standard deviation of split frequencies: 0.003821
886000 -- (-843.791) (-846.982) [-849.276] (-844.623) * (-848.502) [-841.778] (-850.799) (-849.695) -- 0:00:29
887000 -- (-837.673) (-852.287) (-838.766) [-847.118] * (-839.551) (-851.452) [-850.509] (-846.802) -- 0:00:28
888000 -- (-837.251) (-850.233) (-848.396) [-840.650] * (-850.509) [-841.975] (-847.202) (-843.040) -- 0:00:28
889000 -- [-842.800] (-846.225) (-849.220) (-851.507) * (-843.324) (-850.277) [-841.727] (-849.336) -- 0:00:28
890000 -- (-848.438) (-848.590) [-842.425] (-841.778) * (-838.535) (-844.780) [-842.159] (-847.421) -- 0:00:28
Average standard deviation of split frequencies: 0.003945
891000 -- (-853.815) (-837.327) (-843.736) [-841.455] * (-846.881) (-852.006) (-858.469) [-845.427] -- 0:00:27
892000 -- (-854.679) (-841.697) [-846.730] (-843.857) * (-843.365) (-845.488) (-840.805) [-842.634] -- 0:00:27
893000 -- (-847.768) (-852.072) [-841.341] (-842.526) * (-840.756) [-847.465] (-839.421) (-851.287) -- 0:00:27
894000 -- [-844.481] (-841.854) (-847.480) (-850.425) * (-850.138) (-844.068) (-846.736) [-840.494] -- 0:00:27
895000 -- (-843.216) (-847.633) [-843.911] (-841.361) * [-844.028] (-836.549) (-846.525) (-846.856) -- 0:00:26
Average standard deviation of split frequencies: 0.003444
896000 -- [-841.905] (-845.000) (-848.651) (-843.776) * (-845.367) (-846.864) [-841.226] (-850.456) -- 0:00:26
897000 -- [-849.460] (-846.508) (-851.292) (-842.441) * (-845.576) (-847.873) [-846.827] (-853.850) -- 0:00:26
898000 -- (-842.225) (-851.592) (-850.896) [-841.903] * [-838.423] (-846.885) (-850.176) (-849.868) -- 0:00:26
899000 -- (-840.354) (-843.295) [-843.355] (-856.165) * [-845.495] (-848.445) (-851.395) (-852.070) -- 0:00:25
900000 -- (-846.487) [-841.739] (-839.266) (-845.308) * [-848.786] (-854.006) (-837.368) (-846.271) -- 0:00:25
Average standard deviation of split frequencies: 0.003473
901000 -- [-848.354] (-843.591) (-847.570) (-842.741) * [-843.235] (-852.087) (-851.673) (-846.295) -- 0:00:25
902000 -- (-840.228) (-852.482) [-843.243] (-837.844) * (-840.046) (-843.814) (-841.378) [-847.415] -- 0:00:25
903000 -- (-841.984) (-850.996) [-851.318] (-842.176) * (-846.144) [-843.644] (-852.867) (-843.815) -- 0:00:24
904000 -- (-844.938) (-845.577) (-851.908) [-844.185] * (-854.630) [-849.193] (-844.004) (-843.222) -- 0:00:24
905000 -- (-846.904) [-844.578] (-844.789) (-843.329) * (-838.658) (-851.219) (-845.840) [-841.323] -- 0:00:24
Average standard deviation of split frequencies: 0.003216
906000 -- (-844.723) (-839.000) (-842.123) [-848.451] * (-847.582) (-846.413) (-845.728) [-844.008] -- 0:00:24
907000 -- (-843.881) (-850.102) (-843.093) [-841.083] * (-840.717) (-850.454) [-845.902] (-849.670) -- 0:00:23
908000 -- (-849.181) (-846.301) [-849.076] (-849.335) * (-846.122) (-841.902) [-842.968] (-847.036) -- 0:00:23
909000 -- (-851.558) (-851.551) (-845.050) [-837.544] * (-848.224) (-857.303) (-845.139) [-844.153] -- 0:00:23
910000 -- [-841.540] (-848.417) (-844.729) (-844.414) * (-853.448) (-847.660) (-841.396) [-837.673] -- 0:00:23
Average standard deviation of split frequencies: 0.003388
911000 -- [-841.884] (-839.614) (-844.964) (-844.568) * (-852.916) [-848.015] (-842.209) (-846.878) -- 0:00:22
912000 -- (-838.348) (-847.783) (-847.382) [-837.728] * [-841.058] (-841.359) (-853.688) (-853.513) -- 0:00:22
913000 -- [-843.044] (-844.039) (-852.945) (-857.927) * (-853.679) (-843.802) (-851.906) [-840.941] -- 0:00:22
914000 -- (-839.980) (-853.429) [-844.054] (-839.602) * (-855.711) (-850.750) (-845.705) [-846.328] -- 0:00:22
915000 -- (-855.076) [-844.342] (-842.690) (-851.300) * [-838.361] (-851.467) (-841.641) (-846.325) -- 0:00:21
Average standard deviation of split frequencies: 0.003696
916000 -- [-838.079] (-846.337) (-847.913) (-850.539) * [-843.890] (-856.385) (-854.028) (-851.848) -- 0:00:21
917000 -- (-839.174) (-843.203) [-843.562] (-840.696) * (-845.166) (-841.918) [-843.202] (-850.606) -- 0:00:21
918000 -- (-840.059) (-846.900) [-839.479] (-848.712) * [-839.533] (-841.521) (-841.476) (-840.370) -- 0:00:20
919000 -- [-840.685] (-842.978) (-845.971) (-845.397) * (-844.780) [-851.931] (-850.456) (-853.621) -- 0:00:20
920000 -- (-847.749) (-839.125) [-841.619] (-854.165) * (-846.562) (-844.340) [-843.081] (-853.237) -- 0:00:20
Average standard deviation of split frequencies: 0.003212
921000 -- (-845.643) [-842.683] (-839.471) (-841.428) * (-851.816) [-837.841] (-848.808) (-844.688) -- 0:00:20
922000 -- (-843.119) (-839.081) (-841.251) [-841.610] * (-843.314) (-840.884) [-842.189] (-847.615) -- 0:00:19
923000 -- [-847.241] (-843.526) (-842.415) (-845.528) * [-846.029] (-845.330) (-841.986) (-850.133) -- 0:00:19
924000 -- (-845.555) (-842.731) [-845.575] (-846.230) * (-849.383) [-842.093] (-841.978) (-849.832) -- 0:00:19
925000 -- (-849.255) [-840.031] (-863.715) (-843.233) * (-851.825) [-844.291] (-841.641) (-849.553) -- 0:00:19
Average standard deviation of split frequencies: 0.002684
926000 -- (-847.037) (-843.886) [-842.514] (-851.844) * (-840.703) [-838.937] (-848.492) (-842.825) -- 0:00:18
927000 -- (-838.252) (-845.503) (-847.372) [-842.370] * (-838.389) (-852.018) [-848.760] (-843.489) -- 0:00:18
928000 -- (-847.882) (-843.252) [-843.977] (-842.705) * (-843.330) (-852.702) [-842.325] (-842.056) -- 0:00:18
929000 -- (-855.826) [-838.940] (-846.573) (-844.904) * [-844.619] (-843.893) (-859.444) (-844.983) -- 0:00:18
930000 -- (-851.438) [-840.614] (-840.219) (-847.741) * (-854.771) (-844.522) (-852.678) [-839.901] -- 0:00:17
Average standard deviation of split frequencies: 0.002625
931000 -- [-847.865] (-833.778) (-843.123) (-839.529) * (-851.201) (-842.463) (-840.478) [-850.461] -- 0:00:17
932000 -- (-851.254) (-842.565) (-851.843) [-840.284] * (-842.492) (-844.799) (-842.348) [-841.778] -- 0:00:17
933000 -- [-845.301] (-841.371) (-841.647) (-839.218) * (-844.293) (-837.856) (-847.076) [-843.345] -- 0:00:17
934000 -- (-838.738) (-844.914) [-845.131] (-844.581) * [-838.723] (-846.832) (-848.418) (-846.300) -- 0:00:16
935000 -- (-848.163) (-854.639) [-839.960] (-843.129) * (-843.492) (-848.124) [-838.049] (-848.482) -- 0:00:16
Average standard deviation of split frequencies: 0.002793
936000 -- (-849.600) (-841.934) (-854.371) [-842.633] * (-847.449) [-839.271] (-841.298) (-848.321) -- 0:00:16
937000 -- (-850.224) (-842.576) [-842.936] (-836.743) * [-843.925] (-843.709) (-855.342) (-852.109) -- 0:00:16
938000 -- (-850.817) (-841.025) [-844.374] (-851.935) * [-845.569] (-854.327) (-845.934) (-845.328) -- 0:00:15
939000 -- (-849.133) (-845.941) (-849.930) [-846.885] * (-849.046) (-845.751) [-846.782] (-845.032) -- 0:00:15
940000 -- (-842.007) [-844.644] (-851.956) (-839.921) * (-841.456) (-845.221) (-855.143) [-840.702] -- 0:00:15
Average standard deviation of split frequencies: 0.003235
941000 -- (-837.632) (-838.546) [-839.800] (-842.677) * [-836.922] (-844.472) (-845.345) (-854.495) -- 0:00:15
942000 -- (-846.267) (-840.504) (-844.861) [-837.693] * (-841.244) (-840.285) [-846.341] (-837.710) -- 0:00:14
943000 -- [-842.644] (-848.549) (-848.089) (-842.948) * (-849.537) (-843.331) [-846.430] (-847.480) -- 0:00:14
944000 -- (-840.183) [-841.774] (-840.943) (-844.573) * [-840.674] (-847.104) (-841.811) (-851.118) -- 0:00:14
945000 -- (-844.886) (-847.634) [-848.544] (-845.608) * (-840.539) (-839.184) [-841.031] (-847.296) -- 0:00:14
Average standard deviation of split frequencies: 0.002582
946000 -- (-844.285) [-839.136] (-843.979) (-841.960) * [-844.286] (-849.682) (-855.245) (-845.881) -- 0:00:13
947000 -- (-846.677) (-852.014) (-858.007) [-846.421] * (-846.451) (-836.806) [-856.184] (-842.683) -- 0:00:13
948000 -- (-841.164) (-850.447) (-845.997) [-844.671] * [-845.326] (-841.883) (-850.957) (-844.392) -- 0:00:13
949000 -- (-846.319) (-848.094) [-843.724] (-842.950) * (-842.361) [-841.728] (-854.330) (-845.809) -- 0:00:13
950000 -- (-847.370) (-854.264) (-843.125) [-838.403] * [-844.754] (-843.030) (-851.697) (-844.339) -- 0:00:12
Average standard deviation of split frequencies: 0.002660
951000 -- [-840.738] (-843.047) (-837.288) (-848.582) * (-844.732) (-846.505) [-842.915] (-845.755) -- 0:00:12
952000 -- [-841.693] (-849.976) (-836.209) (-843.068) * (-841.362) [-844.072] (-841.480) (-853.661) -- 0:00:12
953000 -- [-847.423] (-846.073) (-849.173) (-845.385) * (-847.853) [-850.942] (-852.604) (-842.287) -- 0:00:12
954000 -- (-844.034) [-844.755] (-848.134) (-837.699) * (-841.090) (-847.138) [-840.397] (-850.970) -- 0:00:11
955000 -- (-846.643) (-851.468) (-846.255) [-845.362] * (-850.495) (-841.705) (-841.548) [-838.712] -- 0:00:11
Average standard deviation of split frequencies: 0.002690
956000 -- (-847.518) (-855.846) (-841.892) [-836.394] * (-843.718) (-847.988) (-845.157) [-841.640] -- 0:00:11
957000 -- (-839.406) (-847.018) (-847.030) [-844.573] * (-850.119) (-842.394) (-840.248) [-838.678] -- 0:00:11
958000 -- [-837.598] (-845.133) (-844.667) (-843.609) * [-841.949] (-849.039) (-845.345) (-844.850) -- 0:00:10
959000 -- [-839.667] (-843.130) (-840.743) (-847.429) * (-848.501) (-862.454) [-843.468] (-856.035) -- 0:00:10
960000 -- (-847.681) (-843.665) [-838.862] (-841.054) * [-844.319] (-849.723) (-843.746) (-850.319) -- 0:00:10
Average standard deviation of split frequencies: 0.002989
961000 -- (-843.801) [-844.916] (-851.846) (-846.736) * [-852.185] (-843.685) (-838.741) (-852.135) -- 0:00:09
962000 -- [-842.541] (-846.559) (-842.508) (-844.075) * (-851.348) (-851.270) (-838.602) [-843.558] -- 0:00:09
963000 -- (-846.026) (-842.734) [-839.426] (-851.422) * (-847.038) (-845.228) (-861.254) [-841.903] -- 0:00:09
964000 -- (-838.992) [-844.390] (-846.845) (-840.910) * (-846.226) [-847.954] (-854.081) (-846.473) -- 0:00:09
965000 -- (-848.973) (-839.015) (-845.509) [-843.775] * (-841.823) [-844.561] (-845.777) (-848.425) -- 0:00:08
Average standard deviation of split frequencies: 0.003105
966000 -- [-843.186] (-845.013) (-850.201) (-852.284) * (-848.701) [-835.292] (-842.366) (-846.586) -- 0:00:08
967000 -- (-844.713) [-845.453] (-841.955) (-852.901) * (-845.144) (-843.351) (-845.328) [-843.616] -- 0:00:08
968000 -- (-841.839) (-845.662) (-839.205) [-852.240] * (-843.382) (-846.183) (-841.974) [-848.007] -- 0:00:08
969000 -- (-856.828) (-848.204) [-843.182] (-847.021) * (-850.492) (-854.131) [-839.708] (-846.244) -- 0:00:07
970000 -- (-854.708) (-840.796) [-842.377] (-845.451) * (-844.127) (-847.468) (-836.410) [-839.672] -- 0:00:07
Average standard deviation of split frequencies: 0.002737
971000 -- (-849.752) (-846.292) (-840.989) [-841.161] * [-844.913] (-850.675) (-842.343) (-847.362) -- 0:00:07
972000 -- (-842.786) [-835.094] (-844.833) (-845.940) * (-850.335) (-849.383) [-844.770] (-846.446) -- 0:00:07
973000 -- (-847.541) [-840.854] (-852.044) (-842.748) * [-836.158] (-851.006) (-846.567) (-859.987) -- 0:00:06
974000 -- (-844.636) (-842.465) (-845.955) [-842.997] * (-854.878) [-848.113] (-848.301) (-845.109) -- 0:00:06
975000 -- (-847.119) (-845.562) [-844.661] (-849.624) * (-848.824) (-844.685) (-843.917) [-843.240] -- 0:00:06
Average standard deviation of split frequencies: 0.002415
976000 -- (-845.514) [-840.393] (-853.933) (-842.949) * (-837.285) (-846.188) [-844.736] (-839.338) -- 0:00:06
977000 -- (-844.289) [-846.057] (-850.961) (-845.913) * (-844.455) (-850.931) [-847.865] (-840.562) -- 0:00:05
978000 -- (-837.258) (-846.416) [-846.391] (-846.804) * (-846.591) [-841.573] (-846.327) (-848.500) -- 0:00:05
979000 -- [-843.876] (-847.055) (-846.832) (-842.442) * (-851.262) (-844.983) (-843.058) [-836.070] -- 0:00:05
980000 -- [-847.302] (-849.889) (-850.183) (-843.495) * (-854.551) (-848.663) (-846.268) [-848.275] -- 0:00:05
Average standard deviation of split frequencies: 0.002797
981000 -- (-843.018) (-842.303) [-837.037] (-848.423) * (-844.468) (-853.967) (-847.965) [-838.993] -- 0:00:04
982000 -- [-839.179] (-847.532) (-848.442) (-845.784) * (-849.650) (-846.752) (-847.599) [-843.331] -- 0:00:04
983000 -- (-851.608) [-842.090] (-855.155) (-854.525) * (-846.807) [-840.384] (-841.884) (-841.381) -- 0:00:04
984000 -- [-838.435] (-845.124) (-849.464) (-846.539) * (-847.035) (-843.757) [-839.267] (-841.243) -- 0:00:04
985000 -- (-841.201) (-844.951) [-844.319] (-866.429) * (-850.050) [-844.636] (-850.119) (-838.750) -- 0:00:03
Average standard deviation of split frequencies: 0.001652
986000 -- (-852.766) (-845.542) (-850.102) [-843.698] * (-846.670) (-846.620) (-850.019) [-842.746] -- 0:00:03
987000 -- (-848.952) [-847.773] (-849.379) (-848.489) * (-857.116) [-839.490] (-843.977) (-851.999) -- 0:00:03
988000 -- (-850.940) (-840.635) (-846.206) [-842.078] * [-840.843] (-859.460) (-840.194) (-837.349) -- 0:00:03
989000 -- (-843.250) [-845.454] (-849.056) (-842.461) * (-848.990) [-840.996] (-846.921) (-836.438) -- 0:00:02
990000 -- (-848.971) (-841.638) (-843.440) [-845.529] * (-839.986) (-844.899) [-843.298] (-844.338) -- 0:00:02
Average standard deviation of split frequencies: 0.001471
991000 -- (-844.858) (-843.634) (-849.970) [-844.776] * (-842.664) (-840.853) [-845.950] (-853.866) -- 0:00:02
992000 -- (-845.251) [-845.135] (-841.357) (-841.124) * (-858.035) (-843.444) (-850.824) [-842.031] -- 0:00:02
993000 -- (-849.002) [-842.857] (-846.386) (-846.631) * (-846.931) (-843.173) [-850.898] (-843.637) -- 0:00:01
994000 -- [-843.096] (-845.455) (-851.840) (-842.055) * (-858.333) [-838.881] (-844.720) (-841.061) -- 0:00:01
995000 -- [-842.441] (-844.372) (-845.557) (-852.614) * (-848.759) [-838.860] (-847.759) (-843.359) -- 0:00:01
Average standard deviation of split frequencies: 0.001678
996000 -- (-848.550) [-835.947] (-845.709) (-848.327) * (-845.560) [-846.499] (-867.092) (-846.552) -- 0:00:01
997000 -- [-849.678] (-849.736) (-864.334) (-841.394) * (-844.388) (-848.161) (-850.558) [-836.472] -- 0:00:00
998000 -- (-851.805) [-843.109] (-846.194) (-836.399) * [-843.337] (-855.044) (-848.235) (-842.956) -- 0:00:00
999000 -- (-841.511) (-844.945) [-841.260] (-843.646) * (-843.613) (-848.806) (-843.367) [-840.910] -- 0:00:00
1000000 -- (-844.684) (-848.511) [-849.508] (-841.776) * (-849.797) [-847.701] (-856.013) (-841.179) -- 0:00:00
Average standard deviation of split frequencies: 0.001756
Analysis completed in 4 mins 16 seconds
Analysis used 255.08 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -831.35
Likelihood of best state for "cold" chain of run 2 was -831.27
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
63.9 % ( 57 %) Dirichlet(Revmat{all})
78.1 % ( 67 %) Slider(Revmat{all})
35.5 % ( 29 %) Dirichlet(Pi{all})
36.5 % ( 26 %) Slider(Pi{all})
66.9 % ( 37 %) Multiplier(Alpha{1,2})
62.5 % ( 42 %) Multiplier(Alpha{3})
70.7 % ( 44 %) Slider(Pinvar{all})
26.3 % ( 29 %) ExtSPR(Tau{all},V{all})
17.2 % ( 24 %) ExtTBR(Tau{all},V{all})
34.0 % ( 28 %) NNI(Tau{all},V{all})
37.2 % ( 35 %) ParsSPR(Tau{all},V{all})
27.0 % ( 21 %) Multiplier(V{all})
41.7 % ( 42 %) Nodeslider(V{all})
26.4 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
64.4 % ( 48 %) Dirichlet(Revmat{all})
78.6 % ( 77 %) Slider(Revmat{all})
35.2 % ( 28 %) Dirichlet(Pi{all})
35.9 % ( 24 %) Slider(Pi{all})
67.4 % ( 39 %) Multiplier(Alpha{1,2})
62.1 % ( 37 %) Multiplier(Alpha{3})
71.2 % ( 45 %) Slider(Pinvar{all})
26.1 % ( 29 %) ExtSPR(Tau{all},V{all})
17.2 % ( 15 %) ExtTBR(Tau{all},V{all})
34.2 % ( 37 %) NNI(Tau{all},V{all})
37.1 % ( 47 %) ParsSPR(Tau{all},V{all})
27.1 % ( 23 %) Multiplier(V{all})
41.8 % ( 36 %) Nodeslider(V{all})
26.6 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.75 0.53 0.37
2 | 166954 0.77 0.56
3 | 166330 166625 0.78
4 | 166231 166614 167246
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.75 0.53 0.37
2 | 167011 0.76 0.56
3 | 166301 166511 0.78
4 | 166707 166299 167171
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -841.26
| 1 |
| |
| 2 2 2 |
|22 2 1 2 2 1 2 |
| 1 2 2 1 2 1 1 2 1 1 |
|1 * 2 2 * * 21 11 22 2 212 1 1 1 |
| 2 2 1 * 11 1 1 2 1 * 2 22|
| 2 21 1 1 1 1 1*1 1 1 2 2 |
| 1 2 122 2 * 2 2 1 |
| 2 22 * 2 1 1 22 22 |
| 1 1 1* 2 2 |
| 11 2 2 1 2 2 1|
| 1 |
| 1 1 1 1 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -845.42
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -839.16 -851.97
2 -838.68 -851.79
--------------------------------------
TOTAL -838.89 -851.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.304420 0.004249 0.192208 0.436590 0.295201 867.53 937.34 1.000
r(A<->C){all} 0.087069 0.001616 0.013860 0.160857 0.082410 553.39 620.23 1.000
r(A<->G){all} 0.157403 0.002704 0.069745 0.263839 0.151584 497.65 528.29 1.001
r(A<->T){all} 0.100707 0.001639 0.026705 0.177595 0.096963 349.86 400.34 1.002
r(C<->G){all} 0.053979 0.001010 0.003957 0.117868 0.048972 525.66 679.42 1.001
r(C<->T){all} 0.542941 0.006004 0.404741 0.705339 0.542053 440.86 467.87 1.001
r(G<->T){all} 0.057900 0.001009 0.005587 0.120305 0.052467 398.34 539.83 1.000
pi(A){all} 0.267532 0.000490 0.223611 0.308719 0.267272 1089.42 1190.71 1.001
pi(C){all} 0.260152 0.000492 0.217138 0.303646 0.259480 1168.94 1334.97 1.001
pi(G){all} 0.227061 0.000475 0.186221 0.271200 0.226350 1137.35 1178.08 1.000
pi(T){all} 0.245256 0.000473 0.201398 0.286221 0.245012 1236.80 1282.96 1.000
alpha{1,2} 0.120502 0.011230 0.000061 0.294930 0.100671 1067.70 1113.04 1.000
alpha{3} 2.309624 1.642257 0.473627 4.929037 2.024246 1259.95 1319.39 1.000
pinvar{all} 0.472338 0.013584 0.237283 0.681523 0.479801 1168.29 1183.77 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
---------------
1 -- .********
2 -- .*.......
3 -- ..*......
4 -- ...*.....
5 -- ....*....
6 -- .....*...
7 -- ......*..
8 -- .......*.
9 -- ........*
10 -- ..**.****
11 -- ..**.....
12 -- .....***.
13 -- ..*******
14 -- ..**.***.
15 -- .....*.*.
16 -- ......**.
17 -- .....**..
18 -- ..**....*
19 -- .....****
20 -- .*..*....
---------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
10 3002 1.000000 0.000000 1.000000 1.000000 2
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 2992 0.996669 0.000942 0.996003 0.997335 2
13 2465 0.821119 0.000471 0.820786 0.821452 2
14 1269 0.422718 0.007066 0.417722 0.427715 2
15 1078 0.359094 0.000000 0.359094 0.359094 2
16 961 0.320120 0.000471 0.319787 0.320453 2
17 958 0.319121 0.000942 0.318454 0.319787 2
18 927 0.308794 0.001413 0.307795 0.309793 2
19 805 0.268155 0.005182 0.264490 0.271819 2
20 392 0.130580 0.002827 0.128581 0.132578 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.047918 0.000335 0.015993 0.083067 0.045025 1.000 2
length{all}[2] 0.031318 0.000213 0.008380 0.061805 0.029030 1.000 2
length{all}[3] 0.002920 0.000009 0.000001 0.008711 0.001988 1.000 2
length{all}[4] 0.002988 0.000009 0.000001 0.008770 0.002137 1.000 2
length{all}[5] 0.048110 0.000363 0.015214 0.085255 0.045184 1.000 2
length{all}[6] 0.003103 0.000010 0.000002 0.009431 0.002120 1.000 2
length{all}[7] 0.003117 0.000010 0.000005 0.009779 0.002098 1.000 2
length{all}[8] 0.003077 0.000010 0.000001 0.009478 0.002078 1.000 2
length{all}[9] 0.040232 0.000243 0.015337 0.072024 0.037707 1.000 2
length{all}[10] 0.042656 0.000330 0.013220 0.078418 0.039658 1.000 2
length{all}[11] 0.033877 0.000190 0.010533 0.060887 0.031312 1.000 2
length{all}[12] 0.019393 0.000099 0.003622 0.039550 0.017411 1.000 2
length{all}[13] 0.017873 0.000131 0.000323 0.038700 0.015676 1.000 2
length{all}[14] 0.006804 0.000039 0.000003 0.019275 0.004958 0.999 2
length{all}[15] 0.003236 0.000011 0.000001 0.009618 0.002246 0.999 2
length{all}[16] 0.003012 0.000009 0.000002 0.009179 0.001968 0.999 2
length{all}[17] 0.003148 0.000011 0.000004 0.010431 0.002053 1.000 2
length{all}[18] 0.006178 0.000042 0.000010 0.017834 0.004022 0.999 2
length{all}[19] 0.005926 0.000039 0.000004 0.017026 0.004133 1.000 2
length{all}[20] 0.009581 0.000083 0.000067 0.024355 0.007275 1.008 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.001756
Maximum standard deviation of split frequencies = 0.007066
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
| /------------------ C3 (3)
| /-------100-------+
| | \------------------ C4 (4)
+ |
| | /------------------ C6 (6)
| | |
| /-------100-------+-------100-------+------------------ C7 (7)
| | | |
| | | \------------------ C8 (8)
\--------82-------+ |
| \------------------------------------ C9 (9)
|
\------------------------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/----------------------------------- C1 (1)
|
|---------------------- C2 (2)
|
| /-- C3 (3)
| /-----------------------+
| | \-- C4 (4)
+ |
| | /-- C6 (6)
| | |
| /------------------------------+------------+-- C7 (7)
| | | |
| | | \-- C8 (8)
\-----------+ |
| \----------------------------- C9 (9)
|
\----------------------------------- C5 (5)
|--------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (35 trees sampled):
50 % credible set contains 5 trees
90 % credible set contains 14 trees
95 % credible set contains 19 trees
99 % credible set contains 25 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Tue Oct 25 21:14:53 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=9, Len=119
C1 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNIQYPIKWRCIYT
C2 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C3 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C4 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C5 MDYVSLLNQVWQKQVNSAHEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C6 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C7 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C8 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C9 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGTLQYPIKWRCIYT
*****************::******:***:*******.:* *********
C1 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C2 FAGYTGTSTEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C3 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C4 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C5 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C6 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C7 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C8 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C9 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
*******:*****.***************: ****** *********::*
C1 RYDASKSYFYTQTSSSSNE
C2 RYDASKSYFYTETSSSSNE
C3 RYDASKSYFYTQTSSSSHE
C4 RYDASKSYFYTQTSSSSHE
C5 RYDASKSYFYTKTPSSPEE
C6 RYDASKSYFYTETSSSSDE
C7 RYDASKSYFYTETSSSSDE
C8 RYDASKSYFYTETSSSSDE
C9 RYDASKSYFYTETSSSSDE
***********:*.**..*
-- Starting log on Tue Oct 25 21:56:20 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/codeml,TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 357 sites
reading seq# 2 C2 357 sites
reading seq# 3 C3 357 sites
reading seq# 4 C4 357 sites
reading seq# 5 C5 357 sites
reading seq# 6 C6 357 sites
reading seq# 7 C7 357 sites
reading seq# 8 C8 357 sites
reading seq# 9 C9 357 sitesns = 9 ls = 357
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Sequences read..
Counting site patterns.. 0:00
Compressing, 83 patterns at 119 / 119 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 83 patterns at 119 / 119 sites (100.0%), 0:00
Counting codons..
288 bytes for distance
81008 bytes for conP
7304 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, (((3, 4), (6, 7, 8), 9), 5)); MP score: 59
202520 bytes for conP, adjusted
0.056963 0.025134 0.097272 0.073908 0.087720 0.029615 0.023274 0.040306 0.081411 0.102258 0.081785 0.059132 0.023004 0.300000 0.500842 0.269769
ntime & nrate & np: 13 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.491284
np = 16
lnL0 = -921.661118
Iterating by ming2
Initial: fx= 921.661118
x= 0.05696 0.02513 0.09727 0.07391 0.08772 0.02962 0.02327 0.04031 0.08141 0.10226 0.08179 0.05913 0.02300 0.30000 0.50084 0.26977
1 h-m-p 0.0000 0.0002 450.1957 +++ 895.543402 m 0.0002 22 | 1/16
2 h-m-p 0.0000 0.0000 358.2465 ++ 891.992549 m 0.0000 41 | 2/16
3 h-m-p 0.0000 0.0000 3117.5690 ++ 870.694773 m 0.0000 60 | 3/16
4 h-m-p 0.0000 0.0000 13187.8239 ++ 870.586138 m 0.0000 79 | 4/16
5 h-m-p 0.0000 0.0000 1172.8615 ++ 867.338106 m 0.0000 98 | 5/16
6 h-m-p 0.0001 0.0040 102.5627 ++YCYCCC 856.026919 5 0.0029 127 | 5/16
7 h-m-p 0.0000 0.0002 772.5091 +YYCCCC 851.770078 5 0.0001 155 | 5/16
8 h-m-p 0.0001 0.0006 137.0507 YCCC 850.774252 3 0.0002 179 | 5/16
9 h-m-p 0.0006 0.0053 53.8010 +CYCCC 844.835168 4 0.0035 207 | 5/16
10 h-m-p 0.0004 0.0019 61.9840 YCCCC 843.340881 4 0.0010 233 | 5/16
11 h-m-p 0.0006 0.0032 28.6185 +YCYCCC 841.307168 5 0.0019 261 | 5/16
12 h-m-p 0.0018 0.0091 26.9331 YCYC 840.762519 3 0.0014 284 | 5/16
13 h-m-p 0.0021 0.0104 8.4548 YYCC 840.621022 3 0.0015 307 | 5/16
14 h-m-p 0.0032 0.1143 4.0965 +CYCCC 838.580657 4 0.0173 334 | 5/16
15 h-m-p 0.3999 2.9804 0.1776 +YCYCCCC 828.464650 6 2.0331 364 | 5/16
16 h-m-p 0.7084 3.5418 0.1951 YCCC 825.510120 3 1.2732 399 | 5/16
17 h-m-p 0.8932 8.0000 0.2782 YCYCCC 824.528973 5 0.4330 437 | 5/16
18 h-m-p 0.6227 8.0000 0.1934 +CCC 822.119127 2 3.2676 472 | 5/16
19 h-m-p 0.8389 4.1943 0.0710 YCCCC 821.708121 4 1.7048 509 | 5/16
20 h-m-p 0.9443 8.0000 0.1282 +YC 820.971482 1 2.3776 541 | 5/16
21 h-m-p 1.6000 8.0000 0.0945 CCCC 820.638417 3 2.5699 577 | 5/16
22 h-m-p 1.6000 8.0000 0.0417 YCCC 820.352927 3 3.1511 612 | 5/16
23 h-m-p 1.6000 8.0000 0.0207 CC 820.339584 1 1.8719 644 | 5/16
24 h-m-p 1.6000 8.0000 0.0104 CC 820.336399 1 1.7883 676 | 5/16
25 h-m-p 1.6000 8.0000 0.0099 C 820.335343 0 1.6110 706 | 5/16
26 h-m-p 1.6000 8.0000 0.0002 C 820.335298 0 1.3044 736 | 5/16
27 h-m-p 0.3603 8.0000 0.0008 +Y 820.335279 0 3.3491 767 | 5/16
28 h-m-p 1.6000 8.0000 0.0002 C 820.335274 0 1.5467 797 | 5/16
29 h-m-p 1.5628 8.0000 0.0002 C 820.335273 0 2.3657 827 | 5/16
30 h-m-p 1.6000 8.0000 0.0001 C 820.335273 0 2.0124 857 | 5/16
31 h-m-p 1.6000 8.0000 0.0000 C 820.335273 0 1.8926 887 | 5/16
32 h-m-p 1.6000 8.0000 0.0000 C 820.335273 0 1.9223 917 | 5/16
33 h-m-p 1.6000 8.0000 0.0000 C 820.335273 0 1.3527 947 | 5/16
34 h-m-p 1.6000 8.0000 0.0000 C 820.335273 0 1.6000 977 | 5/16
35 h-m-p 1.6000 8.0000 0.0000 ----------Y 820.335273 0 0.0000 1017
Out..
lnL = -820.335273
1018 lfun, 3054 eigenQcodon, 26468 P(t)
end of tree file.
Time used: 0:10
Model 2: PositiveSelection
TREE # 1
(1, 2, (((3, 4), (6, 7, 8), 9), 5)); MP score: 59
0.064099 0.086325 0.035092 0.082161 0.023832 0.074117 0.095692 0.065502 0.063154 0.010732 0.036196 0.063363 0.020991 2.984472 0.871516 0.379392 0.357207 1.451661
ntime & nrate & np: 13 3 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.824438
np = 18
lnL0 = -878.621353
Iterating by ming2
Initial: fx= 878.621353
x= 0.06410 0.08633 0.03509 0.08216 0.02383 0.07412 0.09569 0.06550 0.06315 0.01073 0.03620 0.06336 0.02099 2.98447 0.87152 0.37939 0.35721 1.45166
1 h-m-p 0.0000 0.0001 500.3354 ++ 862.946274 m 0.0001 23 | 1/18
2 h-m-p 0.0000 0.0002 291.4986 ++ 851.046231 m 0.0002 44 | 2/18
3 h-m-p 0.0000 0.0000 6353.6955 ++ 841.647870 m 0.0000 65 | 3/18
4 h-m-p 0.0000 0.0000 12183.9332 ++ 838.649164 m 0.0000 86 | 4/18
5 h-m-p 0.0000 0.0002 153.5409 ++ 835.997673 m 0.0002 107 | 5/18
6 h-m-p 0.0002 0.0045 50.3787 +YCYCCC 834.627455 5 0.0020 137 | 5/18
7 h-m-p 0.0003 0.0016 161.5884 ++ 831.352891 m 0.0016 158 | 6/18
8 h-m-p 0.0036 0.0179 11.1754 CYC 831.199991 2 0.0034 182 | 6/18
9 h-m-p 0.0006 0.0151 62.3577 ++CCC 828.442972 2 0.0097 209 | 6/18
10 h-m-p 0.0002 0.0010 326.9368 YCCC 827.950311 3 0.0004 235 | 6/18
11 h-m-p 0.0011 0.0056 37.6244 CCC 827.695725 2 0.0018 260 | 6/18
12 h-m-p 0.0056 0.0278 2.5047 ++ 827.122528 m 0.0278 281 | 6/18
13 h-m-p 0.0044 0.1529 7.2320 CCCC 826.969421 3 0.0043 308 | 6/18
14 h-m-p 0.0099 0.1261 3.1450 ++ 824.703401 m 0.1261 329 | 6/18
15 h-m-p 0.2815 1.4077 0.2721 YCYCCC 821.858234 5 0.6081 358 | 6/18
16 h-m-p 0.2119 5.4721 0.7807 +CYC 820.981720 2 0.7984 395 | 6/18
17 h-m-p 1.6000 8.0000 0.3302 YCCC 820.605648 3 0.8300 433 | 6/18
18 h-m-p 0.9502 7.4470 0.2884 CCC 820.403655 2 1.0670 470 | 5/18
19 h-m-p 0.8740 8.0000 0.3521 CYC 820.341790 2 0.6742 506 | 5/18
20 h-m-p 1.2487 8.0000 0.1901 YC 820.285831 1 0.8537 541 | 5/18
21 h-m-p 1.6000 8.0000 0.0500 YC 820.277375 1 1.1015 576 | 5/18
22 h-m-p 1.6000 8.0000 0.0297 YC 820.273809 1 2.6699 611 | 5/18
23 h-m-p 1.6000 8.0000 0.0224 YC 820.270225 1 2.8093 646 | 5/18
24 h-m-p 1.6000 8.0000 0.0139 CC 820.269270 1 2.2526 682 | 5/18
25 h-m-p 1.6000 8.0000 0.0184 CC 820.268811 1 2.0316 718 | 5/18
26 h-m-p 1.6000 8.0000 0.0200 +YC 820.267926 1 7.0760 754 | 5/18
27 h-m-p 1.4708 8.0000 0.0961 +YC 820.265436 1 3.7508 790 | 5/18
28 h-m-p 1.6000 8.0000 0.1462 CC 820.263081 1 2.0324 826 | 5/18
29 h-m-p 0.8641 8.0000 0.3439 CCC 820.261036 2 1.0901 864 | 5/18
30 h-m-p 1.6000 8.0000 0.1726 YC 820.259057 1 0.9265 899 | 5/18
31 h-m-p 0.6931 8.0000 0.2307 YC 820.258158 1 1.2996 934 | 5/18
32 h-m-p 1.6000 8.0000 0.0679 YC 820.257633 1 1.1076 969 | 5/18
33 h-m-p 0.3357 8.0000 0.2241 +CCC 820.256546 2 2.3211 1008 | 5/18
34 h-m-p 1.6000 8.0000 0.1604 YCC 820.255421 2 2.5115 1045 | 5/18
35 h-m-p 0.9295 8.0000 0.4335 C 820.255023 0 0.9295 1079 | 5/18
36 h-m-p 1.6000 8.0000 0.1339 C 820.254687 0 1.5231 1113 | 5/18
37 h-m-p 0.7094 8.0000 0.2875 +YC 820.254343 1 2.2124 1149 | 5/18
38 h-m-p 1.6000 8.0000 0.1903 C 820.254139 0 2.2591 1183 | 5/18
39 h-m-p 0.8805 8.0000 0.4881 CC 820.253987 1 1.4144 1219 | 5/18
40 h-m-p 1.6000 8.0000 0.2819 C 820.253910 0 2.2374 1253 | 5/18
41 h-m-p 1.6000 8.0000 0.3133 C 820.253862 0 2.3441 1287 | 5/18
42 h-m-p 1.6000 8.0000 0.2951 Y 820.253837 0 3.0626 1321 | 5/18
43 h-m-p 1.6000 8.0000 0.4116 C 820.253828 0 1.7265 1355 | 5/18
44 h-m-p 1.6000 8.0000 0.3194 C 820.253824 0 2.3875 1389 | 5/18
45 h-m-p 1.6000 8.0000 0.3988 C 820.253821 0 2.0668 1423 | 5/18
46 h-m-p 1.6000 8.0000 0.3450 Y 820.253820 0 2.8110 1457 | 5/18
47 h-m-p 1.6000 8.0000 0.3470 C 820.253820 0 2.2520 1491 | 5/18
48 h-m-p 1.6000 8.0000 0.3509 Y 820.253820 0 2.9472 1525 | 5/18
49 h-m-p 1.6000 8.0000 0.3444 C 820.253820 0 2.1903 1559 | 5/18
50 h-m-p 1.6000 8.0000 0.3418 Y 820.253820 0 3.0331 1593 | 5/18
51 h-m-p 1.6000 8.0000 0.3794 C 820.253820 0 2.2999 1627 | 5/18
52 h-m-p 1.6000 8.0000 0.3538 Y 820.253820 0 2.7494 1661 | 5/18
53 h-m-p 1.6000 8.0000 0.2848 C 820.253820 0 2.0808 1695 | 5/18
54 h-m-p 1.0961 8.0000 0.5406 ++ 820.253820 m 8.0000 1729 | 5/18
55 h-m-p 1.6000 8.0000 1.0344 ----------------.. | 5/18
56 h-m-p 0.0160 8.0000 0.0013 ---Y 820.253820 0 0.0001 1801 | 5/18
57 h-m-p 0.0160 8.0000 0.0002 -Y 820.253820 0 0.0007 1836
Out..
lnL = -820.253820
1837 lfun, 7348 eigenQcodon, 71643 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -827.196004 S = -779.898594 -87.048809
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 83 patterns 0:35
did 20 / 83 patterns 0:35
did 30 / 83 patterns 0:36
did 40 / 83 patterns 0:36
did 50 / 83 patterns 0:36
did 60 / 83 patterns 0:36
did 70 / 83 patterns 0:36
did 80 / 83 patterns 0:36
did 83 / 83 patterns 0:36end of tree file.
Time used: 0:36
Model 7: beta
TREE # 1
(1, 2, (((3, 4), (6, 7, 8), 9), 5)); MP score: 59
0.073018 0.011192 0.072402 0.084688 0.045360 0.016207 0.038299 0.066490 0.038712 0.102316 0.017054 0.015845 0.096300 3.030496 0.831645 1.100845
ntime & nrate & np: 13 1 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.780090
np = 16
lnL0 = -864.922502
Iterating by ming2
Initial: fx= 864.922502
x= 0.07302 0.01119 0.07240 0.08469 0.04536 0.01621 0.03830 0.06649 0.03871 0.10232 0.01705 0.01584 0.09630 3.03050 0.83165 1.10084
1 h-m-p 0.0000 0.0001 648.1321 ++ 841.648205 m 0.0001 21 | 1/16
2 h-m-p 0.0000 0.0000 269.2794 ++ 841.391655 m 0.0000 40 | 2/16
3 h-m-p 0.0000 0.0000 10255.7336 ++ 833.675335 m 0.0000 59 | 3/16
4 h-m-p 0.0000 0.0000 188759.1590 ++ 833.648816 m 0.0000 78 | 4/16
5 h-m-p 0.0000 0.0003 212.4265 +++ 826.106595 m 0.0003 98 | 5/16
6 h-m-p 0.0011 0.0059 19.7650 +YCYCCC 824.850140 5 0.0032 126 | 5/16
7 h-m-p 0.0006 0.0028 32.6964 CCCCC 824.622718 4 0.0007 153 | 5/16
8 h-m-p 0.0011 0.0219 19.4841 +CCCCC 823.823754 4 0.0065 181 | 5/16
9 h-m-p 0.0009 0.0051 145.5592 YCYCCC 821.727163 5 0.0021 208 | 5/16
10 h-m-p 0.0026 0.0131 17.1324 CC 821.661849 1 0.0009 229 | 5/16
11 h-m-p 0.0028 0.0570 5.7780 CC 821.582331 1 0.0041 250 | 5/16
12 h-m-p 0.0019 0.0327 12.4452 CCCC 821.464625 3 0.0028 275 | 5/16
13 h-m-p 0.0371 1.1145 0.9432 +CCCC 821.276101 3 0.1796 301 | 5/16
14 h-m-p 0.6036 7.2063 0.2807 YC 821.013832 1 1.0909 332 | 5/16
15 h-m-p 1.0377 5.1887 0.2920 +YYCYCCC 820.622752 6 3.4148 372 | 5/16
16 h-m-p 0.2949 1.4747 0.3542 YCCCCC 820.572132 5 0.4138 411 | 5/16
17 h-m-p 0.2667 1.9407 0.5495 YCCC 820.532556 3 0.1812 446 | 5/16
18 h-m-p 0.2567 8.0000 0.3880 CC 820.512412 1 0.2596 478 | 5/16
19 h-m-p 1.6000 8.0000 0.0111 YC 820.510837 1 1.0348 509 | 5/16
20 h-m-p 1.6000 8.0000 0.0052 YC 820.510801 1 1.0085 540 | 5/16
21 h-m-p 1.6000 8.0000 0.0006 Y 820.510800 0 1.0813 570 | 5/16
22 h-m-p 1.6000 8.0000 0.0001 C 820.510799 0 1.8742 600 | 5/16
23 h-m-p 1.6000 8.0000 0.0000 C 820.510799 0 2.4062 630 | 5/16
24 h-m-p 1.6000 8.0000 0.0000 Y 820.510799 0 1.0499 660 | 5/16
25 h-m-p 1.6000 8.0000 0.0000 Y 820.510799 0 0.9703 690 | 5/16
26 h-m-p 1.6000 8.0000 0.0000 C 820.510799 0 0.5000 720 | 5/16
27 h-m-p 1.0181 8.0000 0.0000 ---------------Y 820.510799 0 0.0000 765
Out..
lnL = -820.510799
766 lfun, 8426 eigenQcodon, 99580 P(t)
end of tree file.
Time used: 1:11
Model 8: beta&w>1
TREE # 1
(1, 2, (((3, 4), (6, 7, 8), 9), 5)); MP score: 59
0.033109 0.057000 0.025724 0.063312 0.011712 0.047732 0.103464 0.108735 0.108650 0.066003 0.102546 0.051604 0.039115 2.994285 0.900000 0.922684 1.069794 1.300000
ntime & nrate & np: 13 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.987786
np = 18
lnL0 = -895.790283
Iterating by ming2
Initial: fx= 895.790283
x= 0.03311 0.05700 0.02572 0.06331 0.01171 0.04773 0.10346 0.10873 0.10865 0.06600 0.10255 0.05160 0.03912 2.99428 0.90000 0.92268 1.06979 1.30000
1 h-m-p 0.0000 0.0005 661.4621 +++ 857.893389 m 0.0005 24 | 1/18
2 h-m-p 0.0000 0.0001 243.0252 ++ 852.732721 m 0.0001 45 | 2/18
3 h-m-p 0.0000 0.0000 3742.2377 ++ 839.892783 m 0.0000 66 | 3/18
4 h-m-p 0.0000 0.0000 188.3461 ++ 838.861204 m 0.0000 87 | 4/18
5 h-m-p 0.0000 0.0000 256.7899 ++ 838.702824 m 0.0000 108 | 5/18
6 h-m-p 0.0000 0.0087 21.8008 +++CYCCC 837.893753 4 0.0034 139 | 5/18
7 h-m-p 0.0002 0.0010 93.8038 ++ 836.449422 m 0.0010 160 | 6/18
8 h-m-p 0.0006 0.0037 120.3682 YCCCC 835.424805 4 0.0013 188 | 6/18
9 h-m-p 0.0028 0.0139 34.1931 YCCCCC 834.169730 5 0.0061 218 | 6/18
10 h-m-p 0.0021 0.0107 25.1333 YCCCC 833.675922 4 0.0038 246 | 6/18
11 h-m-p 0.0047 0.0236 17.4854 YYCC 833.379172 3 0.0034 271 | 5/18
12 h-m-p 0.0016 0.0138 36.4922 +CYCCC 831.762138 4 0.0052 300 | 5/18
13 h-m-p 0.0064 0.0321 9.0139 YC 831.676468 1 0.0028 322 | 5/18
14 h-m-p 0.0482 3.0651 0.5311 ++YCCCC 827.695155 4 1.4169 352 | 5/18
15 h-m-p 0.1018 0.5090 2.2770 CYC 826.943877 2 0.0999 389 | 5/18
16 h-m-p 0.1864 0.9319 1.1781 YCCC 824.551719 3 0.4073 415 | 5/18
17 h-m-p 0.4339 2.1697 0.6417 CYCCC 822.651840 4 0.8344 443 | 5/18
18 h-m-p 0.2822 1.4110 0.3485 +YCCCC 821.470618 4 0.7664 485 | 5/18
19 h-m-p 0.4636 2.3181 0.3400 CCCC 820.899375 3 0.4757 525 | 5/18
20 h-m-p 0.6401 3.2006 0.2120 CYYC 820.571979 3 0.6212 563 | 5/18
21 h-m-p 0.4946 2.4732 0.1760 CYC 820.503569 2 0.4809 600 | 5/18
22 h-m-p 0.5532 7.7197 0.1530 YC 820.469007 1 0.9232 635 | 5/18
23 h-m-p 1.0004 7.3075 0.1412 YCCC 820.433281 3 2.1828 674 | 5/18
24 h-m-p 0.9052 4.5262 0.1576 CCC 820.417385 2 0.9459 712 | 5/18
25 h-m-p 1.6000 8.0000 0.0189 YC 820.410400 1 1.0880 747 | 5/18
26 h-m-p 0.4771 8.0000 0.0430 +YC 820.405518 1 1.4549 783 | 5/18
27 h-m-p 0.8188 6.8239 0.0765 CY 820.404147 1 0.7837 819 | 5/18
28 h-m-p 1.6000 8.0000 0.0109 YC 820.403470 1 1.0533 854 | 5/18
29 h-m-p 0.8514 8.0000 0.0135 YC 820.403012 1 1.8428 889 | 5/18
30 h-m-p 1.6000 8.0000 0.0116 ++ 820.400574 m 8.0000 923 | 5/18
31 h-m-p 0.6373 8.0000 0.1460 +YCC 820.388375 2 4.1463 961 | 5/18
32 h-m-p 1.5587 8.0000 0.3883 CC 820.369748 1 2.0702 997 | 5/18
33 h-m-p 1.6000 8.0000 0.1792 YYC 820.355529 2 1.3112 1033 | 5/18
34 h-m-p 0.3677 8.0000 0.6391 +YCC 820.338396 2 2.4950 1071 | 5/18
35 h-m-p 1.4051 7.0257 1.1024 YC 820.327588 1 1.0980 1106 | 5/18
36 h-m-p 1.0023 8.0000 1.2078 CC 820.317477 1 1.1381 1129 | 5/18
37 h-m-p 1.0003 8.0000 1.3742 +YC 820.306797 1 2.8879 1152 | 5/18
38 h-m-p 1.6000 8.0000 1.6164 CCC 820.300194 2 2.2288 1177 | 5/18
39 h-m-p 1.4039 8.0000 2.5662 YC 820.295329 1 2.5019 1199 | 5/18
40 h-m-p 1.6000 8.0000 2.9953 YC 820.292072 1 2.5668 1221 | 5/18
41 h-m-p 1.5634 8.0000 4.9178 C 820.290075 0 1.5634 1242 | 5/18
42 h-m-p 1.1565 8.0000 6.6477 YC 820.288340 1 1.9406 1264 | 5/18
43 h-m-p 1.2840 6.4198 7.7996 YC 820.286884 1 2.6085 1286 | 5/18
44 h-m-p 0.5378 2.6891 11.0544 +Y 820.285873 0 2.2731 1308 | 5/18
45 h-m-p 0.0627 0.3134 14.6752 ++ 820.285709 m 0.3134 1329 | 6/18
46 h-m-p 0.0472 6.6882 12.8273 --------------.. | 6/18
47 h-m-p 0.0005 0.2251 0.4852 YC 820.285618 1 0.0008 1384 | 6/18
48 h-m-p 0.0018 0.3579 0.2067 C 820.285607 0 0.0006 1417 | 6/18
49 h-m-p 0.0041 2.0612 0.0547 C 820.285605 0 0.0012 1450 | 6/18
50 h-m-p 0.0106 5.2777 0.0484 Y 820.285604 0 0.0019 1483 | 6/18
51 h-m-p 0.0058 2.8761 0.1272 Y 820.285597 0 0.0039 1516 | 6/18
52 h-m-p 0.0041 2.0402 0.4328 C 820.285571 0 0.0047 1549 | 6/18
53 h-m-p 0.0064 3.2176 1.6252 +YC 820.285140 1 0.0203 1584 | 6/18
54 h-m-p 0.0010 0.4179 32.0482 +YC 820.282181 1 0.0071 1607 | 6/18
55 h-m-p 0.0106 0.1992 21.3555 -CC 820.281910 1 0.0010 1631 | 6/18
56 h-m-p 0.0182 1.4066 1.1436 -C 820.281891 0 0.0013 1653 | 6/18
57 h-m-p 0.0160 8.0000 0.4236 ++++YYC 820.261184 2 3.6608 1680 | 6/18
58 h-m-p 1.6000 8.0000 0.2294 YC 820.259408 1 0.7427 1714 | 6/18
59 h-m-p 1.6000 8.0000 0.0914 CC 820.258942 1 1.3621 1749 | 6/18
60 h-m-p 1.6000 8.0000 0.0272 Y 820.258936 0 0.9258 1782 | 6/18
61 h-m-p 1.6000 8.0000 0.0001 Y 820.258936 0 0.9493 1815 | 6/18
62 h-m-p 0.6553 8.0000 0.0002 C 820.258936 0 0.8148 1848 | 6/18
63 h-m-p 1.6000 8.0000 0.0000 -C 820.258936 0 0.1000 1882
Out..
lnL = -820.258936
1883 lfun, 22596 eigenQcodon, 269269 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -826.279185 S = -779.922183 -74.188182
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 83 patterns 2:48
did 20 / 83 patterns 2:48
did 30 / 83 patterns 2:48
did 40 / 83 patterns 2:48
did 50 / 83 patterns 2:48
did 60 / 83 patterns 2:49
did 70 / 83 patterns 2:49
did 80 / 83 patterns 2:49
did 83 / 83 patterns 2:49end of tree file.
Time used: 2:49
The loglikelihoods for models M1, M2, M7 and M8 are -820.335273 -820.253820 -820.510799 -820.258936 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNIQYPIKWRCIYTFAGYTGTATE
BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYTFAGYTGTSTE
LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATE
HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATE
BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAHEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYTFAGYTGTATE
TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATE
TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATE
TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATE
YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGTLQYPIKWRCIYTFAGYTGTATE
*****************::******:***:*******.:* ****************:**
BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 PTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRNRYDASKSYFYTQTSSSSNE
BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 PTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRNRYDASKSYFYTETSSSSNE
LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTQTSSSSHE
HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTQTSSSSHE
BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRNRYDASKSYFYTKTPSSPEE
TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTETSSSSDE
TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTETSSSSDE
TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTETSSSSDE
YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 PTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTETSSSSDE
***.***************: ****** *********::************:*.**..*
>BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCGCTCAAGAAGGAACCTTGGCTCCTATTCGCCCTACGTACGCCTATCGGCCAGTGCAGGGAAATATTCAGTACCCAATTAAGTGGCGCTGCATCTACACCTTCGCAGGCTACACAGGCACTGCAACCGAGCCAACCAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTCAGGCTTCAAGATGACGGACGACTCGATGGATTTGAGCTTAGACTGCGTTATAGCACAGCCTTCCAGCGAAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGCAAACGTCGTCGTCATCCAATGAA >BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCACTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCGCTCAAGAAGGAACCTTGGCTCCTATTCGCCCTACATTTGCCTACAGGCCAGTGCAGGGAAATCTTCAGTGTCCTATTAAGTGGCGCTGCATTTACACATTTGCAGGCTACACAGGCACTTCAACTGAGCCAACCAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGATGACGGACGACTCGATGGATTTGAGCTTAGACTGCGTTATAGCACAGCCTTCCAGCGAAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCAATGAA >LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCTCTCAAGAAGGAACTTTGGCTCCTGTTCGCCCTACATACGCCTATCGGCCAGTGCAGGGAAATCTTCAGTGTCCTATCAAGTGGCGTTGCATTTACACTTTTGCAGGCTACACAGGTACTGCAACTGAGCCAACTAAAGTATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGCAAACGTCGTCGTCATCCCATGAA >HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCTCTCAAGAAGGAACTTTGGCTCCTGTTCGCCCTACATACGCCTATCGGCCAGTGCAGGGAAATCTTCAGTGTCCTATCAAGTGGCGTTGCATTTACACTTTTGCAGGCTACACAGGTACTGCAACTGAGCCAACTAAAGTATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGCAAACGTCGTCGTCATCCCATGAA >BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCGCTCACGAAGGAACTTTGGCTCCTATTCGCCCCACATTTGCCTATCGGCCAGTGCAGGGTAATCTTCAGTGTCCTATCAAGTGGCGCTGCATCTATACTTTTGCAGGCTACACGGGTACTGCAACTGAGCCAACCAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGATGACGGACGACTCGATGGATTTGAACTTAGACTGCGTTATAGCACAGCCTTCCAGCGAAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGAAAACGCCGTCGTCACCCGAAGAA >TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTCAATTCCGCTCAAGAAGGAACTTTGGCTCCTATTCGCCCTACATACGCCTATCGGCCAGTGCAGGGTAACCTTCAGTGTCCTATTAAGTGGCGCTGCATCTACACTTTTGCAGGCTACACAGGCACTGCAACCGAGCCAACTAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAA >TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTCAATTCCGCTCAAGAAGGAACTTTGGCTCCTATTCGCCCTACATACGCCTATCGGCCAGTGCAGGGTAACCTTCAGTGTCCTATTAAGTGGCGCTGCATCTACACTTTTGCAGGCTACACAGGCACTGCAACCGAGCCAACTAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAA >TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTCAATTCCGCTCAAGAAGGAACTTTGGCTCCTATTCGCCCTACATACGCCTATCGGCCAGTGCAGGGTAACCTTCAGTGTCCTATTAAGTGGCGCTGCATCTACACTTTTGCAGGCTACACAGGCACTGCAACCGAGCCAACTAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAA >YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCGCTCAAGAAGGGACTTTGGCTCCTATTCGCCCTACATACGCCTACAGGCCAGTGCAGGGAACTCTCCAGTACCCTATTAAGTGGCGCTGCATCTACACTTTTGCAGGCTACACAGGTACTGCTACTGAGCCAACCAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTCTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAA
>BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNIQYPIKWRCIYTFAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRNRYDASKSYFYTQTSSSSNE >BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYTFAGYTGTSTEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRNRYDASKSYFYTETSSSSNE >LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTQTSSSSHE >HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTQTSSSSHE >BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAHEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYTFAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRNRYDASKSYFYTKTPSSPEE >TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTETSSSSDE >TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTETSSSSDE >TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYTFAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTETSSSSDE >YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGTLQYPIKWRCIYTFAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHNRYDASKSYFYTETSSSSDE
Reading sequence file /data//pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/codeml/fasta/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1
Found 9 sequences of length 357
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 5.1%
Found 29 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 6
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 32 polymorphic sites
**p-Value(s)**
----------
NSS: 1.00e-03 (1000 permutations)
Max Chi^2: 2.64e-01 (1000 permutations)
PHI (Permutation): 7.00e-03 (1000 permutations)
PHI (Normal): 6.34e-03
#NEXUS
[ID: 4000349257]
begin taxa;
dimensions ntax=9;
taxlabels
BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
;
end;
begin trees;
translate
1 BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
2 BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
3 LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
4 HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
5 BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
6 TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
7 TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
8 TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
9 YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:4.502484e-02,2:2.902955e-02,(((3:1.988076e-03,4:2.137087e-03)1.000:3.131237e-02,(6:2.120126e-03,7:2.098102e-03,8:2.077773e-03)0.997:1.741078e-02,9:3.770706e-02)1.000:3.965818e-02,5:4.518372e-02)0.821:1.567614e-02);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:4.502484e-02,2:2.902955e-02,(((3:1.988076e-03,4:2.137087e-03):3.131237e-02,(6:2.120126e-03,7:2.098102e-03,8:2.077773e-03):1.741078e-02,9:3.770706e-02):3.965818e-02,5:4.518372e-02):1.567614e-02);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -839.16 -851.97
2 -838.68 -851.79
--------------------------------------
TOTAL -838.89 -851.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.304420 0.004249 0.192208 0.436590 0.295201 867.53 937.34 1.000
r(A<->C){all} 0.087069 0.001616 0.013860 0.160857 0.082410 553.39 620.23 1.000
r(A<->G){all} 0.157403 0.002704 0.069745 0.263839 0.151584 497.65 528.29 1.001
r(A<->T){all} 0.100707 0.001639 0.026705 0.177595 0.096963 349.86 400.34 1.002
r(C<->G){all} 0.053979 0.001010 0.003957 0.117868 0.048972 525.66 679.42 1.001
r(C<->T){all} 0.542941 0.006004 0.404741 0.705339 0.542053 440.86 467.87 1.001
r(G<->T){all} 0.057900 0.001009 0.005587 0.120305 0.052467 398.34 539.83 1.000
pi(A){all} 0.267532 0.000490 0.223611 0.308719 0.267272 1089.42 1190.71 1.001
pi(C){all} 0.260152 0.000492 0.217138 0.303646 0.259480 1168.94 1334.97 1.001
pi(G){all} 0.227061 0.000475 0.186221 0.271200 0.226350 1137.35 1178.08 1.000
pi(T){all} 0.245256 0.000473 0.201398 0.286221 0.245012 1236.80 1282.96 1.000
alpha{1,2} 0.120502 0.011230 0.000061 0.294930 0.100671 1067.70 1113.04 1.000
alpha{3} 2.309624 1.642257 0.473627 4.929037 2.024246 1259.95 1319.39 1.000
pinvar{all} 0.472338 0.013584 0.237283 0.681523 0.479801 1168.29 1183.77 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 9 ls = 119
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 3 2 2 3 2 | Ser TCT 1 1 2 2 1 1 | Tyr TAT 4 3 5 5 5 5 | Cys TGT 0 1 1 1 1 1
TTC 3 2 2 2 2 2 | TCC 3 3 3 3 2 3 | TAC 6 5 5 5 3 5 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 1 3 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 3 2 3 3 2 3 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 4 4 4 4 4 | Pro CCT 2 3 3 3 2 3 | His CAT 0 0 1 1 0 0 | Arg CGT 2 2 3 3 2 2
CTC 3 2 2 2 2 2 | CCC 0 0 0 0 2 0 | CAC 0 0 1 1 1 1 | CGC 2 2 1 1 2 2
CTA 0 0 0 0 0 0 | CCA 3 2 2 2 2 2 | Gln CAA 4 3 4 4 2 3 | CGA 2 2 1 1 2 1
CTG 2 2 2 2 2 2 | CCG 0 0 0 0 1 0 | CAG 6 6 5 5 6 5 | CGG 1 0 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 1 1 1 2 | Thr ACT 1 2 5 5 4 4 | Asn AAT 4 4 3 3 3 2 | Ser AGT 0 0 0 0 0 0
ATC 1 0 1 1 2 1 | ACC 4 2 0 0 1 1 | AAC 1 1 1 1 1 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 2 4 3 3 2 3 | Lys AAA 3 3 3 3 4 3 | Arg AGA 1 1 1 1 1 1
Met ATG 1 1 1 1 1 1 | ACG 3 2 2 2 3 2 | AAG 3 3 3 3 3 3 | AGG 2 3 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 4 4 3 2 | Ala GCT 3 3 2 2 3 3 | Asp GAT 4 4 3 3 4 4 | Gly GGT 0 0 1 1 2 1
GTC 0 0 0 0 0 1 | GCC 4 4 4 4 4 4 | GAC 1 1 0 0 1 0 | GGC 2 2 1 1 1 2
GTA 0 0 1 1 0 0 | GCA 4 3 3 3 4 4 | Glu GAA 3 4 3 3 5 4 | GGA 4 4 5 5 3 4
GTG 2 2 2 2 2 2 | GCG 0 0 0 0 0 0 | GAG 2 2 3 3 1 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------
Phe TTT 2 2 2 | Ser TCT 1 1 1 | Tyr TAT 5 5 4 | Cys TGT 1 1 0
TTC 2 2 2 | TCC 3 3 3 | TAC 5 5 7 | TGC 2 2 2
Leu TTA 1 1 1 | TCA 1 1 1 | *** TAA 0 0 0 | *** TGA 0 0 0
TTG 1 1 1 | TCG 3 3 3 | TAG 0 0 0 | Trp TGG 2 2 2
--------------------------------------------------------------------------------------
Leu CTT 4 4 3 | Pro CCT 3 3 3 | His CAT 0 0 0 | Arg CGT 2 2 2
CTC 2 2 3 | CCC 0 0 0 | CAC 1 1 1 | CGC 2 2 2
CTA 0 0 0 | CCA 2 2 2 | Gln CAA 3 3 3 | CGA 1 1 1
CTG 2 2 2 | CCG 0 0 0 | CAG 5 5 5 | CGG 1 1 0
--------------------------------------------------------------------------------------
Ile ATT 2 2 2 | Thr ACT 4 4 5 | Asn AAT 2 2 2 | Ser AGT 0 0 0
ATC 1 1 1 | ACC 1 1 1 | AAC 2 2 1 | AGC 1 1 1
ATA 0 0 0 | ACA 3 3 3 | Lys AAA 3 3 3 | Arg AGA 1 1 1
Met ATG 1 1 1 | ACG 2 2 2 | AAG 3 3 3 | AGG 2 2 3
--------------------------------------------------------------------------------------
Val GTT 2 2 2 | Ala GCT 3 3 4 | Asp GAT 4 4 4 | Gly GGT 1 1 1
GTC 1 1 1 | GCC 4 4 4 | GAC 0 0 0 | GGC 2 2 1
GTA 0 0 0 | GCA 4 4 3 | Glu GAA 4 4 4 | GGA 4 4 4
GTG 2 2 2 | GCG 0 0 0 | GAG 3 3 3 | GGG 0 0 1
--------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.23529 C:0.24370 A:0.25210 G:0.26891
position 2: T:0.19328 C:0.28571 A:0.34454 G:0.17647
position 3: T:0.25210 C:0.27731 A:0.23529 G:0.23529
Average T:0.22689 C:0.26891 A:0.27731 G:0.22689
#2: C2
position 1: T:0.24370 C:0.23529 A:0.25210 G:0.26891
position 2: T:0.20168 C:0.28571 A:0.32773 G:0.18487
position 3: T:0.30252 C:0.22689 A:0.25210 G:0.21849
Average T:0.24930 C:0.24930 A:0.27731 G:0.22409
#3: C3
position 1: T:0.25210 C:0.25210 A:0.22689 G:0.26891
position 2: T:0.20168 C:0.27731 A:0.33613 G:0.18487
position 3: T:0.33613 C:0.20168 A:0.23529 G:0.22689
Average T:0.26331 C:0.24370 A:0.26611 G:0.22689
#4: C4
position 1: T:0.25210 C:0.25210 A:0.22689 G:0.26891
position 2: T:0.20168 C:0.27731 A:0.33613 G:0.18487
position 3: T:0.33613 C:0.20168 A:0.23529 G:0.22689
Average T:0.26331 C:0.24370 A:0.26611 G:0.22689
#5: C5
position 1: T:0.21849 C:0.26050 A:0.24370 G:0.27731
position 2: T:0.20168 C:0.28571 A:0.32773 G:0.18487
position 3: T:0.31933 C:0.22689 A:0.22689 G:0.22689
Average T:0.24650 C:0.25770 A:0.26611 G:0.22969
#6: C6
position 1: T:0.24370 C:0.23529 A:0.23529 G:0.28571
position 2: T:0.19328 C:0.28571 A:0.33613 G:0.18487
position 3: T:0.30252 C:0.24370 A:0.22689 G:0.22689
Average T:0.24650 C:0.25490 A:0.26611 G:0.23249
#7: C7
position 1: T:0.24370 C:0.23529 A:0.23529 G:0.28571
position 2: T:0.19328 C:0.28571 A:0.33613 G:0.18487
position 3: T:0.30252 C:0.24370 A:0.22689 G:0.22689
Average T:0.24650 C:0.25490 A:0.26611 G:0.23249
#8: C8
position 1: T:0.24370 C:0.23529 A:0.23529 G:0.28571
position 2: T:0.19328 C:0.28571 A:0.33613 G:0.18487
position 3: T:0.30252 C:0.24370 A:0.22689 G:0.22689
Average T:0.24650 C:0.25490 A:0.26611 G:0.23249
#9: C9
position 1: T:0.24370 C:0.22689 A:0.24370 G:0.28571
position 2: T:0.19328 C:0.29412 A:0.33613 G:0.17647
position 3: T:0.29412 C:0.25210 A:0.21849 G:0.23529
Average T:0.24370 C:0.25770 A:0.26611 G:0.23249
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 19 | Ser S TCT 11 | Tyr Y TAT 41 | Cys C TGT 7
TTC 19 | TCC 26 | TAC 46 | TGC 18
Leu L TTA 9 | TCA 11 | *** * TAA 0 | *** * TGA 0
TTG 9 | TCG 25 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 33 | Pro P CCT 25 | His H CAT 2 | Arg R CGT 20
CTC 20 | CCC 2 | CAC 7 | CGC 16
CTA 0 | CCA 19 | Gln Q CAA 29 | CGA 12
CTG 18 | CCG 1 | CAG 48 | CGG 7
------------------------------------------------------------------------------
Ile I ATT 17 | Thr T ACT 34 | Asn N AAT 25 | Ser S AGT 0
ATC 9 | ACC 11 | AAC 12 | AGC 9
ATA 0 | ACA 26 | Lys K AAA 28 | Arg R AGA 9
Met M ATG 9 | ACG 20 | AAG 27 | AGG 20
------------------------------------------------------------------------------
Val V GTT 25 | Ala A GCT 26 | Asp D GAT 34 | Gly G GGT 8
GTC 4 | GCC 36 | GAC 3 | GGC 14
GTA 2 | GCA 32 | Glu E GAA 34 | GGA 37
GTG 18 | GCG 0 | GAG 23 | GGG 1
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.24183 C:0.24183 A:0.23903 G:0.27731
position 2: T:0.19701 C:0.28478 A:0.33520 G:0.18301
position 3: T:0.30532 C:0.23529 A:0.23156 G:0.22782
Average T:0.24805 C:0.25397 A:0.26860 G:0.22938
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, (((3, 4), (6, 7, 8), 9), 5)); MP score: 59
lnL(ntime: 13 np: 16): -820.335273 +0.000000
10..1 10..2 10..11 11..12 12..13 13..3 13..4 12..14 14..6 14..7 14..8 12..9 11..5
0.101158 0.061321 0.032294 0.083746 0.075870 0.000004 0.000004 0.044937 0.000004 0.000004 0.000004 0.086705 0.102362 2.984472 0.834147 0.071597
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.588415
(1: 0.101158, 2: 0.061321, (((3: 0.000004, 4: 0.000004): 0.075870, (6: 0.000004, 7: 0.000004, 8: 0.000004): 0.044937, 9: 0.086705): 0.083746, 5: 0.102362): 0.032294);
(C1: 0.101158, C2: 0.061321, (((C3: 0.000004, C4: 0.000004): 0.075870, (C6: 0.000004, C7: 0.000004, C8: 0.000004): 0.044937, C9: 0.086705): 0.083746, C5: 0.102362): 0.032294);
Detailed output identifying parameters
kappa (ts/tv) = 2.98447
MLEs of dN/dS (w) for site classes (K=2)
p: 0.83415 0.16585
w: 0.07160 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.101 255.6 101.4 0.2256 0.0171 0.0757 4.4 7.7
10..2 0.061 255.6 101.4 0.2256 0.0103 0.0459 2.6 4.7
10..11 0.032 255.6 101.4 0.2256 0.0055 0.0242 1.4 2.4
11..12 0.084 255.6 101.4 0.2256 0.0141 0.0627 3.6 6.4
12..13 0.076 255.6 101.4 0.2256 0.0128 0.0568 3.3 5.8
13..3 0.000 255.6 101.4 0.2256 0.0000 0.0000 0.0 0.0
13..4 0.000 255.6 101.4 0.2256 0.0000 0.0000 0.0 0.0
12..14 0.045 255.6 101.4 0.2256 0.0076 0.0336 1.9 3.4
14..6 0.000 255.6 101.4 0.2256 0.0000 0.0000 0.0 0.0
14..7 0.000 255.6 101.4 0.2256 0.0000 0.0000 0.0 0.0
14..8 0.000 255.6 101.4 0.2256 0.0000 0.0000 0.0 0.0
12..9 0.087 255.6 101.4 0.2256 0.0146 0.0649 3.7 6.6
11..5 0.102 255.6 101.4 0.2256 0.0173 0.0766 4.4 7.8
Time used: 0:10
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, (((3, 4), (6, 7, 8), 9), 5)); MP score: 59
lnL(ntime: 13 np: 18): -820.253820 +0.000000
10..1 10..2 10..11 11..12 12..13 13..3 13..4 12..14 14..6 14..7 14..8 12..9 11..5
0.101579 0.061887 0.031511 0.084202 0.075971 0.000004 0.000004 0.044875 0.000004 0.000004 0.000004 0.086663 0.102806 3.030496 0.894000 0.000000 0.099279 1.378549
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.589512
(1: 0.101579, 2: 0.061887, (((3: 0.000004, 4: 0.000004): 0.075971, (6: 0.000004, 7: 0.000004, 8: 0.000004): 0.044875, 9: 0.086663): 0.084202, 5: 0.102806): 0.031511);
(C1: 0.101579, C2: 0.061887, (((C3: 0.000004, C4: 0.000004): 0.075971, (C6: 0.000004, C7: 0.000004, C8: 0.000004): 0.044875, C9: 0.086663): 0.084202, C5: 0.102806): 0.031511);
Detailed output identifying parameters
kappa (ts/tv) = 3.03050
MLEs of dN/dS (w) for site classes (K=3)
p: 0.89400 0.00000 0.10600
w: 0.09928 1.00000 1.37855
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.102 255.4 101.6 0.2349 0.0176 0.0748 4.5 7.6
10..2 0.062 255.4 101.6 0.2349 0.0107 0.0456 2.7 4.6
10..11 0.032 255.4 101.6 0.2349 0.0055 0.0232 1.4 2.4
11..12 0.084 255.4 101.6 0.2349 0.0146 0.0620 3.7 6.3
12..13 0.076 255.4 101.6 0.2349 0.0131 0.0559 3.4 5.7
13..3 0.000 255.4 101.6 0.2349 0.0000 0.0000 0.0 0.0
13..4 0.000 255.4 101.6 0.2349 0.0000 0.0000 0.0 0.0
12..14 0.045 255.4 101.6 0.2349 0.0078 0.0330 2.0 3.4
14..6 0.000 255.4 101.6 0.2349 0.0000 0.0000 0.0 0.0
14..7 0.000 255.4 101.6 0.2349 0.0000 0.0000 0.0 0.0
14..8 0.000 255.4 101.6 0.2349 0.0000 0.0000 0.0 0.0
12..9 0.087 255.4 101.6 0.2349 0.0150 0.0638 3.8 6.5
11..5 0.103 255.4 101.6 0.2349 0.0178 0.0757 4.5 7.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
30 Y 0.885 1.231
41 Y 0.866 1.208
99 R 0.658 0.941
112 Q 0.990** 1.366
118 N 0.989* 1.365
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
112 Q 0.607 1.942 +- 1.395
118 N 0.565 1.808 +- 1.253
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.599 0.381 0.020 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.495 0.244 0.119 0.059 0.031 0.018 0.012 0.009 0.007 0.006
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.007
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.008 0.102
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.017 0.081 0.287
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.023 0.075 0.163 0.230
sum of density on p0-p1 = 1.000000
Time used: 0:36
Model 7: beta (10 categories)
TREE # 1: (1, 2, (((3, 4), (6, 7, 8), 9), 5)); MP score: 59
lnL(ntime: 13 np: 16): -820.510799 +0.000000
10..1 10..2 10..11 11..12 12..13 13..3 13..4 12..14 14..6 14..7 14..8 12..9 11..5
0.100934 0.061049 0.032716 0.083528 0.075848 0.000004 0.000004 0.044991 0.000004 0.000004 0.000004 0.086749 0.102041 2.994285 0.116397 0.391461
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.587875
(1: 0.100934, 2: 0.061049, (((3: 0.000004, 4: 0.000004): 0.075848, (6: 0.000004, 7: 0.000004, 8: 0.000004): 0.044991, 9: 0.086749): 0.083528, 5: 0.102041): 0.032716);
(C1: 0.100934, C2: 0.061049, (((C3: 0.000004, C4: 0.000004): 0.075848, (C6: 0.000004, C7: 0.000004, C8: 0.000004): 0.044991, C9: 0.086749): 0.083528, C5: 0.102041): 0.032716);
Detailed output identifying parameters
kappa (ts/tv) = 2.99428
Parameters in M7 (beta):
p = 0.11640 q = 0.39146
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00004 0.00070 0.00609 0.03362 0.13324 0.38321 0.75338 0.98243
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.101 255.6 101.4 0.2293 0.0172 0.0751 4.4 7.6
10..2 0.061 255.6 101.4 0.2293 0.0104 0.0454 2.7 4.6
10..11 0.033 255.6 101.4 0.2293 0.0056 0.0243 1.4 2.5
11..12 0.084 255.6 101.4 0.2293 0.0142 0.0621 3.6 6.3
12..13 0.076 255.6 101.4 0.2293 0.0129 0.0564 3.3 5.7
13..3 0.000 255.6 101.4 0.2293 0.0000 0.0000 0.0 0.0
13..4 0.000 255.6 101.4 0.2293 0.0000 0.0000 0.0 0.0
12..14 0.045 255.6 101.4 0.2293 0.0077 0.0335 2.0 3.4
14..6 0.000 255.6 101.4 0.2293 0.0000 0.0000 0.0 0.0
14..7 0.000 255.6 101.4 0.2293 0.0000 0.0000 0.0 0.0
14..8 0.000 255.6 101.4 0.2293 0.0000 0.0000 0.0 0.0
12..9 0.087 255.6 101.4 0.2293 0.0148 0.0645 3.8 6.5
11..5 0.102 255.6 101.4 0.2293 0.0174 0.0759 4.4 7.7
Time used: 1:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, (((3, 4), (6, 7, 8), 9), 5)); MP score: 59
lnL(ntime: 13 np: 18): -820.258936 +0.000000
10..1 10..2 10..11 11..12 12..13 13..3 13..4 12..14 14..6 14..7 14..8 12..9 11..5
0.101574 0.061881 0.031513 0.084201 0.075971 0.000004 0.000004 0.044876 0.000004 0.000004 0.000004 0.086663 0.102797 3.031056 0.894921 11.074147 99.000000 1.381815
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.589495
(1: 0.101574, 2: 0.061881, (((3: 0.000004, 4: 0.000004): 0.075971, (6: 0.000004, 7: 0.000004, 8: 0.000004): 0.044876, 9: 0.086663): 0.084201, 5: 0.102797): 0.031513);
(C1: 0.101574, C2: 0.061881, (((C3: 0.000004, C4: 0.000004): 0.075971, (C6: 0.000004, C7: 0.000004, C8: 0.000004): 0.044876, C9: 0.086663): 0.084201, C5: 0.102797): 0.031513);
Detailed output identifying parameters
kappa (ts/tv) = 3.03106
Parameters in M8 (beta&w>1):
p0 = 0.89492 p = 11.07415 q = 99.00000
(p1 = 0.10508) w = 1.38181
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08949 0.08949 0.08949 0.08949 0.08949 0.08949 0.08949 0.08949 0.08949 0.08949 0.10508
w: 0.05812 0.07141 0.08016 0.08762 0.09466 0.10179 0.10948 0.11843 0.13020 0.15136 1.38181
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.102 255.4 101.6 0.2350 0.0176 0.0748 4.5 7.6
10..2 0.062 255.4 101.6 0.2350 0.0107 0.0456 2.7 4.6
10..11 0.032 255.4 101.6 0.2350 0.0055 0.0232 1.4 2.4
11..12 0.084 255.4 101.6 0.2350 0.0146 0.0620 3.7 6.3
12..13 0.076 255.4 101.6 0.2350 0.0131 0.0559 3.4 5.7
13..3 0.000 255.4 101.6 0.2350 0.0000 0.0000 0.0 0.0
13..4 0.000 255.4 101.6 0.2350 0.0000 0.0000 0.0 0.0
12..14 0.045 255.4 101.6 0.2350 0.0078 0.0330 2.0 3.4
14..6 0.000 255.4 101.6 0.2350 0.0000 0.0000 0.0 0.0
14..7 0.000 255.4 101.6 0.2350 0.0000 0.0000 0.0 0.0
14..8 0.000 255.4 101.6 0.2350 0.0000 0.0000 0.0 0.0
12..9 0.087 255.4 101.6 0.2350 0.0150 0.0638 3.8 6.5
11..5 0.103 255.4 101.6 0.2350 0.0178 0.0757 4.5 7.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
30 Y 0.876 1.225
41 Y 0.857 1.200
99 R 0.653 0.939
112 Q 0.988* 1.367
118 N 0.987* 1.365
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
30 Y 0.517 1.400 +- 1.063
112 Q 0.764 1.936 +- 1.223
118 N 0.731 1.847 +- 1.167
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.152 0.842
p : 0.534 0.358 0.091 0.014 0.002 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.018 0.070 0.089 0.096 0.108 0.126 0.145 0.164 0.183
ws: 0.538 0.277 0.109 0.041 0.017 0.008 0.004 0.003 0.002 0.001
Time used: 2:49
Model 1: NearlyNeutral -820.335273 Model 2: PositiveSelection -820.253820 Model 7: beta -820.510799 Model 8: beta&w>1 -820.258936 Model 2 vs 1 .162906 Model 8 vs 7 .503726
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
