--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -647.82 -660.96
2 -647.93 -665.33
--------------------------------------
TOTAL -647.87 -664.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.094619 0.000665 0.050248 0.148044 0.091328 1421.47 1441.77 1.000
r(A<->C){all} 0.105840 0.003778 0.008375 0.228855 0.094510 316.81 425.09 1.000
r(A<->G){all} 0.172186 0.006908 0.032141 0.335241 0.159813 318.51 361.90 1.000
r(A<->T){all} 0.080640 0.002776 0.001671 0.178999 0.071481 327.85 469.68 1.001
r(C<->G){all} 0.039367 0.001549 0.000008 0.119285 0.027322 349.85 497.00 1.001
r(C<->T){all} 0.505276 0.010267 0.310899 0.698400 0.505749 446.42 470.40 1.000
r(G<->T){all} 0.096691 0.003135 0.005646 0.203415 0.087039 462.70 479.18 1.002
pi(A){all} 0.241701 0.000468 0.199043 0.283782 0.241689 1119.63 1226.01 1.000
pi(C){all} 0.250569 0.000503 0.208812 0.296062 0.249816 1173.45 1223.01 1.001
pi(G){all} 0.192929 0.000398 0.155918 0.233177 0.192453 1288.05 1294.35 1.000
pi(T){all} 0.314801 0.000550 0.271634 0.361426 0.313900 1199.69 1217.12 1.000
alpha{1,2} 0.600158 0.564324 0.000015 2.072402 0.337430 1044.67 1169.53 1.000
alpha{3} 1.197001 1.047704 0.000705 3.243417 0.934710 925.73 1004.67 1.000
pinvar{all} 0.572390 0.037415 0.169863 0.876821 0.605757 745.32 758.27 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -549.122912
Model 2: PositiveSelection -545.198852
Model 7: beta -549.323936
Model 8: beta&w>1 -545.209570
Model 2 vs 1 7.848120
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.999** 29.672
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.957* 6.994 +- 2.866
Model 8 vs 7 8.228732
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.999** 29.707
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.976* 6.635 +- 2.877
-- Starting log on Tue Oct 25 21:14:53 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=9, Len=121
C1 ------------------MMRVQRPPTLLLLLLVANAFSKPIGTPIPEHC
C2 ------------------MMRVQRPPTLLLILLVANAFSKPIGTSIPEHC
C3 MMSMRSRRSMFIEHFNELMMRVQRPPTLFLILLVANAFSKPIGTPIPEHC
C4 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C6 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C7 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C8 -------------------MRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C9 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
*********:*:*************.:****
C1 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C2 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C3 STLAGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C4 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C6 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C7 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C8 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C9 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
***.**********************************************
C1 SYDTSDPQLLSDIGYSFDYGK
C2 SYDTSDPQLLSDIGYSFDYGK
C3 SYDTSDPQQLSDIGYSFDYGK
C4 SYDTSDPQLLSDIGYSFDYGK
C5 SYDTSDPQLLSDIGYSFDYGK
C6 SYDTSDPQLLSDIGYSFDYGK
C7 SYDTSDPQLLSDIGYSFDYGK
C8 SYDNSDPQSLSDIGYSFDYGK
C9 SYDTSDPQLLSDIGYSFDYGK
***.**** ************
-- Starting log on Tue Oct 25 21:15:30 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=999, Nseq=9, Len=121
C1 ------------------MMRVQRPPTLLLLLLVANAFSKPIGTPIPEHC
C2 ------------------MMRVQRPPTLLLILLVANAFSKPIGTSIPEHC
C3 MMSMRSRRSMFIEHFNELMMRVQRPPTLFLILLVANAFSKPIGTPIPEHC
C4 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C6 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C7 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C8 -------------------MRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C9 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
*********:*:*************.:****
C1 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C2 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C3 STLAGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C4 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C6 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C7 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C8 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C9 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
***.**********************************************
C1 SYDTSDPQLLSDIGYSFDYGK
C2 SYDTSDPQLLSDIGYSFDYGK
C3 SYDTSDPQQLSDIGYSFDYGK
C4 SYDTSDPQLLSDIGYSFDYGK
C5 SYDTSDPQLLSDIGYSFDYGK
C6 SYDTSDPQLLSDIGYSFDYGK
C7 SYDTSDPQLLSDIGYSFDYGK
C8 SYDNSDPQSLSDIGYSFDYGK
C9 SYDTSDPQLLSDIGYSFDYGK
***.**** ************
-- Starting log on Tue Oct 25 21:27:34 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/gapped_alignment/codeml,TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 9 taxa and 363 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666733256
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 36268225
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4997353928
Seed = 408555307
Swapseed = 1666733256
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 15 unique site patterns
Division 2 has 12 unique site patterns
Division 3 has 20 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -739.806690 -- 32.479477
Chain 2 -- -737.050565 -- 32.479477
Chain 3 -- -733.707700 -- 32.479477
Chain 4 -- -737.956924 -- 32.479477
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -738.397722 -- 32.479477
Chain 2 -- -741.578334 -- 32.479477
Chain 3 -- -741.873629 -- 32.479477
Chain 4 -- -735.036071 -- 32.479477
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-739.807] (-737.051) (-733.708) (-737.957) * [-738.398] (-741.578) (-741.874) (-735.036)
1000 -- [-667.601] (-662.032) (-664.354) (-669.995) * (-665.754) (-656.655) (-663.642) [-663.677] -- 0:00:00
2000 -- [-660.106] (-656.525) (-660.554) (-668.898) * (-655.797) [-660.790] (-657.475) (-679.783) -- 0:08:19
3000 -- [-655.176] (-651.457) (-662.235) (-653.622) * [-655.557] (-660.365) (-659.939) (-659.016) -- 0:05:32
4000 -- (-658.936) [-660.892] (-660.326) (-656.173) * (-650.998) (-648.750) (-659.155) [-658.254] -- 0:04:09
5000 -- (-654.830) (-659.279) (-649.000) [-653.454] * [-655.373] (-655.454) (-657.510) (-660.577) -- 0:03:19
Average standard deviation of split frequencies: 0.068319
6000 -- [-646.776] (-659.855) (-654.783) (-662.286) * [-657.243] (-648.519) (-653.036) (-658.719) -- 0:05:31
7000 -- (-650.243) (-660.364) (-655.882) [-654.780] * (-649.692) (-662.275) [-658.010] (-664.336) -- 0:04:43
8000 -- (-652.433) (-654.084) (-657.192) [-656.473] * [-651.941] (-652.716) (-657.217) (-656.694) -- 0:04:08
9000 -- (-653.670) (-656.402) [-650.325] (-654.044) * (-647.253) [-650.727] (-669.768) (-660.135) -- 0:03:40
10000 -- [-656.543] (-655.544) (-650.611) (-656.975) * (-656.209) (-649.676) [-653.080] (-657.040) -- 0:03:18
Average standard deviation of split frequencies: 0.069053
11000 -- (-647.146) (-656.353) [-648.869] (-652.941) * [-652.085] (-650.869) (-661.904) (-664.636) -- 0:04:29
12000 -- (-662.004) (-656.338) [-649.019] (-661.105) * [-654.401] (-651.242) (-657.354) (-656.710) -- 0:04:07
13000 -- (-656.719) [-650.682] (-657.557) (-658.520) * [-649.627] (-646.744) (-655.432) (-658.766) -- 0:03:47
14000 -- [-651.691] (-658.257) (-654.375) (-654.638) * [-658.875] (-653.956) (-654.207) (-652.759) -- 0:03:31
15000 -- (-649.214) [-648.474] (-655.588) (-651.146) * (-665.270) (-651.499) (-650.924) [-654.570] -- 0:03:17
Average standard deviation of split frequencies: 0.053033
16000 -- (-654.776) (-658.884) (-664.292) [-654.524] * [-654.195] (-651.305) (-648.642) (-646.830) -- 0:04:06
17000 -- [-652.693] (-652.979) (-661.867) (-650.935) * [-654.469] (-650.659) (-651.055) (-649.331) -- 0:03:51
18000 -- (-663.695) (-654.761) [-649.845] (-664.491) * (-653.659) (-651.028) (-649.271) [-651.335] -- 0:03:38
19000 -- (-648.755) [-647.552] (-655.863) (-656.544) * (-657.697) (-653.450) [-646.558] (-651.379) -- 0:03:26
20000 -- (-657.738) [-661.665] (-652.640) (-658.384) * (-655.522) (-652.561) (-648.934) [-651.455] -- 0:04:05
Average standard deviation of split frequencies: 0.060379
21000 -- (-650.479) (-660.325) (-656.193) [-656.252] * (-656.216) [-650.951] (-650.905) (-650.409) -- 0:03:53
22000 -- [-656.938] (-648.054) (-656.196) (-654.464) * (-661.312) (-661.381) [-653.126] (-654.378) -- 0:03:42
23000 -- (-656.569) (-657.075) (-652.732) [-653.233] * (-656.159) (-648.516) (-647.795) [-654.116] -- 0:03:32
24000 -- (-660.492) (-656.876) [-649.393] (-650.003) * (-659.157) (-657.560) (-650.555) [-647.272] -- 0:03:23
25000 -- (-660.926) (-655.708) (-656.408) [-649.654] * (-650.731) [-654.540] (-654.779) (-656.907) -- 0:03:54
Average standard deviation of split frequencies: 0.047298
26000 -- (-659.325) [-653.361] (-651.667) (-656.021) * [-647.797] (-656.074) (-659.374) (-647.193) -- 0:03:44
27000 -- [-656.595] (-650.797) (-651.365) (-665.540) * (-653.423) (-662.722) (-657.684) [-652.321] -- 0:03:36
28000 -- (-658.550) [-650.443] (-647.939) (-653.903) * (-653.534) (-662.642) (-655.173) [-648.096] -- 0:03:28
29000 -- (-654.813) [-649.470] (-645.867) (-654.736) * (-658.171) (-657.366) (-661.941) [-642.384] -- 0:03:54
30000 -- (-655.327) (-663.471) (-656.267) [-655.970] * (-649.386) [-658.014] (-657.435) (-653.482) -- 0:03:46
Average standard deviation of split frequencies: 0.045347
31000 -- (-651.508) (-659.662) [-646.060] (-658.094) * (-650.637) (-655.270) [-650.833] (-649.839) -- 0:03:38
32000 -- (-649.215) (-658.377) [-653.078] (-656.771) * (-650.864) (-651.645) (-652.452) [-646.426] -- 0:03:31
33000 -- (-660.717) (-647.900) [-651.719] (-661.168) * (-658.626) (-645.980) (-652.543) [-649.382] -- 0:03:25
34000 -- [-651.921] (-655.544) (-657.261) (-658.499) * (-646.938) (-651.007) (-659.408) [-649.161] -- 0:03:47
35000 -- [-652.682] (-651.638) (-652.787) (-654.292) * (-655.110) (-649.299) (-651.640) [-650.841] -- 0:03:40
Average standard deviation of split frequencies: 0.045486
36000 -- (-651.078) (-667.207) (-662.950) [-654.189] * (-656.101) (-660.086) (-659.230) [-644.386] -- 0:03:34
37000 -- [-652.690] (-651.265) (-660.162) (-657.284) * (-651.451) (-656.493) [-658.676] (-649.456) -- 0:03:28
38000 -- [-651.862] (-649.823) (-658.638) (-660.789) * [-647.765] (-656.749) (-652.500) (-654.391) -- 0:03:47
39000 -- (-663.698) (-657.445) [-651.943] (-657.606) * [-646.870] (-653.437) (-654.319) (-655.818) -- 0:03:41
40000 -- [-648.016] (-654.144) (-654.047) (-665.112) * (-648.714) [-656.149] (-658.823) (-650.293) -- 0:03:36
Average standard deviation of split frequencies: 0.038867
41000 -- (-658.815) (-651.982) [-653.035] (-658.365) * (-647.548) (-652.548) (-657.399) [-651.767] -- 0:03:30
42000 -- (-659.474) [-655.687] (-657.124) (-655.407) * [-651.294] (-654.658) (-652.370) (-653.683) -- 0:03:25
43000 -- [-650.534] (-656.405) (-650.639) (-650.539) * (-667.346) (-657.920) (-661.697) [-650.135] -- 0:03:42
44000 -- [-648.743] (-651.048) (-652.324) (-653.869) * (-649.784) (-652.669) [-654.070] (-648.964) -- 0:03:37
45000 -- (-651.424) (-657.236) (-650.437) [-655.214] * (-652.552) [-651.865] (-648.533) (-650.461) -- 0:03:32
Average standard deviation of split frequencies: 0.034361
46000 -- (-664.878) (-651.309) (-657.479) [-648.565] * (-650.204) [-655.233] (-658.491) (-652.068) -- 0:03:27
47000 -- (-649.275) [-651.786] (-656.177) (-654.389) * (-652.077) (-667.451) [-652.673] (-648.745) -- 0:03:43
48000 -- (-648.112) [-657.453] (-669.655) (-650.979) * [-657.510] (-650.471) (-651.295) (-649.185) -- 0:03:38
49000 -- (-654.759) [-655.710] (-651.570) (-656.332) * (-652.240) (-648.554) (-651.693) [-649.076] -- 0:03:33
50000 -- (-658.397) [-654.424] (-651.351) (-657.230) * (-658.025) (-660.703) [-651.543] (-656.986) -- 0:03:29
Average standard deviation of split frequencies: 0.033932
51000 -- [-649.501] (-650.877) (-652.488) (-662.448) * (-649.440) [-652.115] (-657.756) (-659.627) -- 0:03:24
52000 -- [-651.713] (-653.265) (-649.798) (-657.335) * [-655.172] (-655.635) (-661.377) (-657.986) -- 0:03:38
53000 -- (-650.795) (-658.761) [-656.146] (-665.018) * (-658.459) [-652.463] (-655.960) (-650.677) -- 0:03:34
54000 -- (-657.049) (-655.145) [-650.310] (-658.646) * (-659.923) [-649.444] (-659.205) (-663.198) -- 0:03:30
55000 -- (-649.485) (-653.999) [-655.006] (-655.580) * (-644.789) [-653.985] (-648.130) (-659.769) -- 0:03:26
Average standard deviation of split frequencies: 0.031196
56000 -- (-650.975) [-647.467] (-663.966) (-649.903) * (-651.993) [-652.749] (-663.579) (-652.039) -- 0:03:39
57000 -- [-648.954] (-656.386) (-658.591) (-650.530) * (-650.570) (-655.302) [-654.570] (-648.730) -- 0:03:35
58000 -- (-653.097) [-645.763] (-654.501) (-656.962) * (-652.060) [-655.399] (-661.757) (-663.264) -- 0:03:31
59000 -- (-654.102) [-653.113] (-649.414) (-655.508) * (-658.903) (-650.725) [-659.135] (-650.946) -- 0:03:27
60000 -- (-654.656) (-654.998) [-651.069] (-657.335) * [-650.741] (-659.505) (-655.513) (-650.763) -- 0:03:23
Average standard deviation of split frequencies: 0.030625
61000 -- (-654.109) [-653.205] (-656.096) (-656.173) * (-651.295) (-648.839) [-659.506] (-657.365) -- 0:03:35
62000 -- (-651.408) (-653.240) [-650.743] (-677.889) * (-652.706) [-653.980] (-659.909) (-651.103) -- 0:03:31
63000 -- (-649.293) [-647.616] (-654.520) (-658.169) * (-651.187) [-657.910] (-665.906) (-659.275) -- 0:03:28
64000 -- (-655.390) (-656.141) (-655.012) [-650.339] * (-655.352) (-650.234) (-655.617) [-654.362] -- 0:03:24
65000 -- [-654.339] (-646.542) (-660.138) (-653.720) * (-662.886) [-652.265] (-653.625) (-650.330) -- 0:03:21
Average standard deviation of split frequencies: 0.025209
66000 -- [-648.669] (-655.525) (-650.239) (-652.359) * (-650.266) [-646.237] (-647.957) (-658.351) -- 0:03:32
67000 -- (-653.894) (-655.656) [-649.982] (-664.968) * (-661.355) (-650.571) [-651.945] (-649.466) -- 0:03:28
68000 -- (-650.446) [-650.834] (-651.825) (-648.894) * (-653.859) [-644.820] (-654.982) (-661.366) -- 0:03:25
69000 -- [-653.490] (-649.652) (-650.415) (-650.203) * (-654.561) [-653.944] (-654.875) (-651.883) -- 0:03:22
70000 -- (-662.788) (-662.902) (-653.470) [-649.866] * (-654.001) (-655.220) [-643.975] (-659.182) -- 0:03:32
Average standard deviation of split frequencies: 0.028017
71000 -- (-657.044) [-657.003] (-647.414) (-652.984) * [-653.069] (-650.825) (-650.973) (-656.835) -- 0:03:29
72000 -- (-657.351) (-653.524) [-650.821] (-649.418) * [-649.826] (-661.232) (-650.782) (-663.255) -- 0:03:26
73000 -- (-659.461) [-644.358] (-650.490) (-653.659) * (-650.137) [-647.391] (-652.559) (-659.239) -- 0:03:23
74000 -- [-652.803] (-655.014) (-660.681) (-647.415) * (-655.976) (-652.141) [-659.915] (-648.292) -- 0:03:20
75000 -- (-653.533) (-649.782) [-654.467] (-651.534) * [-650.494] (-655.401) (-659.198) (-652.166) -- 0:03:29
Average standard deviation of split frequencies: 0.023039
76000 -- (-654.658) (-655.434) [-657.214] (-660.833) * (-663.147) (-648.952) [-648.929] (-653.348) -- 0:03:26
77000 -- (-650.984) [-647.509] (-654.131) (-656.424) * (-653.909) [-647.320] (-650.964) (-651.960) -- 0:03:23
78000 -- [-661.322] (-656.417) (-653.425) (-656.070) * (-656.842) (-651.559) [-653.045] (-647.249) -- 0:03:20
79000 -- [-655.340] (-653.144) (-651.964) (-674.013) * (-662.520) (-659.894) [-650.981] (-645.915) -- 0:03:29
80000 -- (-656.969) [-650.365] (-654.107) (-657.310) * (-659.077) (-657.218) [-653.695] (-650.430) -- 0:03:27
Average standard deviation of split frequencies: 0.021817
81000 -- (-653.635) [-651.236] (-651.711) (-653.012) * (-659.764) (-652.739) (-657.622) [-651.079] -- 0:03:24
82000 -- (-653.116) (-654.547) (-659.863) [-657.719] * (-656.507) (-657.724) (-654.275) [-650.443] -- 0:03:21
83000 -- (-651.453) (-651.989) (-656.477) [-656.133] * (-657.069) (-655.300) [-654.784] (-650.153) -- 0:03:18
84000 -- (-659.972) (-649.163) (-652.820) [-657.681] * (-665.040) [-653.873] (-656.651) (-648.915) -- 0:03:27
85000 -- [-653.434] (-650.270) (-650.022) (-655.782) * (-657.491) (-656.360) [-646.831] (-649.198) -- 0:03:24
Average standard deviation of split frequencies: 0.021583
86000 -- (-655.277) (-653.944) [-653.545] (-654.418) * (-667.511) (-662.284) [-653.967] (-648.687) -- 0:03:21
87000 -- [-652.437] (-663.512) (-651.723) (-653.799) * (-654.126) (-649.626) [-652.257] (-652.358) -- 0:03:19
88000 -- (-663.963) [-654.989] (-652.983) (-659.226) * (-649.475) (-651.902) (-655.637) [-649.698] -- 0:03:27
89000 -- (-654.609) (-660.260) [-646.894] (-647.982) * (-655.523) (-648.713) (-653.866) [-651.908] -- 0:03:24
90000 -- (-654.965) [-654.191] (-658.875) (-652.100) * (-650.267) [-650.301] (-651.700) (-664.397) -- 0:03:22
Average standard deviation of split frequencies: 0.017433
91000 -- (-661.779) (-644.927) (-650.761) [-645.049] * (-649.760) [-652.375] (-653.883) (-655.198) -- 0:03:19
92000 -- [-648.754] (-650.345) (-653.176) (-657.621) * (-656.221) [-658.489] (-645.862) (-663.392) -- 0:03:17
93000 -- [-657.474] (-647.209) (-653.010) (-652.383) * (-662.405) (-651.951) (-655.153) [-659.092] -- 0:03:24
94000 -- [-648.731] (-652.942) (-653.109) (-651.684) * (-649.937) [-648.584] (-650.075) (-651.274) -- 0:03:22
95000 -- (-655.605) (-652.257) (-652.008) [-651.027] * (-657.890) (-654.284) (-652.809) [-652.945] -- 0:03:20
Average standard deviation of split frequencies: 0.019064
96000 -- (-651.280) (-655.501) [-650.013] (-655.158) * (-651.755) (-657.887) [-650.563] (-656.404) -- 0:03:17
97000 -- (-649.941) [-658.986] (-659.182) (-658.171) * (-651.931) (-656.619) (-650.509) [-653.164] -- 0:03:24
98000 -- [-650.731] (-650.674) (-655.019) (-650.971) * (-651.563) [-656.650] (-652.169) (-665.203) -- 0:03:22
99000 -- (-649.883) (-659.789) (-663.016) [-654.802] * [-651.262] (-654.757) (-651.486) (-663.443) -- 0:03:20
100000 -- (-656.619) (-648.108) (-658.959) [-653.644] * [-648.116] (-658.763) (-653.037) (-655.950) -- 0:03:18
Average standard deviation of split frequencies: 0.021951
101000 -- (-649.047) [-656.235] (-656.729) (-654.782) * [-656.475] (-648.798) (-651.306) (-654.379) -- 0:03:15
102000 -- [-650.163] (-655.078) (-657.342) (-654.448) * [-651.693] (-658.249) (-668.089) (-648.647) -- 0:03:22
103000 -- (-656.222) (-653.552) [-654.703] (-650.737) * (-650.160) (-658.375) [-654.146] (-662.187) -- 0:03:20
104000 -- [-656.983] (-651.717) (-650.845) (-653.420) * (-645.231) (-654.001) (-649.926) [-657.046] -- 0:03:18
105000 -- (-657.067) (-655.445) [-652.705] (-654.247) * [-648.110] (-666.400) (-651.799) (-657.830) -- 0:03:16
Average standard deviation of split frequencies: 0.019024
106000 -- (-655.208) (-650.407) [-652.377] (-655.067) * (-651.631) [-652.824] (-658.971) (-661.357) -- 0:03:22
107000 -- (-655.029) (-651.772) [-651.755] (-654.952) * (-650.859) [-649.120] (-660.817) (-649.970) -- 0:03:20
108000 -- (-652.493) (-660.637) [-647.695] (-655.310) * (-653.800) (-655.865) [-652.726] (-650.812) -- 0:03:18
109000 -- [-655.325] (-660.659) (-649.470) (-650.914) * (-652.060) [-652.864] (-652.158) (-662.690) -- 0:03:16
110000 -- (-657.875) [-652.631] (-652.765) (-650.539) * (-662.588) (-650.665) (-657.577) [-656.386] -- 0:03:22
Average standard deviation of split frequencies: 0.022630
111000 -- (-662.419) (-649.648) (-651.611) [-647.610] * (-651.272) (-650.745) [-649.338] (-663.699) -- 0:03:20
112000 -- (-652.313) [-651.336] (-656.723) (-653.926) * (-653.283) (-651.350) [-654.887] (-651.289) -- 0:03:18
113000 -- (-653.716) (-655.801) [-648.192] (-654.245) * [-647.651] (-658.345) (-649.340) (-654.713) -- 0:03:16
114000 -- (-656.260) [-649.865] (-653.000) (-656.202) * (-653.748) (-645.975) [-649.302] (-659.230) -- 0:03:14
115000 -- (-649.804) [-645.680] (-662.149) (-651.675) * (-658.258) (-650.019) (-651.409) [-651.146] -- 0:03:20
Average standard deviation of split frequencies: 0.022216
116000 -- [-652.403] (-657.633) (-652.446) (-659.704) * [-646.387] (-657.087) (-652.466) (-661.956) -- 0:03:18
117000 -- (-656.656) (-647.916) [-655.669] (-682.592) * (-647.231) [-656.098] (-659.038) (-652.412) -- 0:03:16
118000 -- (-649.120) (-650.317) [-648.244] (-652.764) * (-646.229) (-652.953) [-653.712] (-652.424) -- 0:03:14
119000 -- (-657.209) [-651.690] (-650.215) (-655.744) * (-652.287) (-655.457) (-649.216) [-656.811] -- 0:03:19
120000 -- (-656.327) [-650.236] (-649.830) (-647.078) * (-649.900) (-659.651) [-649.792] (-653.216) -- 0:03:18
Average standard deviation of split frequencies: 0.021731
121000 -- (-653.400) (-659.456) [-647.146] (-653.338) * (-650.783) (-659.067) (-667.402) [-655.453] -- 0:03:16
122000 -- [-652.792] (-658.558) (-649.020) (-649.206) * (-649.859) (-648.471) [-651.569] (-654.290) -- 0:03:14
123000 -- (-653.250) [-650.022] (-655.164) (-659.787) * (-652.386) [-649.876] (-657.233) (-657.221) -- 0:03:12
124000 -- [-648.246] (-664.971) (-649.759) (-655.958) * (-653.862) [-646.989] (-656.503) (-656.154) -- 0:03:17
125000 -- (-654.773) (-657.967) (-646.601) [-650.073] * (-659.888) [-644.728] (-649.573) (-649.683) -- 0:03:16
Average standard deviation of split frequencies: 0.021788
126000 -- (-655.858) (-653.213) (-663.762) [-655.197] * (-646.212) (-666.515) [-652.853] (-656.460) -- 0:03:14
127000 -- (-660.832) (-657.742) (-646.525) [-655.169] * (-649.128) (-646.590) (-654.638) [-654.734] -- 0:03:12
128000 -- [-654.023] (-655.392) (-647.969) (-651.850) * [-650.995] (-655.952) (-658.923) (-663.342) -- 0:03:17
129000 -- (-656.159) (-654.258) (-647.194) [-654.413] * (-655.436) [-651.707] (-662.129) (-666.336) -- 0:03:15
130000 -- (-658.503) (-660.696) (-650.894) [-648.930] * (-649.588) [-650.028] (-654.530) (-655.171) -- 0:03:14
Average standard deviation of split frequencies: 0.020519
131000 -- (-657.810) (-654.904) [-649.420] (-648.778) * [-645.656] (-663.138) (-668.292) (-657.566) -- 0:03:12
132000 -- (-652.895) [-651.388] (-649.833) (-662.198) * (-649.964) (-650.749) [-649.426] (-653.844) -- 0:03:17
133000 -- (-656.937) [-654.264] (-652.136) (-656.621) * (-662.663) (-654.318) (-654.802) [-648.128] -- 0:03:15
134000 -- (-656.916) (-658.551) [-651.846] (-659.874) * (-658.368) (-652.114) [-651.323] (-653.948) -- 0:03:13
135000 -- (-661.487) (-657.113) [-655.335] (-651.733) * (-650.300) [-648.664] (-652.850) (-653.114) -- 0:03:12
Average standard deviation of split frequencies: 0.021447
136000 -- (-664.720) (-647.629) [-653.432] (-651.876) * [-652.293] (-652.005) (-651.888) (-662.646) -- 0:03:16
137000 -- (-656.912) (-657.159) (-660.213) [-648.420] * [-645.948] (-651.120) (-649.575) (-656.984) -- 0:03:15
138000 -- (-654.315) (-653.634) (-662.932) [-659.400] * [-656.297] (-652.805) (-651.249) (-654.587) -- 0:03:13
139000 -- (-663.056) (-654.659) (-651.862) [-653.143] * (-657.303) (-647.545) [-649.909] (-650.883) -- 0:03:12
140000 -- (-656.074) (-662.607) [-653.555] (-653.141) * (-653.739) (-647.278) (-654.424) [-652.793] -- 0:03:16
Average standard deviation of split frequencies: 0.018851
141000 -- [-657.285] (-658.805) (-660.430) (-646.137) * (-649.519) [-647.179] (-652.811) (-649.973) -- 0:03:14
142000 -- (-664.464) (-652.076) (-665.032) [-653.185] * (-652.881) (-650.117) [-654.132] (-653.912) -- 0:03:13
143000 -- [-655.973] (-653.901) (-651.305) (-653.836) * (-647.595) (-648.233) [-649.496] (-657.738) -- 0:03:11
144000 -- [-646.251] (-653.705) (-656.272) (-650.244) * (-659.039) (-655.723) [-658.245] (-648.923) -- 0:03:10
145000 -- (-657.710) (-667.913) [-655.338] (-658.349) * (-652.857) (-652.062) (-655.360) [-652.981] -- 0:03:14
Average standard deviation of split frequencies: 0.019552
146000 -- (-651.276) (-667.696) (-662.305) [-653.156] * (-661.449) [-650.760] (-655.592) (-656.200) -- 0:03:13
147000 -- [-651.967] (-655.066) (-660.038) (-646.965) * (-647.348) (-661.285) (-657.896) [-657.104] -- 0:03:11
148000 -- [-647.212] (-655.287) (-661.351) (-657.635) * (-651.655) [-652.711] (-657.649) (-652.969) -- 0:03:09
149000 -- [-654.998] (-652.008) (-654.980) (-663.050) * (-650.786) (-657.295) (-656.893) [-654.869] -- 0:03:14
150000 -- (-661.775) (-654.259) [-654.505] (-651.458) * (-659.987) [-653.336] (-654.407) (-646.725) -- 0:03:12
Average standard deviation of split frequencies: 0.019141
151000 -- (-658.100) (-650.277) (-659.221) [-645.676] * (-655.290) [-658.240] (-657.994) (-656.255) -- 0:03:11
152000 -- (-654.245) (-648.696) (-653.709) [-650.829] * [-657.849] (-660.978) (-655.892) (-656.347) -- 0:03:09
153000 -- (-658.905) (-660.605) [-659.411] (-657.228) * (-663.877) (-650.179) [-652.176] (-647.954) -- 0:03:08
154000 -- (-653.587) (-648.426) [-647.536] (-653.908) * [-652.681] (-658.375) (-655.546) (-652.952) -- 0:03:12
155000 -- (-661.001) (-653.784) [-651.023] (-657.872) * (-654.709) (-659.152) (-650.700) [-643.926] -- 0:03:10
Average standard deviation of split frequencies: 0.020817
156000 -- (-652.774) [-650.192] (-653.695) (-654.507) * (-652.462) (-655.925) (-656.678) [-647.096] -- 0:03:09
157000 -- (-653.093) [-651.802] (-653.123) (-655.093) * (-656.739) (-653.984) [-654.158] (-662.776) -- 0:03:07
158000 -- (-655.915) [-656.071] (-652.199) (-656.548) * [-645.997] (-661.149) (-656.112) (-654.276) -- 0:03:11
159000 -- (-655.745) (-659.548) (-655.195) [-649.648] * [-652.031] (-656.535) (-658.756) (-657.338) -- 0:03:10
160000 -- [-653.818] (-650.587) (-651.419) (-655.495) * [-653.064] (-650.521) (-655.281) (-649.183) -- 0:03:09
Average standard deviation of split frequencies: 0.019158
161000 -- (-653.320) [-650.538] (-649.366) (-662.062) * (-653.492) (-653.799) (-658.395) [-648.443] -- 0:03:07
162000 -- (-650.202) (-652.694) [-647.741] (-658.679) * (-666.652) (-650.739) [-657.432] (-658.746) -- 0:03:06
163000 -- (-662.271) (-651.056) [-642.634] (-650.255) * [-645.155] (-662.613) (-651.471) (-654.897) -- 0:03:09
164000 -- (-659.113) (-653.497) (-655.577) [-646.340] * [-645.783] (-657.988) (-653.777) (-653.201) -- 0:03:08
165000 -- (-652.329) (-656.794) [-651.555] (-653.245) * [-654.811] (-656.326) (-653.343) (-659.397) -- 0:03:07
Average standard deviation of split frequencies: 0.019729
166000 -- (-653.566) (-654.003) (-651.247) [-650.561] * (-652.788) (-652.920) [-655.050] (-656.954) -- 0:03:05
167000 -- (-654.082) (-666.991) [-652.320] (-653.309) * (-653.042) (-652.847) [-647.009] (-663.104) -- 0:03:04
168000 -- (-648.648) (-654.508) (-649.281) [-650.560] * (-660.589) (-651.411) [-654.438] (-654.955) -- 0:03:08
169000 -- (-651.868) (-658.300) (-656.496) [-653.147] * (-646.074) (-658.487) (-659.172) [-653.110] -- 0:03:06
170000 -- (-654.749) (-652.256) (-657.077) [-655.021] * (-650.474) (-655.593) (-659.703) [-648.593] -- 0:03:05
Average standard deviation of split frequencies: 0.019660
171000 -- (-649.299) (-652.618) (-652.730) [-656.500] * (-651.262) (-657.576) (-656.073) [-651.196] -- 0:03:04
172000 -- (-651.750) (-652.576) (-648.974) [-647.659] * (-660.527) (-655.174) (-646.940) [-650.361] -- 0:03:07
173000 -- (-654.929) (-662.445) [-651.606] (-649.587) * (-651.840) (-647.815) (-650.688) [-653.886] -- 0:03:06
174000 -- (-651.589) (-652.841) [-647.927] (-646.725) * (-655.529) [-650.434] (-652.066) (-651.734) -- 0:03:05
175000 -- (-652.292) (-655.144) [-648.975] (-656.510) * [-658.923] (-652.906) (-656.316) (-656.088) -- 0:03:03
Average standard deviation of split frequencies: 0.022845
176000 -- [-651.356] (-657.354) (-652.163) (-653.735) * (-654.276) (-654.761) (-663.816) [-647.137] -- 0:03:02
177000 -- [-653.291] (-659.597) (-649.348) (-667.284) * (-653.600) (-648.594) (-664.341) [-652.854] -- 0:03:05
178000 -- [-653.624] (-659.251) (-655.782) (-653.524) * [-650.720] (-661.596) (-661.543) (-656.341) -- 0:03:04
179000 -- (-656.760) (-650.352) [-651.952] (-653.419) * [-646.709] (-657.102) (-651.964) (-651.289) -- 0:03:03
180000 -- (-657.326) [-649.735] (-650.594) (-661.705) * (-654.488) (-660.753) (-658.895) [-653.277] -- 0:03:02
Average standard deviation of split frequencies: 0.020874
181000 -- (-653.060) (-655.868) [-652.535] (-655.893) * (-651.791) [-651.587] (-654.036) (-653.889) -- 0:03:05
182000 -- (-661.898) (-658.234) [-647.839] (-655.504) * (-655.413) (-658.136) [-654.197] (-650.769) -- 0:03:04
183000 -- [-653.884] (-659.541) (-655.894) (-657.193) * (-655.490) [-652.819] (-658.810) (-655.232) -- 0:03:03
184000 -- (-651.685) (-658.526) [-651.635] (-655.793) * [-650.090] (-659.917) (-656.201) (-646.562) -- 0:03:01
185000 -- (-664.624) (-671.606) [-652.126] (-655.295) * (-652.786) (-651.717) [-652.308] (-650.549) -- 0:03:05
Average standard deviation of split frequencies: 0.021468
186000 -- (-654.545) (-652.337) (-654.481) [-654.297] * (-661.324) (-648.381) (-655.574) [-657.616] -- 0:03:03
187000 -- (-655.229) (-652.677) [-647.994] (-661.021) * (-654.819) (-657.130) [-652.745] (-658.288) -- 0:03:02
188000 -- (-650.063) [-647.803] (-654.043) (-657.146) * [-652.737] (-650.694) (-656.554) (-659.132) -- 0:03:01
189000 -- [-648.611] (-653.649) (-654.081) (-649.818) * (-656.158) (-654.155) (-665.509) [-649.468] -- 0:03:00
190000 -- (-655.699) (-652.435) [-651.629] (-653.788) * (-650.195) (-644.507) (-660.214) [-651.072] -- 0:03:03
Average standard deviation of split frequencies: 0.021524
191000 -- (-654.706) (-654.405) (-648.895) [-657.651] * [-659.563] (-652.972) (-654.945) (-648.814) -- 0:03:02
192000 -- (-647.657) [-650.583] (-651.978) (-656.286) * (-656.985) [-648.703] (-656.764) (-651.056) -- 0:03:00
193000 -- (-660.599) [-651.435] (-653.580) (-663.107) * [-652.058] (-651.662) (-655.601) (-655.767) -- 0:02:59
194000 -- (-655.942) [-651.295] (-653.727) (-658.008) * [-660.643] (-648.329) (-658.528) (-648.922) -- 0:03:02
195000 -- (-658.304) (-665.334) [-646.755] (-662.955) * [-652.077] (-653.382) (-656.109) (-657.608) -- 0:03:01
Average standard deviation of split frequencies: 0.019665
196000 -- (-651.370) (-657.718) [-653.969] (-654.781) * [-649.139] (-657.492) (-654.004) (-653.813) -- 0:03:00
197000 -- (-657.959) (-656.382) [-649.130] (-662.239) * (-650.015) (-656.821) [-655.711] (-657.090) -- 0:02:59
198000 -- (-662.665) (-658.712) (-656.289) [-653.520] * [-653.032] (-652.599) (-665.309) (-648.631) -- 0:02:58
199000 -- (-657.046) (-656.705) [-657.737] (-653.543) * [-647.213] (-647.564) (-655.664) (-657.114) -- 0:03:01
200000 -- (-651.241) [-648.013] (-649.114) (-653.310) * [-649.687] (-657.246) (-662.040) (-657.931) -- 0:03:00
Average standard deviation of split frequencies: 0.018379
201000 -- [-651.245] (-649.630) (-650.917) (-658.037) * (-657.303) (-663.482) (-657.662) [-644.173] -- 0:02:58
202000 -- (-657.767) (-644.430) [-656.738] (-648.773) * (-649.122) [-650.298] (-649.494) (-651.995) -- 0:02:57
203000 -- (-653.482) (-647.177) [-657.874] (-649.064) * (-653.752) (-651.991) (-657.845) [-646.845] -- 0:02:56
204000 -- (-664.574) (-647.003) (-657.940) [-651.445] * (-653.087) (-653.945) [-648.603] (-650.117) -- 0:02:59
205000 -- (-651.229) (-656.269) [-649.397] (-656.642) * [-655.781] (-650.097) (-662.609) (-658.656) -- 0:02:58
Average standard deviation of split frequencies: 0.017365
206000 -- (-649.754) (-663.672) [-652.071] (-651.500) * (-656.519) [-658.240] (-652.883) (-657.665) -- 0:02:57
207000 -- (-661.636) [-649.645] (-652.191) (-651.182) * (-655.008) (-659.700) (-658.315) [-651.822] -- 0:02:56
208000 -- (-654.975) (-656.078) [-648.203] (-658.323) * (-656.756) (-665.227) [-648.119] (-653.756) -- 0:02:58
209000 -- (-649.484) (-653.710) (-653.141) [-647.077] * [-649.965] (-662.469) (-653.866) (-649.383) -- 0:02:57
210000 -- [-656.423] (-658.969) (-651.934) (-650.282) * (-657.399) (-660.860) [-647.998] (-653.509) -- 0:02:56
Average standard deviation of split frequencies: 0.016848
211000 -- (-653.854) (-652.861) (-653.265) [-654.644] * [-648.986] (-654.157) (-651.687) (-660.440) -- 0:02:55
212000 -- (-650.247) (-651.914) (-660.753) [-655.606] * (-652.043) [-651.902] (-659.491) (-652.983) -- 0:02:54
213000 -- (-653.416) [-655.029] (-648.263) (-654.522) * [-654.599] (-650.324) (-660.308) (-653.249) -- 0:02:57
214000 -- (-662.793) (-649.321) [-645.228] (-652.532) * [-651.803] (-655.589) (-656.159) (-656.709) -- 0:02:56
215000 -- (-653.376) [-648.293] (-656.821) (-656.448) * (-660.283) (-647.315) [-650.738] (-654.623) -- 0:02:55
Average standard deviation of split frequencies: 0.016176
216000 -- (-658.410) [-649.299] (-662.243) (-662.164) * (-665.939) (-653.787) (-647.962) [-656.125] -- 0:02:54
217000 -- (-648.045) (-652.918) [-649.756] (-648.042) * (-657.988) (-660.104) [-655.188] (-660.904) -- 0:02:56
218000 -- (-657.923) [-654.957] (-648.671) (-656.978) * (-651.074) (-652.799) [-647.915] (-653.470) -- 0:02:55
219000 -- (-659.572) (-656.632) (-654.880) [-653.321] * (-663.683) [-648.769] (-653.193) (-667.060) -- 0:02:54
220000 -- (-664.908) [-648.949] (-649.846) (-661.623) * (-654.468) [-647.910] (-656.103) (-656.787) -- 0:02:53
Average standard deviation of split frequencies: 0.016462
221000 -- [-657.465] (-655.301) (-659.860) (-650.228) * (-651.494) (-657.057) [-644.839] (-654.416) -- 0:02:52
222000 -- (-654.527) [-651.776] (-657.486) (-656.586) * (-659.568) (-650.868) [-651.066] (-659.517) -- 0:02:55
223000 -- [-656.181] (-667.240) (-646.518) (-655.777) * (-654.604) [-649.929] (-657.617) (-651.959) -- 0:02:54
224000 -- (-654.775) [-649.848] (-659.582) (-650.803) * (-658.118) (-648.234) [-652.834] (-654.750) -- 0:02:53
225000 -- (-665.775) [-651.540] (-654.845) (-656.119) * [-653.008] (-658.774) (-656.350) (-653.050) -- 0:02:52
Average standard deviation of split frequencies: 0.015992
226000 -- [-654.137] (-658.606) (-651.984) (-655.102) * (-653.594) (-651.875) [-649.017] (-656.636) -- 0:02:54
227000 -- (-648.959) (-655.042) [-649.695] (-658.546) * [-656.142] (-662.490) (-652.933) (-652.816) -- 0:02:53
228000 -- [-648.937] (-659.571) (-658.918) (-659.201) * (-657.937) (-651.931) [-654.669] (-652.097) -- 0:02:52
229000 -- [-647.005] (-657.494) (-656.433) (-661.135) * (-657.963) [-650.416] (-648.397) (-654.088) -- 0:02:51
230000 -- [-649.612] (-657.419) (-652.595) (-665.295) * (-664.327) (-656.098) (-654.696) [-654.555] -- 0:02:50
Average standard deviation of split frequencies: 0.014561
231000 -- [-651.498] (-661.529) (-649.524) (-651.207) * [-651.484] (-649.670) (-651.117) (-653.522) -- 0:02:53
232000 -- [-650.041] (-655.596) (-654.317) (-655.849) * [-649.796] (-653.785) (-648.223) (-650.293) -- 0:02:52
233000 -- (-650.593) (-655.929) (-655.246) [-654.373] * (-654.233) (-652.216) [-656.550] (-650.103) -- 0:02:51
234000 -- (-646.022) (-653.515) [-648.458] (-649.547) * (-652.328) (-652.466) (-656.511) [-648.918] -- 0:02:50
235000 -- [-654.615] (-658.855) (-648.879) (-652.759) * [-650.167] (-662.544) (-658.954) (-655.153) -- 0:02:52
Average standard deviation of split frequencies: 0.014922
236000 -- (-672.489) (-652.240) (-651.424) [-656.096] * [-650.236] (-651.308) (-646.691) (-653.521) -- 0:02:51
237000 -- [-655.041] (-655.509) (-651.908) (-652.328) * (-661.012) (-650.029) [-650.246] (-653.191) -- 0:02:50
238000 -- (-654.219) (-652.884) [-651.463] (-647.846) * (-652.613) (-647.491) [-654.195] (-660.197) -- 0:02:49
239000 -- [-652.801] (-658.614) (-657.422) (-649.001) * (-649.672) (-651.507) [-647.183] (-657.017) -- 0:02:48
240000 -- (-663.448) (-647.482) (-650.933) [-649.853] * (-653.494) [-652.540] (-656.037) (-649.236) -- 0:02:51
Average standard deviation of split frequencies: 0.013481
241000 -- (-655.347) (-654.199) [-651.866] (-650.168) * (-655.560) (-660.065) (-659.213) [-655.742] -- 0:02:50
242000 -- [-652.614] (-651.032) (-651.940) (-652.234) * (-655.547) [-647.709] (-656.615) (-648.342) -- 0:02:49
243000 -- [-649.923] (-659.601) (-650.288) (-658.271) * (-647.375) (-659.967) (-653.032) [-650.423] -- 0:02:48
244000 -- (-653.541) (-668.503) (-650.947) [-649.315] * (-662.098) (-650.338) (-660.936) [-655.698] -- 0:02:50
245000 -- (-662.058) (-661.983) (-650.884) [-655.681] * (-656.811) [-653.736] (-650.723) (-661.132) -- 0:02:49
Average standard deviation of split frequencies: 0.013946
246000 -- (-651.216) (-661.914) [-648.332] (-659.567) * (-659.093) [-656.324] (-653.439) (-665.274) -- 0:02:48
247000 -- (-655.135) (-656.309) [-657.151] (-659.928) * (-652.645) (-665.767) (-654.841) [-648.671] -- 0:02:47
248000 -- (-656.208) [-648.839] (-659.169) (-657.492) * [-645.772] (-659.534) (-650.476) (-657.913) -- 0:02:46
249000 -- [-647.205] (-653.735) (-650.916) (-648.915) * (-659.353) (-651.510) [-652.821] (-655.346) -- 0:02:48
250000 -- (-651.071) (-666.556) (-661.323) [-651.374] * (-651.266) (-652.820) [-650.699] (-654.859) -- 0:02:48
Average standard deviation of split frequencies: 0.013582
251000 -- [-654.780] (-653.847) (-648.308) (-655.171) * (-657.282) [-652.504] (-649.342) (-647.357) -- 0:02:47
252000 -- (-666.841) [-654.770] (-652.180) (-650.100) * [-649.852] (-653.968) (-649.646) (-664.002) -- 0:02:46
253000 -- (-666.975) (-651.049) [-652.809] (-651.352) * [-645.914] (-659.084) (-657.060) (-647.638) -- 0:02:48
254000 -- (-660.944) (-651.819) (-651.827) [-656.196] * (-655.970) (-651.001) [-648.759] (-654.735) -- 0:02:47
255000 -- (-666.488) (-653.483) [-652.207] (-651.394) * [-653.253] (-650.648) (-655.458) (-661.677) -- 0:02:46
Average standard deviation of split frequencies: 0.013215
256000 -- (-653.033) (-648.218) (-665.046) [-650.363] * (-657.605) (-654.022) (-648.976) [-653.643] -- 0:02:45
257000 -- (-657.301) (-652.068) [-650.077] (-653.791) * (-657.308) (-656.498) (-647.848) [-653.438] -- 0:02:44
258000 -- (-658.549) [-648.300] (-652.620) (-651.736) * (-646.019) [-653.497] (-653.958) (-660.900) -- 0:02:46
259000 -- (-651.492) (-649.904) [-653.874] (-656.499) * [-654.410] (-656.048) (-653.296) (-660.217) -- 0:02:45
260000 -- (-657.022) (-650.228) [-649.532] (-657.805) * (-661.547) (-652.334) [-651.694] (-654.474) -- 0:02:45
Average standard deviation of split frequencies: 0.014042
261000 -- (-647.700) (-650.999) [-650.432] (-656.701) * [-648.389] (-662.787) (-651.337) (-654.921) -- 0:02:44
262000 -- (-653.417) (-656.671) (-658.045) [-654.809] * (-658.322) (-668.472) [-651.353] (-660.700) -- 0:02:46
263000 -- (-651.547) (-648.082) (-655.845) [-655.290] * (-648.083) (-664.818) (-651.891) [-651.816] -- 0:02:45
264000 -- [-654.940] (-654.024) (-651.536) (-651.229) * [-651.955] (-663.069) (-652.600) (-647.630) -- 0:02:44
265000 -- [-654.541] (-656.695) (-659.300) (-669.716) * (-659.874) (-661.062) [-648.615] (-659.099) -- 0:02:43
Average standard deviation of split frequencies: 0.012110
266000 -- (-652.007) (-659.089) [-652.222] (-656.811) * (-646.589) [-650.006] (-650.352) (-652.511) -- 0:02:42
267000 -- [-656.127] (-656.089) (-651.888) (-657.979) * (-648.262) (-654.164) (-654.268) [-651.108] -- 0:02:44
268000 -- (-662.584) (-650.756) [-654.682] (-672.359) * (-652.903) (-660.300) [-650.564] (-652.771) -- 0:02:43
269000 -- (-652.405) (-657.338) (-656.186) [-658.740] * (-654.311) (-664.457) [-647.203] (-651.870) -- 0:02:43
270000 -- [-654.855] (-655.341) (-650.513) (-667.445) * (-655.835) (-653.001) (-654.161) [-650.847] -- 0:02:42
Average standard deviation of split frequencies: 0.012499
271000 -- (-653.280) [-660.686] (-652.532) (-672.146) * (-652.296) (-652.629) (-657.464) [-660.271] -- 0:02:44
272000 -- [-648.564] (-651.142) (-651.915) (-662.105) * (-653.370) (-658.642) (-656.329) [-650.657] -- 0:02:43
273000 -- [-659.014] (-650.414) (-652.314) (-654.181) * (-666.608) (-651.234) [-653.587] (-654.800) -- 0:02:42
274000 -- [-651.792] (-650.727) (-649.310) (-655.279) * [-657.297] (-655.619) (-649.429) (-664.084) -- 0:02:41
275000 -- (-657.221) (-648.337) [-648.872] (-650.785) * (-660.106) [-655.989] (-652.576) (-660.377) -- 0:02:40
Average standard deviation of split frequencies: 0.012760
276000 -- (-656.790) [-655.172] (-658.030) (-653.690) * (-654.624) [-651.222] (-648.514) (-657.941) -- 0:02:42
277000 -- (-664.833) (-650.361) [-652.038] (-659.369) * [-654.374] (-672.652) (-658.922) (-664.114) -- 0:02:41
278000 -- (-664.084) (-659.531) (-655.781) [-650.727] * [-660.928] (-659.899) (-653.697) (-660.248) -- 0:02:41
279000 -- [-657.562] (-649.441) (-652.747) (-653.809) * [-656.171] (-645.125) (-660.278) (-661.495) -- 0:02:40
280000 -- (-656.747) [-651.969] (-656.838) (-660.737) * (-653.472) (-661.682) [-650.885] (-660.602) -- 0:02:42
Average standard deviation of split frequencies: 0.012504
281000 -- (-652.329) (-650.826) (-654.343) [-658.573] * (-655.802) (-650.901) [-648.589] (-663.430) -- 0:02:41
282000 -- [-651.632] (-657.996) (-655.826) (-652.371) * (-661.948) (-651.956) [-654.394] (-658.881) -- 0:02:40
283000 -- (-657.768) (-658.447) [-648.289] (-653.664) * [-648.721] (-654.889) (-661.863) (-650.765) -- 0:02:39
284000 -- (-657.006) (-650.554) (-658.142) [-651.662] * (-658.955) (-657.101) [-653.679] (-656.294) -- 0:02:38
285000 -- (-655.521) (-654.182) (-657.651) [-651.828] * (-656.880) (-657.479) [-650.564] (-653.529) -- 0:02:40
Average standard deviation of split frequencies: 0.012545
286000 -- (-659.184) (-650.219) [-653.298] (-652.169) * (-656.763) [-652.930] (-652.797) (-655.605) -- 0:02:39
287000 -- (-651.884) (-662.977) [-656.672] (-657.571) * (-649.185) (-658.843) (-657.369) [-655.610] -- 0:02:38
288000 -- (-654.637) [-656.848] (-653.906) (-664.487) * (-655.818) (-651.832) (-663.791) [-656.153] -- 0:02:38
289000 -- (-661.733) (-650.041) (-648.269) [-653.395] * (-653.151) (-651.573) (-657.878) [-661.862] -- 0:02:39
290000 -- (-665.895) (-665.091) (-653.770) [-654.624] * (-657.101) (-651.609) (-657.028) [-655.258] -- 0:02:39
Average standard deviation of split frequencies: 0.011543
291000 -- (-654.689) (-662.346) (-658.446) [-656.304] * (-661.351) (-649.910) [-661.165] (-655.713) -- 0:02:38
292000 -- (-655.126) (-657.624) (-655.880) [-655.988] * [-659.171] (-656.150) (-661.949) (-652.806) -- 0:02:37
293000 -- [-646.940] (-664.782) (-646.828) (-655.682) * (-657.021) [-648.500] (-656.646) (-650.889) -- 0:02:39
294000 -- [-653.961] (-660.730) (-656.280) (-659.444) * [-651.953] (-654.294) (-654.891) (-648.645) -- 0:02:38
295000 -- [-654.652] (-655.211) (-658.570) (-652.623) * (-654.215) (-650.331) (-651.885) [-651.695] -- 0:02:37
Average standard deviation of split frequencies: 0.012272
296000 -- [-651.933] (-662.354) (-663.047) (-658.738) * (-656.726) (-664.062) [-653.139] (-655.881) -- 0:02:36
297000 -- (-648.181) (-663.543) (-663.783) [-649.710] * (-653.561) [-651.949] (-653.495) (-652.873) -- 0:02:36
298000 -- (-655.776) (-662.859) [-647.105] (-652.146) * (-659.531) (-651.603) (-651.626) [-657.765] -- 0:02:37
299000 -- (-657.163) (-659.723) (-657.576) [-652.228] * (-656.140) (-654.658) (-657.251) [-657.970] -- 0:02:37
300000 -- [-648.288] (-657.784) (-654.210) (-659.041) * (-653.988) (-648.187) [-651.999] (-650.927) -- 0:02:36
Average standard deviation of split frequencies: 0.012451
301000 -- (-653.526) [-658.032] (-666.848) (-653.383) * (-654.699) (-652.872) [-653.346] (-648.416) -- 0:02:35
302000 -- (-653.681) (-661.934) (-653.299) [-655.998] * (-660.003) (-651.228) (-651.645) [-650.524] -- 0:02:34
303000 -- [-664.019] (-660.390) (-654.308) (-658.788) * (-656.554) [-654.374] (-653.252) (-657.468) -- 0:02:36
304000 -- [-645.000] (-657.679) (-662.230) (-653.021) * (-660.703) [-654.580] (-656.969) (-654.411) -- 0:02:35
305000 -- (-660.667) (-661.844) [-648.125] (-651.647) * (-669.118) (-657.670) [-653.899] (-649.184) -- 0:02:34
Average standard deviation of split frequencies: 0.014137
306000 -- (-650.554) (-650.920) (-653.905) [-652.887] * (-655.082) [-654.643] (-647.815) (-658.220) -- 0:02:34
307000 -- [-649.513] (-655.990) (-658.571) (-650.994) * (-651.345) [-654.419] (-659.336) (-652.186) -- 0:02:35
308000 -- (-647.806) [-650.401] (-656.200) (-659.076) * (-649.935) (-654.475) (-646.682) [-651.304] -- 0:02:35
309000 -- [-649.276] (-657.107) (-646.213) (-651.658) * (-648.700) (-650.628) [-652.034] (-655.973) -- 0:02:34
310000 -- (-649.721) [-649.039] (-650.523) (-656.567) * [-651.227] (-657.831) (-652.261) (-655.392) -- 0:02:33
Average standard deviation of split frequencies: 0.013389
311000 -- (-657.351) (-660.284) (-649.605) [-653.968] * (-652.390) (-658.318) (-659.094) [-652.909] -- 0:02:32
312000 -- (-659.082) (-649.185) (-655.994) [-647.125] * (-651.436) (-664.984) (-660.365) [-650.272] -- 0:02:34
313000 -- [-649.099] (-649.723) (-656.825) (-655.260) * (-657.693) (-654.068) (-658.714) [-651.714] -- 0:02:33
314000 -- [-654.878] (-654.605) (-658.761) (-651.006) * (-657.748) [-652.685] (-655.252) (-651.903) -- 0:02:32
315000 -- (-660.467) (-652.293) [-650.651] (-653.193) * (-664.380) [-649.872] (-654.132) (-649.151) -- 0:02:32
Average standard deviation of split frequencies: 0.013338
316000 -- (-650.696) [-651.046] (-660.115) (-645.258) * [-653.380] (-659.582) (-655.593) (-648.385) -- 0:02:33
317000 -- (-650.897) (-647.997) (-651.269) [-655.643] * (-648.791) (-652.850) (-658.852) [-658.452] -- 0:02:32
318000 -- (-655.998) (-648.369) [-651.825] (-649.943) * [-646.760] (-648.912) (-652.070) (-646.766) -- 0:02:32
319000 -- [-651.699] (-655.574) (-658.635) (-654.414) * (-654.285) [-646.667] (-650.803) (-650.475) -- 0:02:31
320000 -- (-654.798) [-648.068] (-651.227) (-645.251) * (-653.881) (-650.406) (-665.895) [-651.353] -- 0:02:30
Average standard deviation of split frequencies: 0.012798
321000 -- (-658.343) (-657.187) [-647.176] (-650.192) * (-655.982) (-660.898) (-652.959) [-648.316] -- 0:02:32
322000 -- (-657.087) [-651.425] (-648.578) (-661.452) * (-659.540) [-657.175] (-651.772) (-648.188) -- 0:02:31
323000 -- [-650.774] (-660.004) (-651.151) (-655.897) * (-655.896) (-653.840) [-651.511] (-649.830) -- 0:02:30
324000 -- [-655.549] (-652.973) (-657.849) (-648.111) * [-655.695] (-655.876) (-657.672) (-657.649) -- 0:02:30
325000 -- (-668.096) (-660.791) (-656.215) [-650.675] * [-646.436] (-656.021) (-656.597) (-655.168) -- 0:02:31
Average standard deviation of split frequencies: 0.012844
326000 -- [-650.696] (-650.052) (-661.396) (-660.256) * [-654.557] (-649.122) (-649.565) (-655.925) -- 0:02:30
327000 -- [-646.392] (-650.079) (-654.033) (-665.956) * (-664.219) [-654.084] (-650.906) (-654.454) -- 0:02:30
328000 -- (-653.088) (-653.964) [-650.670] (-651.539) * (-648.412) (-654.607) (-658.864) [-654.889] -- 0:02:29
329000 -- (-653.485) (-659.918) [-652.670] (-654.071) * (-655.461) [-649.209] (-648.812) (-653.065) -- 0:02:30
330000 -- (-647.884) (-662.333) [-656.627] (-661.491) * (-654.019) (-649.455) (-655.831) [-653.775] -- 0:02:30
Average standard deviation of split frequencies: 0.012920
331000 -- (-658.564) (-652.822) (-652.571) [-649.684] * (-651.886) (-654.642) [-655.942] (-649.373) -- 0:02:29
332000 -- (-655.305) (-663.782) (-647.833) [-645.314] * (-656.220) [-646.926] (-660.186) (-652.511) -- 0:02:28
333000 -- (-655.936) (-655.680) [-654.084] (-649.081) * (-656.080) [-655.194] (-650.536) (-653.050) -- 0:02:28
334000 -- (-650.674) (-653.117) [-649.886] (-657.226) * (-661.831) (-653.758) [-654.624] (-649.728) -- 0:02:29
335000 -- (-654.240) (-655.673) (-652.978) [-654.637] * (-648.061) [-658.168] (-649.778) (-659.210) -- 0:02:28
Average standard deviation of split frequencies: 0.013328
336000 -- (-654.544) (-650.400) (-651.142) [-653.038] * (-657.529) (-646.980) [-651.268] (-653.833) -- 0:02:28
337000 -- (-650.886) [-649.317] (-653.557) (-649.592) * (-660.356) [-656.684] (-649.919) (-663.782) -- 0:02:27
338000 -- (-650.208) (-661.505) [-651.827] (-652.614) * (-654.841) (-655.848) [-654.034] (-659.125) -- 0:02:28
339000 -- [-650.248] (-654.024) (-661.900) (-654.870) * (-655.889) (-663.858) [-655.910] (-659.100) -- 0:02:28
340000 -- (-653.378) [-649.923] (-650.378) (-661.984) * (-650.011) (-653.623) (-649.627) [-649.673] -- 0:02:27
Average standard deviation of split frequencies: 0.013924
341000 -- (-658.307) (-655.847) (-650.731) [-650.791] * (-652.815) (-654.814) [-654.957] (-662.027) -- 0:02:26
342000 -- [-661.462] (-650.306) (-653.620) (-654.913) * (-665.840) (-656.335) (-651.235) [-654.104] -- 0:02:26
343000 -- (-663.964) (-652.945) [-651.492] (-666.988) * (-663.438) [-647.970] (-652.152) (-650.416) -- 0:02:27
344000 -- (-653.410) (-653.744) (-661.113) [-655.653] * (-656.402) (-653.454) [-651.933] (-653.896) -- 0:02:26
345000 -- (-648.774) [-646.738] (-657.786) (-655.172) * (-647.518) (-649.199) [-651.824] (-664.290) -- 0:02:26
Average standard deviation of split frequencies: 0.013965
346000 -- [-650.063] (-658.205) (-657.346) (-658.793) * (-654.959) [-653.820] (-650.507) (-653.561) -- 0:02:25
347000 -- [-649.825] (-655.083) (-650.133) (-651.322) * [-654.132] (-659.776) (-652.767) (-653.882) -- 0:02:26
348000 -- (-653.023) (-651.027) (-650.823) [-653.415] * (-648.010) (-658.021) [-650.443] (-649.156) -- 0:02:26
349000 -- (-651.976) [-647.952] (-652.108) (-667.663) * (-654.466) (-662.462) [-650.688] (-659.477) -- 0:02:25
350000 -- (-656.864) [-649.031] (-676.535) (-652.175) * [-649.737] (-654.641) (-650.243) (-656.682) -- 0:02:24
Average standard deviation of split frequencies: 0.014339
351000 -- (-649.873) (-652.492) (-656.494) [-654.806] * (-652.530) (-659.849) [-648.806] (-653.250) -- 0:02:24
352000 -- (-651.809) (-655.837) (-657.480) [-652.610] * (-662.865) (-648.031) [-651.924] (-654.931) -- 0:02:25
353000 -- [-648.455] (-649.838) (-662.835) (-653.763) * (-665.397) (-651.626) [-653.454] (-651.420) -- 0:02:24
354000 -- [-652.976] (-652.745) (-649.065) (-654.963) * (-651.595) (-663.607) [-649.526] (-655.883) -- 0:02:24
355000 -- (-655.920) (-651.740) (-657.454) [-662.299] * [-651.708] (-652.734) (-653.382) (-659.399) -- 0:02:23
Average standard deviation of split frequencies: 0.014478
356000 -- (-653.218) [-660.282] (-650.892) (-658.202) * [-649.521] (-652.761) (-654.481) (-645.696) -- 0:02:24
357000 -- (-646.597) [-651.125] (-654.084) (-652.282) * (-648.033) [-648.602] (-653.201) (-658.344) -- 0:02:24
358000 -- (-657.838) [-658.693] (-651.720) (-652.620) * (-646.439) (-654.022) (-651.243) [-649.955] -- 0:02:23
359000 -- (-654.871) [-654.502] (-659.880) (-655.866) * (-659.523) (-659.672) [-648.043] (-661.212) -- 0:02:22
360000 -- (-650.872) (-655.977) [-648.473] (-654.886) * [-652.878] (-656.383) (-652.202) (-648.957) -- 0:02:24
Average standard deviation of split frequencies: 0.014203
361000 -- (-653.444) [-656.188] (-659.834) (-646.252) * (-654.949) (-655.905) (-661.013) [-655.888] -- 0:02:23
362000 -- (-650.000) (-651.840) (-656.471) [-649.337] * (-662.492) (-651.160) (-654.371) [-651.021] -- 0:02:22
363000 -- (-650.880) (-649.966) [-651.392] (-652.876) * [-649.282] (-652.886) (-660.224) (-657.507) -- 0:02:22
364000 -- (-647.803) [-651.136] (-646.237) (-658.361) * (-655.659) [-649.346] (-647.526) (-648.202) -- 0:02:21
365000 -- (-651.856) [-650.808] (-655.349) (-649.035) * [-661.208] (-650.535) (-651.470) (-653.577) -- 0:02:22
Average standard deviation of split frequencies: 0.013481
366000 -- (-656.597) [-652.584] (-652.539) (-663.959) * (-656.227) [-653.134] (-649.057) (-652.846) -- 0:02:22
367000 -- (-664.678) [-652.703] (-649.060) (-658.017) * (-653.531) [-648.184] (-654.672) (-658.398) -- 0:02:21
368000 -- (-655.789) (-654.329) (-654.249) [-649.508] * [-652.787] (-650.266) (-651.245) (-651.480) -- 0:02:20
369000 -- (-654.841) (-655.229) (-656.612) [-645.037] * [-651.555] (-656.422) (-653.913) (-655.463) -- 0:02:21
370000 -- (-656.691) [-647.607] (-649.943) (-648.745) * (-655.977) (-654.077) [-656.217] (-655.613) -- 0:02:21
Average standard deviation of split frequencies: 0.013820
371000 -- (-656.788) [-649.882] (-645.545) (-654.387) * [-654.651] (-657.277) (-657.445) (-649.622) -- 0:02:20
372000 -- (-667.694) [-654.376] (-668.075) (-661.670) * (-657.006) (-665.263) [-652.952] (-647.190) -- 0:02:20
373000 -- (-661.020) (-657.981) (-657.993) [-649.421] * [-660.059] (-654.503) (-653.207) (-656.436) -- 0:02:19
374000 -- [-649.154] (-653.000) (-647.647) (-657.450) * (-660.045) (-655.459) (-657.719) [-651.771] -- 0:02:20
375000 -- (-653.945) [-655.601] (-660.780) (-647.437) * (-662.661) [-656.372] (-659.731) (-654.544) -- 0:02:20
Average standard deviation of split frequencies: 0.014460
376000 -- (-655.658) (-653.981) (-649.242) [-646.160] * [-657.490] (-658.517) (-647.901) (-649.737) -- 0:02:19
377000 -- [-646.150] (-656.319) (-653.871) (-650.113) * (-649.241) [-652.092] (-649.702) (-661.431) -- 0:02:18
378000 -- (-655.406) (-651.107) (-654.982) [-651.636] * (-656.406) [-651.895] (-658.920) (-657.083) -- 0:02:19
379000 -- (-655.116) (-652.781) [-654.188] (-651.302) * (-655.731) (-660.645) [-652.781] (-653.219) -- 0:02:19
380000 -- [-655.904] (-653.776) (-654.315) (-648.003) * [-659.475] (-648.810) (-653.432) (-649.686) -- 0:02:18
Average standard deviation of split frequencies: 0.014365
381000 -- (-650.648) (-666.870) (-655.984) [-652.327] * (-656.594) [-650.300] (-655.171) (-653.598) -- 0:02:18
382000 -- (-656.281) (-658.642) [-653.097] (-650.634) * (-661.715) [-658.053] (-650.122) (-651.591) -- 0:02:17
383000 -- (-659.123) (-666.348) (-653.719) [-650.386] * (-658.449) [-650.803] (-655.066) (-654.988) -- 0:02:18
384000 -- (-654.726) (-662.672) (-648.701) [-648.440] * (-660.303) (-653.948) (-650.703) [-648.733] -- 0:02:17
385000 -- [-657.754] (-661.097) (-650.718) (-659.917) * (-663.228) (-647.400) (-650.228) [-650.800] -- 0:02:17
Average standard deviation of split frequencies: 0.013597
386000 -- [-656.078] (-670.116) (-648.071) (-659.983) * (-662.679) [-646.379] (-653.626) (-660.916) -- 0:02:16
387000 -- [-654.947] (-660.195) (-654.890) (-651.533) * (-656.874) (-655.869) (-656.613) [-651.625] -- 0:02:17
388000 -- [-655.352] (-668.245) (-653.845) (-652.292) * (-659.945) [-658.739] (-654.068) (-654.355) -- 0:02:17
389000 -- [-653.349] (-660.326) (-648.688) (-648.896) * (-657.385) [-653.370] (-661.373) (-653.732) -- 0:02:16
390000 -- [-649.634] (-653.301) (-659.270) (-655.173) * (-654.073) (-656.900) [-653.976] (-660.218) -- 0:02:16
Average standard deviation of split frequencies: 0.013112
391000 -- (-657.788) (-652.789) (-653.407) [-652.023] * (-653.779) (-664.655) (-658.922) [-648.553] -- 0:02:15
392000 -- (-652.651) (-655.524) [-652.805] (-653.845) * (-671.260) (-653.289) [-644.941] (-656.599) -- 0:02:16
393000 -- [-654.799] (-650.755) (-650.115) (-672.564) * (-651.413) (-653.209) (-652.098) [-648.943] -- 0:02:15
394000 -- (-657.646) (-651.551) [-648.314] (-655.937) * (-650.338) (-657.528) [-647.748] (-658.299) -- 0:02:15
395000 -- [-659.023] (-654.663) (-650.148) (-665.716) * (-648.435) [-644.572] (-653.553) (-653.956) -- 0:02:14
Average standard deviation of split frequencies: 0.013095
396000 -- [-649.952] (-661.944) (-653.987) (-661.585) * (-661.315) [-652.713] (-661.081) (-654.539) -- 0:02:15
397000 -- [-648.211] (-655.609) (-659.351) (-652.928) * (-655.244) (-656.474) [-653.954] (-651.291) -- 0:02:15
398000 -- [-650.213] (-653.447) (-652.061) (-654.006) * (-651.536) (-658.759) [-644.585] (-649.357) -- 0:02:14
399000 -- (-648.179) [-646.658] (-658.218) (-653.993) * (-649.806) [-655.020] (-646.775) (-656.484) -- 0:02:14
400000 -- (-650.861) (-649.202) [-655.979] (-652.950) * (-667.870) (-657.007) (-650.548) [-649.868] -- 0:02:13
Average standard deviation of split frequencies: 0.014040
401000 -- (-654.715) (-647.967) [-651.596] (-650.402) * (-657.926) [-648.796] (-661.098) (-653.441) -- 0:02:14
402000 -- [-649.406] (-650.312) (-652.432) (-653.142) * [-654.561] (-658.235) (-656.240) (-648.473) -- 0:02:13
403000 -- (-654.847) (-646.963) [-646.487] (-648.339) * (-651.914) (-653.897) [-650.945] (-648.540) -- 0:02:13
404000 -- (-650.950) (-653.148) (-651.587) [-650.427] * (-663.732) (-656.992) [-649.203] (-654.001) -- 0:02:12
405000 -- (-656.694) (-647.795) (-656.844) [-655.059] * [-660.400] (-664.527) (-653.859) (-658.820) -- 0:02:13
Average standard deviation of split frequencies: 0.014398
406000 -- (-657.368) (-652.552) (-647.360) [-654.231] * [-650.356] (-656.022) (-654.641) (-652.945) -- 0:02:13
407000 -- (-658.887) (-653.452) [-646.999] (-655.152) * (-645.980) (-652.235) (-651.997) [-652.719] -- 0:02:12
408000 -- (-658.188) (-650.538) (-649.249) [-654.029] * (-654.795) [-649.589] (-656.455) (-650.783) -- 0:02:12
409000 -- [-647.798] (-649.625) (-652.668) (-650.580) * (-666.993) (-653.107) (-648.952) [-650.385] -- 0:02:12
410000 -- [-652.194] (-659.282) (-654.448) (-656.756) * (-650.639) (-654.388) [-649.710] (-653.365) -- 0:02:12
Average standard deviation of split frequencies: 0.013469
411000 -- (-645.785) (-664.486) (-656.386) [-656.072] * (-673.625) (-653.520) (-662.992) [-647.840] -- 0:02:11
412000 -- [-646.320] (-650.764) (-656.164) (-652.180) * [-645.823] (-657.145) (-652.358) (-646.119) -- 0:02:11
413000 -- [-650.472] (-649.284) (-655.706) (-656.823) * (-644.734) (-657.278) (-655.559) [-653.466] -- 0:02:10
414000 -- (-648.662) (-652.955) [-652.508] (-653.587) * (-658.999) [-650.517] (-657.988) (-653.708) -- 0:02:11
415000 -- [-649.549] (-658.443) (-651.099) (-658.987) * (-654.770) (-650.727) [-651.736] (-657.039) -- 0:02:11
Average standard deviation of split frequencies: 0.013436
416000 -- (-651.081) (-659.552) (-656.584) [-659.560] * (-664.082) [-650.992] (-661.718) (-652.347) -- 0:02:10
417000 -- [-651.106] (-662.872) (-654.373) (-659.816) * [-652.529] (-657.904) (-655.099) (-655.997) -- 0:02:10
418000 -- (-649.433) [-653.031] (-654.728) (-654.775) * (-654.269) (-656.710) (-649.404) [-652.036] -- 0:02:10
419000 -- (-658.290) (-662.961) (-652.515) [-656.655] * (-650.515) (-655.931) [-659.906] (-665.345) -- 0:02:10
420000 -- (-656.009) (-655.205) [-648.872] (-654.279) * (-657.412) (-651.412) [-651.392] (-653.460) -- 0:02:09
Average standard deviation of split frequencies: 0.013928
421000 -- (-658.189) (-647.860) [-654.404] (-650.351) * (-649.551) [-649.760] (-650.112) (-655.282) -- 0:02:09
422000 -- (-655.573) (-654.056) [-660.571] (-655.835) * (-654.802) (-651.197) [-647.994] (-649.708) -- 0:02:10
423000 -- (-653.958) [-651.786] (-651.809) (-652.331) * (-657.033) (-646.757) [-651.329] (-657.463) -- 0:02:09
424000 -- (-649.572) [-651.938] (-653.860) (-659.423) * (-657.066) (-664.438) (-650.918) [-652.075] -- 0:02:09
425000 -- [-647.682] (-664.572) (-652.658) (-655.106) * (-654.707) [-652.863] (-652.414) (-657.091) -- 0:02:08
Average standard deviation of split frequencies: 0.013516
426000 -- (-652.163) (-659.341) [-661.038] (-654.998) * (-658.628) (-649.661) [-647.030] (-654.001) -- 0:02:09
427000 -- [-650.028] (-665.566) (-656.294) (-656.611) * (-651.348) [-649.051] (-659.839) (-654.611) -- 0:02:08
428000 -- (-655.414) (-654.639) [-652.423] (-646.332) * (-654.467) (-649.850) (-653.081) [-650.873] -- 0:02:08
429000 -- (-650.999) (-659.159) [-647.591] (-652.348) * (-662.006) (-657.859) [-649.895] (-658.987) -- 0:02:07
430000 -- (-658.430) [-657.429] (-656.187) (-651.598) * (-653.457) (-655.105) (-651.318) [-651.479] -- 0:02:08
Average standard deviation of split frequencies: 0.013135
431000 -- (-657.453) (-659.071) (-654.123) [-653.194] * (-662.576) (-663.301) (-654.914) [-651.187] -- 0:02:08
432000 -- [-646.447] (-651.322) (-652.720) (-659.852) * (-651.295) (-653.592) [-647.484] (-659.776) -- 0:02:07
433000 -- [-654.205] (-658.613) (-654.784) (-656.630) * (-654.542) [-652.380] (-648.686) (-661.754) -- 0:02:07
434000 -- [-654.407] (-653.363) (-656.726) (-647.246) * [-648.793] (-652.218) (-658.072) (-658.325) -- 0:02:06
435000 -- (-657.962) (-650.428) (-657.687) [-649.745] * (-664.877) [-652.849] (-654.900) (-647.032) -- 0:02:07
Average standard deviation of split frequencies: 0.012470
436000 -- (-656.570) (-660.347) [-654.467] (-650.026) * (-658.703) (-657.736) [-655.034] (-653.391) -- 0:02:06
437000 -- [-650.695] (-657.342) (-650.083) (-654.234) * (-651.924) [-654.949] (-649.880) (-656.104) -- 0:02:06
438000 -- (-659.735) (-652.608) [-648.925] (-660.468) * (-663.938) (-654.335) (-659.403) [-649.704] -- 0:02:05
439000 -- (-657.399) (-659.332) (-656.707) [-651.617] * (-657.443) [-652.731] (-652.788) (-653.043) -- 0:02:06
440000 -- (-649.898) [-649.087] (-648.864) (-656.777) * (-655.516) [-650.502] (-647.154) (-656.341) -- 0:02:06
Average standard deviation of split frequencies: 0.012302
441000 -- (-652.356) (-657.140) [-652.640] (-656.287) * (-653.624) (-654.327) (-651.152) [-653.916] -- 0:02:05
442000 -- (-653.217) (-656.966) [-652.543] (-659.226) * (-647.990) [-647.119] (-654.370) (-652.572) -- 0:02:04
443000 -- (-658.100) (-649.985) [-655.436] (-659.794) * [-652.445] (-652.864) (-650.499) (-651.786) -- 0:02:04
444000 -- (-654.163) (-658.243) [-650.057] (-655.366) * (-648.523) (-653.267) [-650.323] (-658.398) -- 0:02:05
445000 -- (-656.556) (-658.564) [-650.515] (-655.055) * (-652.410) (-646.112) [-649.720] (-646.062) -- 0:02:04
Average standard deviation of split frequencies: 0.011551
446000 -- [-654.255] (-653.505) (-653.854) (-656.468) * (-656.189) (-648.345) (-652.866) [-648.939] -- 0:02:04
447000 -- (-663.848) [-650.299] (-654.539) (-655.999) * [-650.472] (-651.057) (-655.404) (-646.306) -- 0:02:03
448000 -- [-656.943] (-654.837) (-653.008) (-649.378) * [-655.360] (-656.446) (-668.756) (-652.178) -- 0:02:04
449000 -- [-657.201] (-650.466) (-649.634) (-654.052) * (-653.648) (-654.933) [-654.415] (-655.450) -- 0:02:03
450000 -- [-651.048] (-653.120) (-664.518) (-655.051) * (-653.421) (-650.035) [-657.283] (-653.235) -- 0:02:03
Average standard deviation of split frequencies: 0.010983
451000 -- (-648.999) [-648.954] (-661.128) (-649.708) * (-654.255) (-650.190) [-653.975] (-660.992) -- 0:02:02
452000 -- (-658.452) (-651.393) (-658.798) [-649.859] * (-661.052) (-652.118) (-662.039) [-665.505] -- 0:02:02
453000 -- (-650.856) [-650.403] (-651.633) (-648.458) * (-657.326) [-650.563] (-656.061) (-654.140) -- 0:02:03
454000 -- (-649.567) (-655.766) (-655.975) [-657.161] * (-650.966) [-652.319] (-664.569) (-662.694) -- 0:02:02
455000 -- (-654.146) [-654.548] (-653.898) (-653.684) * (-648.633) [-650.313] (-659.969) (-647.870) -- 0:02:02
Average standard deviation of split frequencies: 0.010781
456000 -- [-650.739] (-659.303) (-649.845) (-654.720) * (-646.994) [-647.063] (-649.839) (-653.645) -- 0:02:01
457000 -- (-653.002) (-659.414) (-657.260) [-653.203] * (-657.356) [-654.503] (-657.653) (-659.077) -- 0:02:02
458000 -- (-673.461) (-661.065) [-659.361] (-650.681) * (-657.197) (-661.353) [-655.498] (-656.519) -- 0:02:01
459000 -- (-653.808) [-660.309] (-651.174) (-657.594) * (-653.408) (-660.037) (-656.070) [-653.970] -- 0:02:01
460000 -- [-654.091] (-654.118) (-656.274) (-657.252) * (-661.887) (-663.567) (-660.563) [-654.553] -- 0:02:00
Average standard deviation of split frequencies: 0.010705
461000 -- (-651.200) (-659.900) (-650.469) [-652.226] * (-653.155) (-659.775) (-665.125) [-647.476] -- 0:02:00
462000 -- (-653.348) [-652.170] (-651.568) (-648.656) * (-648.905) (-653.377) [-652.804] (-662.857) -- 0:02:01
463000 -- (-654.694) (-652.665) (-650.629) [-651.027] * (-646.593) (-667.412) [-647.434] (-650.389) -- 0:02:00
464000 -- (-656.054) (-658.320) [-652.245] (-658.020) * (-656.400) (-660.533) [-652.464] (-651.643) -- 0:02:00
465000 -- (-646.755) (-659.533) [-648.094] (-658.248) * (-651.768) (-653.381) [-647.992] (-653.912) -- 0:01:59
Average standard deviation of split frequencies: 0.011050
466000 -- (-654.067) (-657.961) (-671.282) [-654.644] * (-656.208) [-649.904] (-652.991) (-657.262) -- 0:02:00
467000 -- (-651.237) [-651.462] (-649.608) (-651.822) * (-651.199) (-657.286) [-651.833] (-648.769) -- 0:01:59
468000 -- (-651.798) (-658.103) (-655.900) [-645.608] * (-652.625) (-658.179) [-651.328] (-672.152) -- 0:01:59
469000 -- (-654.294) [-661.222] (-655.055) (-654.162) * (-652.480) [-651.735] (-656.174) (-657.505) -- 0:01:58
470000 -- [-650.387] (-656.355) (-661.737) (-647.260) * (-653.254) [-650.669] (-661.012) (-660.409) -- 0:01:59
Average standard deviation of split frequencies: 0.011089
471000 -- [-650.322] (-653.430) (-656.772) (-656.335) * (-651.653) (-652.501) (-652.663) [-651.379] -- 0:01:59
472000 -- (-655.717) (-662.547) (-656.122) [-652.046] * (-659.978) [-647.176] (-660.126) (-651.581) -- 0:01:58
473000 -- (-653.388) (-656.342) (-654.243) [-652.122] * [-651.394] (-660.160) (-656.115) (-650.381) -- 0:01:58
474000 -- (-654.221) (-649.163) (-658.483) [-648.562] * (-646.141) (-668.545) [-648.698] (-651.839) -- 0:01:58
475000 -- (-654.433) [-647.872] (-651.961) (-659.285) * (-648.495) (-658.087) [-647.807] (-649.758) -- 0:01:58
Average standard deviation of split frequencies: 0.011672
476000 -- (-653.816) (-652.287) (-646.679) [-651.632] * [-649.341] (-670.851) (-660.809) (-649.387) -- 0:01:57
477000 -- (-653.232) [-649.483] (-651.538) (-650.444) * (-654.136) (-654.942) (-654.515) [-650.290] -- 0:01:57
478000 -- (-652.538) (-650.889) (-651.365) [-647.682] * (-649.115) (-663.144) (-650.956) [-651.596] -- 0:01:56
479000 -- (-656.366) (-653.903) (-660.910) [-652.404] * (-660.330) (-646.969) [-649.964] (-648.349) -- 0:01:57
480000 -- (-661.643) (-654.460) [-650.528] (-647.956) * (-661.480) (-660.127) [-654.454] (-650.635) -- 0:01:57
Average standard deviation of split frequencies: 0.011208
481000 -- (-656.802) (-651.289) [-654.098] (-649.414) * (-653.203) (-650.722) [-652.607] (-657.482) -- 0:01:56
482000 -- (-654.098) [-651.750] (-652.065) (-648.424) * [-655.961] (-652.078) (-652.620) (-660.371) -- 0:01:56
483000 -- (-653.232) [-649.295] (-656.734) (-647.777) * (-650.033) (-648.595) [-650.235] (-670.315) -- 0:01:56
484000 -- (-661.645) [-653.340] (-650.877) (-651.029) * (-648.832) (-652.987) [-647.487] (-649.173) -- 0:01:56
485000 -- (-658.580) (-654.318) [-650.217] (-661.914) * (-666.307) (-652.746) [-656.089] (-658.146) -- 0:01:55
Average standard deviation of split frequencies: 0.010947
486000 -- (-651.177) [-654.406] (-660.820) (-664.943) * (-649.734) (-648.545) (-651.333) [-650.306] -- 0:01:55
487000 -- [-647.775] (-650.595) (-668.926) (-655.109) * [-653.166] (-663.456) (-651.441) (-652.035) -- 0:01:54
488000 -- [-649.882] (-657.554) (-653.121) (-654.443) * [-652.805] (-658.329) (-654.759) (-655.293) -- 0:01:55
489000 -- [-650.140] (-652.403) (-653.965) (-658.964) * [-651.916] (-652.647) (-652.500) (-654.474) -- 0:01:54
490000 -- (-651.298) [-653.480] (-653.878) (-659.172) * (-667.639) [-652.922] (-651.163) (-658.801) -- 0:01:54
Average standard deviation of split frequencies: 0.011323
491000 -- (-654.753) [-659.070] (-653.638) (-646.987) * (-657.736) (-656.196) [-659.524] (-659.093) -- 0:01:54
492000 -- (-657.155) (-664.607) (-661.270) [-650.480] * [-654.406] (-653.592) (-663.470) (-649.735) -- 0:01:54
493000 -- [-660.073] (-649.745) (-658.000) (-655.383) * [-653.416] (-653.659) (-665.843) (-651.156) -- 0:01:54
494000 -- [-649.526] (-659.901) (-643.903) (-654.956) * (-658.635) [-649.288] (-657.848) (-656.232) -- 0:01:53
495000 -- (-656.729) (-669.638) [-652.660] (-648.535) * (-655.657) (-658.548) (-656.788) [-647.007] -- 0:01:53
Average standard deviation of split frequencies: 0.011405
496000 -- [-650.733] (-657.493) (-652.024) (-653.457) * (-656.706) (-662.373) [-656.206] (-658.635) -- 0:01:53
497000 -- (-656.083) [-650.730] (-661.098) (-651.116) * (-659.509) [-655.789] (-653.662) (-653.173) -- 0:01:53
498000 -- (-657.501) (-661.424) [-655.423] (-648.788) * (-651.973) (-655.052) [-649.071] (-653.650) -- 0:01:52
499000 -- (-660.226) (-657.343) (-650.364) [-663.096] * (-651.194) [-650.612] (-648.613) (-653.054) -- 0:01:52
500000 -- (-649.586) (-649.599) [-655.547] (-651.112) * [-657.761] (-652.393) (-652.209) (-658.891) -- 0:01:52
Average standard deviation of split frequencies: 0.012106
501000 -- (-654.620) (-650.665) (-659.723) [-652.280] * (-645.531) (-651.937) [-654.047] (-662.725) -- 0:01:52
502000 -- (-645.334) (-647.150) [-654.793] (-658.783) * [-654.743] (-651.164) (-655.930) (-646.791) -- 0:01:52
503000 -- [-653.650] (-654.753) (-654.786) (-659.023) * (-650.179) [-647.183] (-653.123) (-654.941) -- 0:01:51
504000 -- (-650.234) (-659.807) [-647.850] (-653.820) * (-650.665) [-649.243] (-659.230) (-660.469) -- 0:01:51
505000 -- (-656.617) (-652.168) (-649.863) [-652.719] * (-652.608) (-648.811) [-652.654] (-652.546) -- 0:01:51
Average standard deviation of split frequencies: 0.011366
506000 -- (-658.629) (-657.761) (-648.770) [-659.368] * (-652.146) (-655.871) (-650.806) [-653.872] -- 0:01:51
507000 -- (-651.515) (-649.868) [-651.354] (-647.579) * (-658.293) (-651.047) [-650.089] (-652.383) -- 0:01:50
508000 -- (-661.748) (-654.066) [-653.761] (-655.026) * (-660.856) [-651.040] (-658.483) (-655.602) -- 0:01:50
509000 -- [-653.440] (-653.746) (-660.601) (-651.998) * (-652.124) (-652.972) (-650.444) [-648.799] -- 0:01:50
510000 -- (-655.752) [-650.804] (-654.160) (-653.398) * (-657.805) (-652.962) (-660.544) [-651.766] -- 0:01:50
Average standard deviation of split frequencies: 0.011570
511000 -- (-652.311) (-657.279) [-648.233] (-658.993) * (-652.660) (-654.987) (-659.420) [-646.757] -- 0:01:50
512000 -- [-649.415] (-654.374) (-651.857) (-653.556) * (-658.575) [-651.065] (-656.028) (-651.435) -- 0:01:49
513000 -- (-651.916) [-650.358] (-655.895) (-656.460) * (-666.806) (-659.616) [-652.205] (-652.933) -- 0:01:49
514000 -- (-650.129) (-653.708) [-654.784] (-653.772) * (-660.330) (-649.231) [-653.432] (-651.828) -- 0:01:49
515000 -- (-658.262) (-648.965) [-654.960] (-654.847) * (-655.125) (-660.062) [-653.011] (-651.759) -- 0:01:49
Average standard deviation of split frequencies: 0.011694
516000 -- (-651.137) (-653.620) (-653.733) [-652.622] * (-656.555) [-658.544] (-656.578) (-651.117) -- 0:01:48
517000 -- [-653.272] (-657.001) (-655.246) (-653.673) * (-659.218) (-653.567) (-658.733) [-649.876] -- 0:01:48
518000 -- [-652.924] (-653.389) (-652.498) (-653.955) * (-648.310) (-658.372) (-660.375) [-658.466] -- 0:01:48
519000 -- (-654.142) [-651.579] (-658.586) (-655.582) * (-649.342) (-660.118) (-649.691) [-653.113] -- 0:01:48
520000 -- (-653.017) (-653.258) (-663.851) [-646.423] * (-653.244) [-654.029] (-656.624) (-657.151) -- 0:01:48
Average standard deviation of split frequencies: 0.011046
521000 -- [-648.465] (-656.798) (-659.400) (-652.235) * [-654.273] (-659.564) (-660.778) (-654.235) -- 0:01:47
522000 -- (-660.845) (-654.335) (-654.569) [-654.195] * (-651.434) (-663.760) (-661.909) [-656.938] -- 0:01:47
523000 -- (-646.470) (-663.056) [-649.146] (-656.495) * (-655.005) (-667.222) (-660.101) [-648.576] -- 0:01:47
524000 -- (-648.063) (-652.772) (-665.825) [-656.197] * (-651.441) (-662.919) (-653.399) [-652.363] -- 0:01:47
525000 -- (-654.752) (-657.953) [-654.452] (-644.103) * (-658.706) (-647.610) [-653.277] (-651.946) -- 0:01:46
Average standard deviation of split frequencies: 0.011173
526000 -- [-649.248] (-650.074) (-657.318) (-659.272) * (-650.327) (-655.775) (-653.464) [-650.771] -- 0:01:46
527000 -- (-653.950) (-648.387) (-661.428) [-644.625] * (-645.548) (-656.084) (-655.981) [-649.208] -- 0:01:46
528000 -- (-649.431) (-657.956) [-650.040] (-652.474) * (-658.228) (-654.034) (-652.096) [-653.092] -- 0:01:46
529000 -- (-654.102) [-650.493] (-657.452) (-652.024) * (-660.013) (-649.853) (-647.927) [-647.857] -- 0:01:45
530000 -- (-658.112) [-650.273] (-655.353) (-667.246) * (-656.344) (-650.018) [-647.368] (-653.424) -- 0:01:45
Average standard deviation of split frequencies: 0.009653
531000 -- (-653.982) (-647.876) (-656.816) [-659.640] * (-663.925) (-653.246) [-652.236] (-652.488) -- 0:01:45
532000 -- (-657.291) [-659.622] (-663.774) (-657.220) * (-651.566) (-660.547) (-653.540) [-649.618] -- 0:01:45
533000 -- (-651.472) (-654.068) [-650.749] (-649.652) * (-663.896) (-651.013) (-655.728) [-651.488] -- 0:01:45
534000 -- [-651.564] (-655.200) (-659.858) (-651.080) * (-651.939) (-650.525) [-649.645] (-662.106) -- 0:01:44
535000 -- (-649.627) (-652.457) (-656.577) [-653.465] * [-649.293] (-649.660) (-656.085) (-657.103) -- 0:01:44
Average standard deviation of split frequencies: 0.009235
536000 -- (-650.472) (-658.992) (-656.321) [-657.422] * (-661.797) (-650.655) (-655.106) [-649.438] -- 0:01:44
537000 -- [-648.972] (-651.042) (-650.075) (-653.613) * (-659.417) [-653.530] (-655.985) (-656.967) -- 0:01:44
538000 -- (-649.889) (-664.819) [-659.066] (-655.085) * (-652.428) (-654.971) [-656.824] (-654.768) -- 0:01:43
539000 -- (-653.202) (-649.619) [-651.861] (-661.110) * (-651.962) [-650.903] (-650.461) (-660.674) -- 0:01:43
540000 -- [-653.240] (-651.308) (-662.760) (-655.801) * (-659.988) [-648.725] (-654.212) (-649.852) -- 0:01:43
Average standard deviation of split frequencies: 0.009217
541000 -- (-651.822) (-656.027) [-651.532] (-656.593) * (-648.838) (-647.921) (-656.521) [-653.675] -- 0:01:43
542000 -- (-657.731) (-652.794) (-649.649) [-647.857] * (-656.895) (-661.730) (-652.053) [-653.931] -- 0:01:43
543000 -- (-654.502) (-648.735) (-651.673) [-648.213] * (-656.035) (-652.562) (-654.151) [-647.111] -- 0:01:42
544000 -- (-659.469) (-650.572) (-652.445) [-651.725] * (-651.608) (-660.832) [-647.260] (-671.402) -- 0:01:42
545000 -- (-657.547) (-657.795) [-651.349] (-656.179) * (-652.183) (-659.556) (-660.583) [-645.216] -- 0:01:42
Average standard deviation of split frequencies: 0.009682
546000 -- (-650.323) [-648.339] (-652.646) (-653.772) * (-651.379) [-652.866] (-652.788) (-652.965) -- 0:01:42
547000 -- (-655.965) (-652.042) [-654.442] (-656.352) * (-653.716) (-646.494) [-653.773] (-661.259) -- 0:01:41
548000 -- (-652.075) [-652.652] (-653.563) (-649.195) * [-650.506] (-655.938) (-663.440) (-649.863) -- 0:01:41
549000 -- [-650.059] (-658.545) (-656.447) (-661.793) * [-651.910] (-659.176) (-654.332) (-652.948) -- 0:01:41
550000 -- (-653.982) (-652.115) [-651.057] (-645.507) * (-654.515) (-660.209) [-647.372] (-657.020) -- 0:01:41
Average standard deviation of split frequencies: 0.010456
551000 -- [-646.626] (-656.436) (-658.202) (-644.250) * (-656.273) [-650.178] (-651.675) (-657.587) -- 0:01:41
552000 -- (-654.507) (-656.082) (-650.476) [-654.643] * (-653.477) [-651.931] (-658.189) (-656.953) -- 0:01:40
553000 -- (-651.207) (-652.157) [-653.344] (-657.405) * (-659.628) (-652.253) [-652.388] (-654.211) -- 0:01:40
554000 -- (-653.093) (-653.081) [-649.432] (-658.200) * (-655.139) [-649.383] (-657.814) (-652.738) -- 0:01:40
555000 -- (-657.792) (-649.021) (-655.001) [-657.306] * (-648.900) [-655.307] (-658.386) (-652.523) -- 0:01:40
Average standard deviation of split frequencies: 0.009447
556000 -- (-651.279) (-649.455) (-647.975) [-646.294] * (-647.522) [-648.395] (-648.601) (-661.889) -- 0:01:39
557000 -- (-660.681) (-651.489) [-652.094] (-658.495) * (-661.869) (-654.705) [-647.947] (-651.753) -- 0:01:39
558000 -- (-648.966) (-648.859) [-648.263] (-649.122) * [-648.376] (-659.046) (-652.051) (-662.158) -- 0:01:39
559000 -- [-650.898] (-662.029) (-653.271) (-647.050) * (-651.398) (-655.740) [-653.512] (-665.326) -- 0:01:39
560000 -- (-650.615) (-648.910) [-652.147] (-649.520) * (-649.315) (-652.015) [-652.235] (-650.257) -- 0:01:39
Average standard deviation of split frequencies: 0.009489
561000 -- (-647.107) (-657.210) (-655.490) [-651.829] * (-654.845) (-659.738) (-660.850) [-652.820] -- 0:01:38
562000 -- (-654.780) (-660.219) [-653.778] (-650.959) * (-656.043) [-651.463] (-654.298) (-652.665) -- 0:01:38
563000 -- (-660.633) (-657.623) [-651.537] (-652.395) * [-646.032] (-649.319) (-655.913) (-657.466) -- 0:01:38
564000 -- [-658.380] (-656.765) (-663.171) (-659.688) * (-655.600) (-651.286) (-651.720) [-658.116] -- 0:01:38
565000 -- (-661.147) (-653.187) (-651.710) [-656.002] * (-653.252) (-659.988) (-657.161) [-651.906] -- 0:01:37
Average standard deviation of split frequencies: 0.009340
566000 -- (-655.062) (-653.606) (-658.807) [-655.021] * (-656.817) (-647.703) [-646.713] (-649.796) -- 0:01:37
567000 -- (-648.641) (-650.097) [-654.783] (-655.054) * (-652.927) (-647.942) (-650.456) [-653.877] -- 0:01:37
568000 -- (-664.164) [-649.186] (-661.153) (-652.869) * [-650.335] (-653.459) (-653.668) (-659.508) -- 0:01:37
569000 -- (-655.740) (-649.947) [-656.619] (-647.701) * [-646.661] (-654.688) (-656.250) (-655.073) -- 0:01:36
570000 -- [-650.477] (-658.103) (-655.058) (-653.010) * [-659.492] (-655.712) (-651.519) (-655.254) -- 0:01:36
Average standard deviation of split frequencies: 0.009441
571000 -- (-664.566) (-660.666) (-653.278) [-652.635] * [-650.307] (-664.801) (-652.424) (-659.661) -- 0:01:36
572000 -- (-663.256) (-665.807) [-653.143] (-648.629) * (-654.660) (-654.063) [-645.895] (-649.156) -- 0:01:36
573000 -- (-649.435) [-654.415] (-659.439) (-650.777) * [-648.850] (-648.071) (-649.811) (-661.897) -- 0:01:36
574000 -- (-663.676) [-653.612] (-651.019) (-649.388) * (-650.607) [-653.684] (-653.717) (-653.296) -- 0:01:35
575000 -- (-653.215) [-652.937] (-656.530) (-646.746) * (-647.193) (-653.040) (-655.153) [-649.636] -- 0:01:35
Average standard deviation of split frequencies: 0.009178
576000 -- (-658.966) (-658.195) [-657.373] (-662.882) * (-659.857) (-655.604) [-649.114] (-656.124) -- 0:01:35
577000 -- (-652.518) (-655.403) (-652.448) [-647.520] * (-648.834) (-663.876) [-653.056] (-660.241) -- 0:01:35
578000 -- (-662.337) (-659.191) (-654.485) [-653.286] * (-654.432) [-646.899] (-650.563) (-650.452) -- 0:01:34
579000 -- (-658.632) (-658.014) [-655.133] (-652.542) * [-650.896] (-667.438) (-649.625) (-650.865) -- 0:01:34
580000 -- (-660.328) (-650.738) [-654.875] (-651.113) * (-651.960) (-650.858) (-653.933) [-649.512] -- 0:01:34
Average standard deviation of split frequencies: 0.009046
581000 -- (-650.355) (-661.354) [-654.647] (-654.967) * (-651.255) (-654.022) (-660.699) [-645.336] -- 0:01:34
582000 -- (-650.490) (-650.949) (-661.584) [-664.156] * (-650.702) (-656.012) (-649.948) [-646.797] -- 0:01:34
583000 -- (-656.953) [-651.120] (-656.223) (-664.161) * (-661.858) (-651.509) (-653.422) [-642.962] -- 0:01:33
584000 -- [-648.901] (-656.641) (-663.966) (-648.599) * (-654.313) (-653.770) [-660.072] (-653.241) -- 0:01:33
585000 -- (-659.874) (-650.823) (-660.872) [-652.325] * (-654.995) (-660.239) (-659.646) [-652.095] -- 0:01:32
Average standard deviation of split frequencies: 0.009653
586000 -- (-659.855) (-652.726) [-658.423] (-653.592) * [-658.392] (-657.531) (-655.751) (-668.719) -- 0:01:33
587000 -- [-651.947] (-662.489) (-657.963) (-652.541) * [-651.864] (-648.947) (-653.776) (-653.722) -- 0:01:32
588000 -- (-654.875) (-654.051) (-653.244) [-652.588] * (-651.456) (-649.272) [-654.150] (-655.075) -- 0:01:32
589000 -- [-653.187] (-667.636) (-657.146) (-657.361) * (-655.109) (-655.171) (-651.828) [-648.657] -- 0:01:32
590000 -- (-659.853) (-652.142) [-647.416] (-659.755) * [-656.567] (-656.274) (-651.141) (-651.295) -- 0:01:32
Average standard deviation of split frequencies: 0.009235
591000 -- (-654.428) (-652.442) [-650.851] (-645.004) * (-660.661) [-658.116] (-652.981) (-658.255) -- 0:01:32
592000 -- (-651.161) (-661.575) [-650.108] (-655.185) * (-649.510) (-664.239) (-651.428) [-651.862] -- 0:01:31
593000 -- (-655.535) [-652.642] (-651.427) (-653.633) * (-656.583) [-657.027] (-651.749) (-649.195) -- 0:01:31
594000 -- (-656.518) (-647.528) (-658.865) [-648.318] * (-656.403) [-655.074] (-654.812) (-662.541) -- 0:01:30
595000 -- [-649.687] (-649.041) (-656.237) (-646.626) * [-653.419] (-662.056) (-648.834) (-652.467) -- 0:01:31
Average standard deviation of split frequencies: 0.009887
596000 -- (-656.149) (-660.225) (-654.389) [-650.742] * (-651.490) (-656.274) [-650.658] (-647.534) -- 0:01:30
597000 -- [-648.474] (-654.564) (-646.872) (-653.284) * (-649.697) [-647.925] (-668.015) (-654.655) -- 0:01:30
598000 -- (-647.266) (-656.661) (-652.602) [-650.845] * (-673.098) [-646.179] (-653.972) (-649.942) -- 0:01:30
599000 -- [-654.441] (-660.669) (-652.031) (-651.263) * (-651.711) [-651.282] (-655.980) (-656.059) -- 0:01:30
600000 -- [-651.544] (-650.591) (-649.857) (-658.014) * [-659.450] (-656.902) (-660.977) (-661.415) -- 0:01:30
Average standard deviation of split frequencies: 0.010539
601000 -- (-655.221) (-656.710) (-656.854) [-647.031] * [-653.821] (-655.931) (-657.585) (-657.914) -- 0:01:29
602000 -- (-649.193) (-660.779) [-650.982] (-646.855) * [-653.540] (-646.369) (-651.871) (-647.181) -- 0:01:29
603000 -- (-651.366) (-654.742) [-649.736] (-649.344) * (-660.274) [-656.919] (-655.778) (-650.771) -- 0:01:29
604000 -- (-665.109) (-650.590) [-647.545] (-653.204) * [-665.881] (-652.434) (-654.541) (-655.522) -- 0:01:29
605000 -- (-654.783) [-654.641] (-649.607) (-649.923) * (-658.339) (-657.397) (-649.847) [-651.397] -- 0:01:28
Average standard deviation of split frequencies: 0.010168
606000 -- (-647.355) (-657.655) [-654.626] (-652.589) * [-649.177] (-656.611) (-660.911) (-652.008) -- 0:01:28
607000 -- (-650.442) (-656.083) [-647.187] (-653.072) * (-657.761) (-649.613) (-655.073) [-652.161] -- 0:01:28
608000 -- (-646.490) (-649.681) (-653.467) [-651.714] * (-656.638) (-651.431) (-657.918) [-657.926] -- 0:01:28
609000 -- [-651.562] (-653.682) (-654.582) (-652.066) * (-650.281) (-659.688) (-652.054) [-654.929] -- 0:01:27
610000 -- (-659.581) (-660.570) [-651.982] (-656.829) * (-660.975) [-647.552] (-646.648) (-663.987) -- 0:01:27
Average standard deviation of split frequencies: 0.010476
611000 -- [-654.607] (-651.674) (-664.721) (-655.872) * (-649.257) [-650.045] (-654.981) (-658.007) -- 0:01:27
612000 -- (-649.442) [-654.186] (-651.474) (-661.229) * (-662.305) [-648.075] (-651.932) (-657.474) -- 0:01:27
613000 -- (-657.742) (-655.387) [-652.259] (-649.967) * (-672.718) (-650.378) (-658.582) [-652.564] -- 0:01:27
614000 -- (-653.420) [-647.879] (-657.099) (-649.542) * [-661.749] (-657.327) (-648.773) (-665.002) -- 0:01:26
615000 -- (-650.346) (-655.950) [-649.697] (-652.995) * (-653.631) [-653.255] (-656.569) (-656.857) -- 0:01:26
Average standard deviation of split frequencies: 0.010604
616000 -- (-661.271) (-653.909) (-659.279) [-651.548] * (-658.494) [-646.239] (-655.561) (-648.357) -- 0:01:26
617000 -- (-659.411) (-647.927) (-651.102) [-656.197] * (-655.568) (-653.573) [-646.940] (-648.234) -- 0:01:26
618000 -- (-651.660) [-648.861] (-657.442) (-649.574) * [-654.204] (-651.053) (-650.487) (-647.578) -- 0:01:25
619000 -- (-650.609) (-645.564) (-653.574) [-650.922] * (-662.118) [-651.864] (-651.768) (-651.339) -- 0:01:25
620000 -- (-658.301) [-652.773] (-651.303) (-647.570) * (-659.512) (-656.924) (-652.143) [-651.312] -- 0:01:25
Average standard deviation of split frequencies: 0.010904
621000 -- (-657.313) (-653.656) [-649.297] (-655.621) * (-674.587) (-651.427) [-651.671] (-652.627) -- 0:01:25
622000 -- (-660.437) (-662.844) (-650.760) [-654.297] * (-651.841) (-651.235) [-656.338] (-653.745) -- 0:01:25
623000 -- (-651.892) [-653.639] (-652.252) (-655.202) * (-653.573) [-647.743] (-657.801) (-652.857) -- 0:01:24
624000 -- (-655.488) (-655.233) (-653.433) [-650.695] * [-652.077] (-648.659) (-660.694) (-651.782) -- 0:01:24
625000 -- (-662.387) (-656.435) (-655.762) [-656.716] * (-650.089) (-653.324) [-657.002] (-653.454) -- 0:01:24
Average standard deviation of split frequencies: 0.010758
626000 -- [-659.362] (-662.352) (-665.219) (-661.082) * (-652.436) (-654.765) [-653.185] (-654.865) -- 0:01:24
627000 -- (-659.113) (-663.322) [-647.918] (-657.629) * [-655.364] (-651.847) (-670.592) (-652.207) -- 0:01:23
628000 -- (-654.446) (-660.237) (-660.554) [-655.872] * (-649.282) (-651.034) [-649.997] (-654.838) -- 0:01:23
629000 -- [-652.833] (-654.958) (-656.204) (-650.177) * (-650.781) (-656.460) (-651.344) [-644.221] -- 0:01:23
630000 -- (-662.715) [-650.172] (-657.560) (-648.075) * (-652.664) (-657.414) (-652.463) [-652.183] -- 0:01:23
Average standard deviation of split frequencies: 0.010892
631000 -- (-654.742) [-650.130] (-659.604) (-655.615) * (-656.864) [-650.472] (-659.089) (-654.706) -- 0:01:23
632000 -- (-651.634) [-656.072] (-668.137) (-651.184) * [-657.525] (-660.101) (-667.510) (-656.301) -- 0:01:22
633000 -- (-655.300) [-655.704] (-654.657) (-650.771) * [-655.219] (-650.744) (-662.695) (-653.945) -- 0:01:22
634000 -- (-656.605) [-648.647] (-654.804) (-655.895) * [-652.076] (-658.211) (-658.879) (-659.329) -- 0:01:21
635000 -- (-661.298) [-652.317] (-658.436) (-649.741) * (-655.820) (-652.147) [-659.390] (-657.317) -- 0:01:22
Average standard deviation of split frequencies: 0.010853
636000 -- [-654.639] (-657.795) (-657.856) (-651.502) * (-655.187) [-651.604] (-651.810) (-648.885) -- 0:01:21
637000 -- (-656.143) [-649.978] (-652.674) (-652.628) * (-652.347) [-650.327] (-649.606) (-655.225) -- 0:01:21
638000 -- (-652.741) (-662.809) [-648.154] (-662.351) * [-652.924] (-652.092) (-656.693) (-651.000) -- 0:01:21
639000 -- (-652.990) [-652.290] (-654.089) (-657.278) * [-654.818] (-661.348) (-656.468) (-654.097) -- 0:01:21
640000 -- [-651.492] (-658.732) (-654.279) (-659.539) * (-659.695) (-653.951) (-653.815) [-652.661] -- 0:01:21
Average standard deviation of split frequencies: 0.011142
641000 -- (-664.172) (-661.391) (-647.749) [-648.396] * (-648.168) (-656.473) (-657.508) [-661.025] -- 0:01:20
642000 -- (-656.322) [-651.945] (-664.422) (-648.314) * (-659.796) (-657.858) (-651.933) [-652.268] -- 0:01:20
643000 -- (-663.539) [-649.685] (-663.774) (-650.183) * (-648.698) (-663.033) (-654.797) [-651.700] -- 0:01:19
644000 -- (-651.834) [-651.622] (-658.366) (-653.370) * (-664.811) (-655.730) (-658.903) [-656.812] -- 0:01:20
645000 -- (-656.030) (-656.934) (-649.640) [-651.074] * (-655.630) (-658.207) [-656.290] (-648.795) -- 0:01:19
Average standard deviation of split frequencies: 0.011259
646000 -- (-660.914) [-651.064] (-648.292) (-646.900) * [-646.919] (-654.862) (-651.084) (-657.748) -- 0:01:19
647000 -- (-653.454) (-658.150) [-650.133] (-650.591) * (-659.938) [-651.173] (-662.573) (-662.780) -- 0:01:19
648000 -- (-653.410) (-653.288) [-649.891] (-655.497) * (-648.953) (-660.765) (-657.086) [-646.365] -- 0:01:19
649000 -- (-656.275) (-668.468) [-652.280] (-655.259) * (-656.271) [-654.098] (-665.540) (-654.478) -- 0:01:18
650000 -- (-664.299) (-651.557) (-652.394) [-652.069] * [-654.481] (-660.852) (-648.863) (-655.033) -- 0:01:18
Average standard deviation of split frequencies: 0.011695
651000 -- (-660.687) [-649.101] (-651.108) (-654.086) * (-653.850) [-651.130] (-651.042) (-655.233) -- 0:01:18
652000 -- (-648.627) [-648.366] (-666.029) (-646.521) * (-663.329) (-670.251) [-653.966] (-653.627) -- 0:01:17
653000 -- [-652.366] (-649.191) (-657.582) (-653.372) * (-648.321) (-649.302) [-650.624] (-656.534) -- 0:01:18
654000 -- (-650.539) [-654.521] (-651.270) (-648.463) * (-669.743) (-658.106) [-653.801] (-653.420) -- 0:01:17
655000 -- [-653.860] (-653.622) (-675.399) (-656.548) * [-653.298] (-651.842) (-656.105) (-655.914) -- 0:01:17
Average standard deviation of split frequencies: 0.011190
656000 -- [-655.660] (-655.394) (-656.764) (-660.847) * (-652.296) (-652.620) (-650.813) [-650.079] -- 0:01:17
657000 -- [-650.373] (-653.550) (-648.827) (-657.231) * (-656.310) [-654.416] (-658.541) (-649.399) -- 0:01:17
658000 -- (-657.816) [-644.997] (-654.461) (-656.487) * (-645.935) (-656.851) (-648.407) [-654.399] -- 0:01:16
659000 -- (-662.562) (-646.072) (-650.116) [-653.401] * (-664.077) (-651.175) (-650.532) [-658.946] -- 0:01:16
660000 -- (-667.343) [-646.309] (-653.047) (-653.480) * (-657.857) [-650.671] (-649.013) (-650.290) -- 0:01:16
Average standard deviation of split frequencies: 0.010550
661000 -- (-653.364) (-662.574) [-650.325] (-662.386) * [-649.132] (-656.244) (-664.638) (-666.283) -- 0:01:15
662000 -- (-650.852) [-650.980] (-661.660) (-656.167) * (-661.651) (-655.445) (-652.315) [-651.205] -- 0:01:16
663000 -- (-649.683) (-652.892) (-653.551) [-654.619] * (-655.466) [-655.339] (-650.144) (-649.385) -- 0:01:15
664000 -- [-655.590] (-650.665) (-656.200) (-652.931) * (-652.366) (-660.504) [-657.259] (-652.685) -- 0:01:15
665000 -- (-666.976) (-649.116) [-650.851] (-658.339) * (-654.182) (-661.000) [-656.579] (-657.173) -- 0:01:15
Average standard deviation of split frequencies: 0.010617
666000 -- (-659.413) (-663.057) (-665.395) [-659.586] * (-648.452) [-643.175] (-651.183) (-665.366) -- 0:01:15
667000 -- [-651.691] (-659.479) (-655.247) (-660.359) * [-652.022] (-651.346) (-651.170) (-654.788) -- 0:01:14
668000 -- [-648.318] (-658.346) (-652.046) (-656.093) * (-658.410) [-661.653] (-659.185) (-647.270) -- 0:01:14
669000 -- (-654.559) (-658.982) (-660.294) [-653.665] * (-659.487) [-647.747] (-660.069) (-651.722) -- 0:01:14
670000 -- (-648.501) (-660.586) (-647.304) [-653.022] * (-669.620) (-649.069) [-656.038] (-657.825) -- 0:01:13
Average standard deviation of split frequencies: 0.010091
671000 -- (-650.169) [-655.087] (-650.220) (-655.647) * (-653.560) (-652.879) (-659.804) [-654.566] -- 0:01:14
672000 -- [-660.366] (-654.937) (-650.898) (-657.121) * (-666.746) [-651.988] (-657.781) (-657.583) -- 0:01:13
673000 -- (-654.322) (-654.259) [-648.904] (-656.901) * (-665.702) [-648.545] (-656.270) (-660.088) -- 0:01:13
674000 -- (-651.561) (-666.751) [-655.806] (-654.029) * [-658.551] (-648.265) (-666.990) (-661.879) -- 0:01:13
675000 -- [-647.464] (-651.077) (-649.985) (-663.039) * (-660.812) (-651.314) (-652.400) [-650.109] -- 0:01:13
Average standard deviation of split frequencies: 0.010261
676000 -- (-649.211) (-655.886) [-654.320] (-655.042) * [-655.044] (-654.420) (-658.992) (-652.283) -- 0:01:12
677000 -- [-647.653] (-652.916) (-655.573) (-653.238) * (-653.874) [-653.874] (-664.848) (-658.399) -- 0:01:12
678000 -- (-653.037) (-650.112) (-657.787) [-655.876] * (-661.319) (-656.478) (-656.822) [-656.990] -- 0:01:12
679000 -- (-664.961) (-661.042) [-654.415] (-652.276) * [-649.791] (-649.430) (-654.921) (-661.730) -- 0:01:11
680000 -- [-652.832] (-656.218) (-667.606) (-649.573) * (-650.252) (-657.959) [-656.252] (-652.870) -- 0:01:12
Average standard deviation of split frequencies: 0.010388
681000 -- (-652.955) (-658.729) [-650.482] (-659.383) * [-648.285] (-656.612) (-661.021) (-656.753) -- 0:01:11
682000 -- (-653.014) [-656.798] (-654.023) (-647.965) * (-654.861) (-651.188) (-657.850) [-654.531] -- 0:01:11
683000 -- (-651.351) (-651.499) (-654.702) [-654.574] * (-650.521) (-655.678) (-661.588) [-653.578] -- 0:01:11
684000 -- [-652.538] (-653.279) (-649.643) (-651.045) * (-650.040) [-652.238] (-655.297) (-660.212) -- 0:01:11
685000 -- [-651.042] (-653.456) (-650.703) (-659.887) * (-649.621) (-652.375) [-654.067] (-657.695) -- 0:01:10
Average standard deviation of split frequencies: 0.010259
686000 -- (-651.587) (-649.895) [-660.253] (-650.137) * (-646.544) (-666.920) [-656.496] (-663.070) -- 0:01:10
687000 -- (-653.879) (-651.325) (-659.249) [-652.476] * (-659.272) [-646.485] (-661.536) (-656.377) -- 0:01:10
688000 -- [-651.199] (-651.899) (-658.940) (-653.168) * [-652.010] (-660.747) (-654.053) (-655.196) -- 0:01:09
689000 -- (-651.957) (-653.431) (-655.012) [-653.357] * (-650.999) (-652.200) [-653.601] (-652.679) -- 0:01:09
690000 -- (-652.947) (-660.054) [-651.281] (-655.434) * (-651.791) (-649.306) [-653.690] (-658.846) -- 0:01:09
Average standard deviation of split frequencies: 0.010433
691000 -- [-652.908] (-656.995) (-652.744) (-650.825) * [-650.618] (-649.995) (-653.391) (-656.678) -- 0:01:09
692000 -- (-659.104) (-655.405) [-654.081] (-656.160) * (-661.361) [-653.261] (-664.150) (-656.468) -- 0:01:08
693000 -- (-661.211) (-655.819) (-661.995) [-650.227] * (-660.889) [-652.380] (-671.447) (-663.945) -- 0:01:09
694000 -- [-649.532] (-655.006) (-657.623) (-658.542) * [-649.455] (-665.816) (-657.139) (-659.415) -- 0:01:08
695000 -- [-644.863] (-651.368) (-657.075) (-652.333) * (-652.507) (-657.138) [-652.394] (-662.428) -- 0:01:08
Average standard deviation of split frequencies: 0.010401
696000 -- (-664.361) (-652.123) (-666.044) [-647.402] * (-662.207) (-664.149) (-659.681) [-650.321] -- 0:01:08
697000 -- (-648.829) (-649.357) (-648.222) [-649.930] * (-659.939) (-664.023) (-650.759) [-651.207] -- 0:01:08
698000 -- [-649.650] (-654.027) (-655.739) (-648.002) * (-659.166) [-656.412] (-655.535) (-666.358) -- 0:01:07
699000 -- (-652.571) (-656.071) [-651.120] (-663.803) * (-652.409) (-655.154) (-650.791) [-657.026] -- 0:01:07
700000 -- (-660.309) (-658.732) [-649.419] (-653.604) * (-655.770) (-655.891) [-650.910] (-652.429) -- 0:01:07
Average standard deviation of split frequencies: 0.010476
701000 -- (-655.059) (-655.376) (-651.598) [-654.287] * (-655.306) (-658.172) [-648.834] (-658.208) -- 0:01:06
702000 -- (-660.692) (-655.752) [-656.131] (-657.076) * (-657.749) [-664.107] (-657.617) (-661.831) -- 0:01:07
703000 -- (-649.921) [-652.371] (-651.204) (-651.368) * [-669.803] (-649.272) (-653.763) (-651.647) -- 0:01:06
704000 -- [-650.771] (-658.895) (-648.731) (-653.217) * (-654.696) (-654.647) [-662.500] (-658.539) -- 0:01:06
705000 -- (-657.344) (-651.300) [-652.734] (-653.228) * (-660.833) [-646.261] (-655.803) (-656.319) -- 0:01:06
Average standard deviation of split frequencies: 0.010350
706000 -- (-649.364) (-650.078) [-652.457] (-650.975) * [-651.270] (-649.856) (-656.319) (-665.566) -- 0:01:06
707000 -- (-657.027) (-656.860) [-648.491] (-647.978) * [-653.153] (-647.978) (-660.303) (-659.198) -- 0:01:05
708000 -- [-650.497] (-650.430) (-655.974) (-653.130) * (-646.418) [-645.217] (-652.218) (-651.821) -- 0:01:05
709000 -- (-655.826) [-652.185] (-656.533) (-658.708) * (-652.660) [-649.495] (-663.583) (-647.010) -- 0:01:05
710000 -- (-654.715) (-658.989) (-645.391) [-655.718] * (-646.507) (-652.847) (-664.911) [-648.813] -- 0:01:04
Average standard deviation of split frequencies: 0.010424
711000 -- (-654.725) (-653.607) (-651.363) [-650.398] * [-647.544] (-665.214) (-654.262) (-651.809) -- 0:01:05
712000 -- (-646.397) (-658.600) [-654.466] (-653.465) * (-652.414) (-653.626) (-663.273) [-647.911] -- 0:01:04
713000 -- [-654.695] (-662.368) (-655.850) (-652.642) * (-653.236) (-668.585) (-653.359) [-655.976] -- 0:01:04
714000 -- [-652.959] (-654.290) (-664.876) (-654.650) * (-665.575) (-660.305) [-647.530] (-647.634) -- 0:01:04
715000 -- (-651.586) (-655.744) [-659.422] (-657.962) * (-657.993) (-662.492) (-656.534) [-657.183] -- 0:01:04
Average standard deviation of split frequencies: 0.010158
716000 -- [-648.992] (-649.544) (-648.577) (-655.532) * (-657.984) (-656.677) [-650.388] (-661.815) -- 0:01:03
717000 -- (-651.174) (-663.589) (-657.966) [-651.876] * (-665.080) [-657.644] (-659.771) (-651.919) -- 0:01:03
718000 -- (-660.336) (-666.220) (-661.180) [-654.369] * [-648.850] (-653.449) (-658.673) (-649.342) -- 0:01:03
719000 -- (-653.907) [-654.273] (-661.596) (-659.441) * [-650.095] (-652.921) (-668.645) (-653.824) -- 0:01:02
720000 -- (-651.049) [-651.791] (-653.538) (-669.167) * (-662.518) (-657.207) (-662.547) [-650.581] -- 0:01:03
Average standard deviation of split frequencies: 0.010466
721000 -- [-663.110] (-658.194) (-650.420) (-659.869) * (-649.734) [-652.107] (-651.398) (-655.949) -- 0:01:02
722000 -- (-660.981) [-652.129] (-653.200) (-656.986) * (-651.256) (-653.796) (-650.057) [-656.427] -- 0:01:02
723000 -- (-650.680) (-652.653) (-655.960) [-655.984] * (-652.097) (-656.895) (-652.539) [-647.089] -- 0:01:02
724000 -- [-657.973] (-657.323) (-652.864) (-662.493) * [-650.955] (-652.374) (-654.589) (-656.458) -- 0:01:02
725000 -- [-656.160] (-652.610) (-658.843) (-656.347) * (-651.107) (-647.167) (-655.712) [-647.406] -- 0:01:01
Average standard deviation of split frequencies: 0.010528
726000 -- (-658.470) [-649.237] (-652.672) (-651.377) * (-652.219) (-650.148) (-656.602) [-657.958] -- 0:01:01
727000 -- (-652.817) [-657.052] (-657.456) (-648.261) * [-650.987] (-656.411) (-657.804) (-650.856) -- 0:01:01
728000 -- (-652.597) [-652.308] (-651.736) (-652.802) * (-655.578) (-658.232) [-656.620] (-649.292) -- 0:01:00
729000 -- (-651.760) [-648.902] (-650.504) (-657.066) * (-654.131) (-664.643) (-658.351) [-652.973] -- 0:01:00
730000 -- (-660.241) (-659.604) [-650.929] (-651.022) * (-651.910) (-658.723) [-654.658] (-649.280) -- 0:01:00
Average standard deviation of split frequencies: 0.010620
731000 -- (-658.690) (-663.123) (-658.337) [-655.812] * (-664.321) [-653.811] (-652.465) (-654.230) -- 0:01:00
732000 -- (-652.033) [-655.617] (-662.668) (-652.319) * (-655.543) [-650.078] (-652.806) (-659.393) -- 0:01:00
733000 -- (-656.029) (-658.168) (-654.164) [-648.445] * (-655.265) (-655.212) (-651.595) [-655.797] -- 0:01:00
734000 -- (-653.245) [-648.676] (-655.216) (-657.883) * [-655.196] (-654.205) (-657.649) (-658.073) -- 0:00:59
735000 -- (-655.956) [-652.576] (-653.721) (-653.940) * (-651.534) [-657.000] (-653.005) (-660.504) -- 0:00:59
Average standard deviation of split frequencies: 0.010938
736000 -- [-658.939] (-650.597) (-650.819) (-653.894) * (-654.989) [-653.287] (-651.884) (-655.346) -- 0:00:59
737000 -- (-661.292) [-658.785] (-656.618) (-652.393) * (-657.552) (-656.167) [-654.642] (-654.086) -- 0:00:58
738000 -- [-654.994] (-661.371) (-651.451) (-651.106) * [-650.560] (-666.315) (-651.924) (-653.324) -- 0:00:58
739000 -- [-659.860] (-664.327) (-658.302) (-662.704) * [-650.719] (-657.452) (-649.087) (-658.530) -- 0:00:58
740000 -- (-656.249) (-659.703) (-662.070) [-655.060] * [-650.549] (-661.725) (-652.596) (-657.895) -- 0:00:58
Average standard deviation of split frequencies: 0.010771
741000 -- [-659.285] (-653.762) (-649.303) (-656.237) * (-655.973) (-655.131) [-645.872] (-651.307) -- 0:00:58
742000 -- (-649.713) (-654.358) [-650.990] (-651.807) * (-650.428) (-654.097) [-652.487] (-656.297) -- 0:00:58
743000 -- (-658.711) [-649.596] (-656.546) (-649.125) * (-650.699) (-656.105) (-657.978) [-667.820] -- 0:00:57
744000 -- (-657.764) (-654.066) (-655.628) [-651.698] * (-661.196) (-655.547) [-653.333] (-648.300) -- 0:00:57
745000 -- [-653.814] (-661.008) (-655.237) (-648.456) * [-647.720] (-650.214) (-655.449) (-647.004) -- 0:00:57
Average standard deviation of split frequencies: 0.011326
746000 -- (-652.950) (-652.453) (-654.396) [-653.623] * (-659.560) (-657.664) [-652.211] (-660.929) -- 0:00:57
747000 -- [-652.162] (-652.643) (-663.978) (-651.609) * [-649.563] (-658.638) (-648.985) (-667.940) -- 0:00:56
748000 -- (-655.868) [-651.087] (-652.439) (-662.018) * (-657.645) (-659.068) [-655.614] (-653.028) -- 0:00:56
749000 -- (-655.053) (-659.757) (-648.253) [-647.734] * (-647.383) (-653.121) [-660.296] (-655.835) -- 0:00:56
750000 -- (-654.694) (-660.825) [-656.047] (-656.876) * (-659.550) (-654.417) [-652.165] (-650.062) -- 0:00:56
Average standard deviation of split frequencies: 0.010579
751000 -- (-652.327) (-657.721) (-655.972) [-662.830] * [-649.591] (-657.345) (-654.678) (-648.855) -- 0:00:56
752000 -- (-651.370) [-654.181] (-665.850) (-656.826) * (-655.256) (-649.498) (-657.468) [-659.564] -- 0:00:55
753000 -- (-653.046) (-651.711) [-648.435] (-649.485) * (-653.019) [-654.980] (-652.147) (-658.569) -- 0:00:55
754000 -- (-649.814) [-650.655] (-649.959) (-650.666) * [-656.912] (-651.192) (-657.968) (-660.763) -- 0:00:55
755000 -- (-651.643) [-649.210] (-648.157) (-651.771) * [-650.921] (-652.081) (-650.105) (-655.930) -- 0:00:55
Average standard deviation of split frequencies: 0.010025
756000 -- (-652.662) [-650.554] (-647.775) (-652.925) * (-653.480) (-657.410) [-650.936] (-655.440) -- 0:00:54
757000 -- (-660.559) [-650.596] (-661.321) (-655.259) * (-653.459) (-659.012) [-647.877] (-656.946) -- 0:00:54
758000 -- [-653.350] (-655.336) (-652.045) (-658.465) * (-650.858) (-654.544) (-652.283) [-654.790] -- 0:00:54
759000 -- (-653.236) [-654.267] (-653.416) (-651.714) * (-647.260) (-656.996) (-652.710) [-657.205] -- 0:00:53
760000 -- (-654.925) (-657.846) (-649.683) [-650.181] * (-649.466) [-648.149] (-658.877) (-651.350) -- 0:00:54
Average standard deviation of split frequencies: 0.010440
761000 -- (-653.528) (-658.581) (-650.829) [-654.662] * (-652.906) (-648.102) (-650.727) [-653.937] -- 0:00:53
762000 -- (-651.840) (-644.873) (-649.104) [-655.841] * (-666.301) (-648.996) (-666.790) [-648.031] -- 0:00:53
763000 -- (-659.919) (-648.191) [-650.712] (-650.159) * [-650.933] (-646.797) (-666.702) (-654.261) -- 0:00:53
764000 -- (-659.979) (-650.041) (-655.150) [-652.815] * (-650.318) (-658.252) (-653.029) [-648.523] -- 0:00:53
765000 -- (-656.106) [-650.142] (-653.042) (-650.674) * (-654.938) (-655.705) (-652.388) [-655.246] -- 0:00:52
Average standard deviation of split frequencies: 0.009941
766000 -- (-653.981) (-654.096) (-662.640) [-645.092] * [-649.880] (-653.706) (-658.702) (-650.026) -- 0:00:52
767000 -- (-651.569) [-651.861] (-665.961) (-663.521) * (-655.791) (-655.096) [-649.628] (-651.904) -- 0:00:52
768000 -- [-652.994] (-657.626) (-657.734) (-654.583) * (-646.089) [-652.963] (-649.943) (-657.579) -- 0:00:51
769000 -- [-651.475] (-646.781) (-653.169) (-658.842) * (-649.714) (-659.891) [-654.397] (-652.098) -- 0:00:51
770000 -- (-648.854) [-646.909] (-651.711) (-653.230) * (-657.621) [-653.456] (-653.042) (-649.930) -- 0:00:51
Average standard deviation of split frequencies: 0.010069
771000 -- (-648.497) (-653.639) [-648.037] (-659.253) * (-658.609) [-650.290] (-653.742) (-654.715) -- 0:00:51
772000 -- (-653.680) (-648.259) (-650.399) [-651.076] * (-651.095) [-648.926] (-662.663) (-657.815) -- 0:00:51
773000 -- [-655.627] (-656.843) (-647.985) (-654.804) * [-655.461] (-651.766) (-662.610) (-657.194) -- 0:00:51
774000 -- (-653.231) [-650.736] (-658.505) (-651.240) * (-651.432) [-650.495] (-652.389) (-665.043) -- 0:00:50
775000 -- [-652.479] (-654.933) (-650.559) (-654.660) * (-652.369) [-653.261] (-654.847) (-655.363) -- 0:00:50
Average standard deviation of split frequencies: 0.009720
776000 -- [-648.908] (-652.583) (-653.598) (-652.827) * (-648.172) [-650.477] (-654.090) (-657.219) -- 0:00:50
777000 -- (-650.616) [-648.417] (-663.492) (-652.203) * (-653.264) [-652.678] (-653.650) (-663.329) -- 0:00:49
778000 -- (-659.200) (-657.978) [-656.196] (-648.684) * (-651.823) (-662.490) [-650.491] (-653.432) -- 0:00:49
779000 -- (-651.711) (-659.079) (-652.708) [-652.871] * (-651.052) (-653.822) [-651.489] (-656.904) -- 0:00:49
780000 -- [-647.893] (-662.882) (-655.846) (-656.720) * (-663.603) [-651.938] (-647.688) (-653.658) -- 0:00:49
Average standard deviation of split frequencies: 0.009383
781000 -- [-650.002] (-654.619) (-657.283) (-650.698) * (-654.981) [-648.316] (-652.166) (-653.345) -- 0:00:49
782000 -- (-652.755) (-658.541) (-655.417) [-650.938] * (-654.466) [-651.126] (-647.999) (-648.528) -- 0:00:49
783000 -- (-653.387) (-665.817) [-651.380] (-663.399) * (-658.336) [-655.114] (-646.303) (-648.464) -- 0:00:48
784000 -- (-648.633) (-660.781) (-658.260) [-654.313] * (-659.502) (-650.382) (-655.560) [-650.517] -- 0:00:48
785000 -- [-650.806] (-656.694) (-658.293) (-654.529) * (-651.473) (-650.525) (-653.166) [-652.679] -- 0:00:48
Average standard deviation of split frequencies: 0.009042
786000 -- [-653.437] (-656.431) (-655.383) (-665.733) * (-664.989) (-652.329) [-654.100] (-665.005) -- 0:00:48
787000 -- (-651.917) [-648.608] (-658.530) (-666.428) * (-649.737) (-654.753) [-657.938] (-658.432) -- 0:00:47
788000 -- (-654.400) (-657.466) (-662.638) [-650.444] * [-654.662] (-654.555) (-651.309) (-648.129) -- 0:00:47
789000 -- [-653.825] (-648.771) (-656.619) (-649.371) * (-660.333) (-648.118) [-652.678] (-661.518) -- 0:00:47
790000 -- (-654.199) (-649.856) (-649.642) [-650.639] * (-657.666) [-655.275] (-650.249) (-661.788) -- 0:00:47
Average standard deviation of split frequencies: 0.008806
791000 -- (-654.999) (-653.879) [-650.527] (-657.999) * (-654.722) (-659.713) [-650.036] (-653.579) -- 0:00:47
792000 -- (-652.348) (-662.618) (-656.787) [-656.054] * (-652.380) (-654.420) [-653.905] (-650.542) -- 0:00:46
793000 -- (-656.481) (-647.738) [-659.069] (-657.583) * (-650.220) (-654.614) (-652.465) [-648.401] -- 0:00:46
794000 -- [-650.991] (-651.031) (-652.984) (-658.710) * (-659.175) [-651.467] (-657.572) (-652.744) -- 0:00:46
795000 -- [-650.870] (-655.051) (-646.588) (-655.175) * (-650.283) [-651.383] (-654.547) (-654.856) -- 0:00:46
Average standard deviation of split frequencies: 0.009020
796000 -- (-651.839) (-650.907) [-649.583] (-652.079) * (-658.257) (-647.021) [-649.905] (-647.942) -- 0:00:45
797000 -- (-651.912) [-650.511] (-661.965) (-649.596) * [-655.125] (-663.919) (-653.459) (-657.971) -- 0:00:45
798000 -- (-653.446) [-654.552] (-649.677) (-648.674) * (-649.368) (-652.409) (-666.874) [-646.398] -- 0:00:45
799000 -- (-658.781) (-653.375) [-650.516] (-658.613) * (-658.743) (-651.083) (-660.622) [-644.972] -- 0:00:45
800000 -- [-654.211] (-645.861) (-658.323) (-661.890) * (-657.265) (-658.847) [-653.475] (-649.208) -- 0:00:45
Average standard deviation of split frequencies: 0.008922
801000 -- (-649.436) (-658.557) (-663.351) [-653.376] * [-646.439] (-650.567) (-656.949) (-656.200) -- 0:00:44
802000 -- [-645.478] (-649.028) (-656.558) (-659.734) * [-650.982] (-657.400) (-654.599) (-658.847) -- 0:00:44
803000 -- (-657.239) (-657.181) [-649.170] (-653.723) * (-655.057) [-652.574] (-651.317) (-660.697) -- 0:00:44
804000 -- [-659.845] (-656.243) (-654.084) (-648.805) * [-652.444] (-657.439) (-653.189) (-652.792) -- 0:00:44
805000 -- (-657.954) [-649.179] (-654.120) (-650.019) * [-652.658] (-649.369) (-656.042) (-654.609) -- 0:00:43
Average standard deviation of split frequencies: 0.008908
806000 -- (-668.578) (-657.417) (-657.936) [-647.736] * (-659.441) (-651.232) (-657.251) [-657.172] -- 0:00:43
807000 -- (-650.155) (-656.900) [-652.307] (-663.409) * (-646.451) [-649.284] (-662.752) (-652.377) -- 0:00:43
808000 -- [-656.609] (-653.767) (-658.044) (-646.800) * [-650.545] (-655.505) (-657.656) (-659.146) -- 0:00:43
809000 -- [-648.670] (-654.901) (-661.238) (-658.778) * (-653.625) (-657.158) (-649.589) [-658.416] -- 0:00:42
810000 -- (-651.464) (-669.350) [-654.452] (-649.444) * [-656.323] (-663.128) (-653.556) (-651.781) -- 0:00:42
Average standard deviation of split frequencies: 0.008901
811000 -- (-653.436) (-663.158) (-661.253) [-648.846] * (-664.682) [-649.822] (-659.668) (-662.334) -- 0:00:42
812000 -- (-659.022) (-653.909) (-650.744) [-647.285] * (-671.571) [-650.692] (-665.188) (-649.865) -- 0:00:42
813000 -- (-655.090) (-656.803) [-653.365] (-653.281) * (-652.971) [-662.073] (-663.678) (-652.934) -- 0:00:42
814000 -- [-654.141] (-669.343) (-651.222) (-651.955) * (-650.997) (-660.092) [-655.247] (-658.142) -- 0:00:41
815000 -- [-658.579] (-654.712) (-655.585) (-652.283) * [-650.246] (-659.790) (-652.049) (-652.636) -- 0:00:41
Average standard deviation of split frequencies: 0.008710
816000 -- (-657.523) [-659.661] (-666.567) (-656.347) * (-652.925) [-653.030] (-650.827) (-655.415) -- 0:00:41
817000 -- [-646.847] (-661.478) (-652.433) (-659.257) * (-647.989) (-659.296) [-655.696] (-662.464) -- 0:00:40
818000 -- [-655.314] (-647.990) (-657.238) (-653.051) * [-651.362] (-662.385) (-664.506) (-654.849) -- 0:00:40
819000 -- [-649.587] (-651.625) (-653.290) (-654.912) * (-665.558) (-654.909) [-659.627] (-657.274) -- 0:00:40
820000 -- (-650.447) (-654.263) [-646.953] (-660.954) * (-655.628) (-659.755) (-646.269) [-656.426] -- 0:00:40
Average standard deviation of split frequencies: 0.008749
821000 -- (-658.349) (-651.060) (-648.669) [-649.842] * (-647.918) (-651.598) (-649.037) [-652.074] -- 0:00:40
822000 -- (-659.157) [-647.697] (-646.512) (-651.956) * (-654.427) [-648.068] (-657.582) (-658.602) -- 0:00:40
823000 -- (-664.058) (-655.776) [-650.944] (-649.959) * [-647.418] (-652.669) (-654.176) (-660.330) -- 0:00:39
824000 -- (-658.153) (-651.921) (-659.106) [-654.865] * (-663.566) (-650.361) (-668.956) [-652.289] -- 0:00:39
825000 -- (-650.038) (-651.673) [-652.363] (-651.742) * (-659.590) (-658.164) (-652.253) [-650.601] -- 0:00:39
Average standard deviation of split frequencies: 0.008429
826000 -- (-667.064) [-648.559] (-660.974) (-651.954) * [-655.770] (-650.292) (-657.905) (-654.905) -- 0:00:39
827000 -- [-647.948] (-655.348) (-655.826) (-652.640) * (-661.275) (-652.014) [-652.398] (-656.781) -- 0:00:38
828000 -- (-657.212) [-648.914] (-653.610) (-658.670) * [-654.102] (-658.798) (-663.557) (-656.371) -- 0:00:38
829000 -- (-657.295) (-651.267) [-650.162] (-648.397) * (-659.507) (-645.934) [-650.304] (-653.936) -- 0:00:38
830000 -- (-654.190) (-652.369) [-652.580] (-652.647) * (-656.212) (-656.610) [-657.864] (-657.503) -- 0:00:38
Average standard deviation of split frequencies: 0.008076
831000 -- [-645.868] (-653.037) (-652.905) (-656.583) * (-655.348) (-651.557) (-655.158) [-652.468] -- 0:00:38
832000 -- (-664.851) [-650.574] (-652.582) (-654.330) * (-649.179) (-666.683) [-646.611] (-655.176) -- 0:00:37
833000 -- (-649.677) (-654.445) [-651.701] (-658.500) * (-652.620) [-648.876] (-653.390) (-659.783) -- 0:00:37
834000 -- (-654.976) [-648.119] (-653.079) (-658.548) * (-650.341) (-652.633) [-650.324] (-659.706) -- 0:00:37
835000 -- (-653.972) (-650.515) [-653.874] (-650.696) * (-654.233) (-655.332) [-647.456] (-657.785) -- 0:00:37
Average standard deviation of split frequencies: 0.008458
836000 -- (-655.100) [-650.917] (-651.136) (-653.087) * (-654.544) (-656.428) (-654.516) [-653.865] -- 0:00:36
837000 -- (-652.740) (-652.640) [-648.246] (-664.157) * (-659.058) (-647.663) (-655.293) [-653.613] -- 0:00:36
838000 -- (-648.822) [-655.536] (-650.362) (-661.747) * (-653.182) (-654.278) (-652.791) [-647.697] -- 0:00:36
839000 -- (-651.618) [-654.419] (-653.095) (-662.030) * [-656.001] (-656.463) (-655.368) (-657.184) -- 0:00:36
840000 -- [-655.707] (-649.474) (-652.939) (-659.805) * (-652.541) (-652.101) (-652.705) [-645.804] -- 0:00:36
Average standard deviation of split frequencies: 0.007764
841000 -- (-651.298) (-655.130) [-652.412] (-654.505) * (-649.847) (-650.925) (-651.829) [-653.498] -- 0:00:35
842000 -- (-650.250) [-648.916] (-653.705) (-651.172) * (-660.507) [-648.047] (-651.630) (-660.842) -- 0:00:35
843000 -- (-663.716) (-652.414) (-650.244) [-649.589] * [-658.545] (-660.092) (-655.071) (-658.239) -- 0:00:35
844000 -- (-652.903) (-650.595) [-660.390] (-651.066) * [-648.076] (-649.962) (-653.698) (-649.854) -- 0:00:35
845000 -- (-666.673) [-652.570] (-654.746) (-653.639) * (-654.717) (-650.756) (-651.252) [-646.830] -- 0:00:34
Average standard deviation of split frequencies: 0.007415
846000 -- (-648.834) [-646.831] (-655.505) (-663.590) * (-653.836) (-664.342) (-661.502) [-647.288] -- 0:00:34
847000 -- (-658.510) [-652.276] (-645.124) (-651.485) * (-652.718) [-649.503] (-654.901) (-655.188) -- 0:00:34
848000 -- (-659.901) (-660.542) [-651.519] (-658.545) * [-658.680] (-648.557) (-655.067) (-656.382) -- 0:00:34
849000 -- (-657.458) (-657.658) [-654.702] (-661.938) * (-651.767) (-654.751) [-645.344] (-654.788) -- 0:00:33
850000 -- (-650.731) (-671.876) (-650.455) [-653.233] * (-659.300) (-657.643) [-649.420] (-654.803) -- 0:00:33
Average standard deviation of split frequencies: 0.007545
851000 -- (-648.671) (-657.670) [-653.514] (-652.071) * (-660.063) (-653.370) [-650.903] (-655.105) -- 0:00:33
852000 -- (-656.374) [-653.579] (-650.269) (-656.469) * (-653.364) [-645.978] (-658.343) (-650.614) -- 0:00:33
853000 -- (-665.024) (-652.283) (-653.434) [-650.719] * (-660.721) (-650.789) (-647.300) [-650.507] -- 0:00:33
854000 -- (-652.821) (-655.210) [-649.313] (-654.003) * (-650.852) [-647.432] (-647.476) (-653.220) -- 0:00:32
855000 -- [-661.084] (-659.735) (-653.944) (-656.514) * (-655.774) [-654.372] (-656.320) (-652.220) -- 0:00:32
Average standard deviation of split frequencies: 0.006990
856000 -- (-651.877) [-648.998] (-644.819) (-659.819) * [-651.627] (-658.798) (-648.331) (-655.916) -- 0:00:32
857000 -- (-665.581) (-650.535) (-649.997) [-648.694] * (-649.021) [-650.950] (-653.112) (-655.709) -- 0:00:32
858000 -- [-652.510] (-658.560) (-654.284) (-647.727) * (-649.857) (-651.193) [-653.523] (-655.832) -- 0:00:31
859000 -- (-659.985) (-647.843) [-655.130] (-653.331) * [-656.045] (-652.986) (-651.133) (-647.540) -- 0:00:31
860000 -- [-652.964] (-654.260) (-658.150) (-652.142) * (-659.209) [-648.746] (-649.383) (-648.363) -- 0:00:31
Average standard deviation of split frequencies: 0.007036
861000 -- (-659.302) [-652.049] (-654.411) (-654.517) * (-657.123) (-649.657) [-648.682] (-648.454) -- 0:00:31
862000 -- (-651.622) [-652.593] (-649.210) (-659.121) * (-659.088) [-653.805] (-659.305) (-651.792) -- 0:00:31
863000 -- (-646.870) (-656.688) [-646.550] (-652.984) * [-652.201] (-656.815) (-658.206) (-655.299) -- 0:00:30
864000 -- (-653.019) [-650.787] (-654.814) (-652.394) * (-648.619) (-655.340) [-649.228] (-649.734) -- 0:00:30
865000 -- (-651.095) [-650.734] (-650.780) (-656.191) * (-652.732) (-661.708) [-652.684] (-663.001) -- 0:00:30
Average standard deviation of split frequencies: 0.007244
866000 -- [-660.150] (-652.385) (-650.668) (-650.248) * (-658.243) (-651.671) [-655.122] (-662.509) -- 0:00:30
867000 -- (-651.008) (-650.529) [-651.217] (-652.793) * (-658.370) [-645.913] (-657.770) (-656.629) -- 0:00:29
868000 -- (-663.842) (-653.496) (-652.565) [-647.631] * [-648.624] (-651.637) (-651.905) (-647.757) -- 0:00:29
869000 -- (-656.717) (-651.203) (-649.558) [-648.089] * [-648.045] (-661.180) (-652.925) (-651.947) -- 0:00:29
870000 -- (-647.925) [-660.147] (-649.422) (-650.208) * (-645.541) (-653.482) (-658.060) [-652.458] -- 0:00:29
Average standard deviation of split frequencies: 0.006955
871000 -- [-651.523] (-653.050) (-652.165) (-660.150) * (-654.282) (-656.311) [-659.908] (-653.801) -- 0:00:29
872000 -- (-654.901) (-645.364) [-647.681] (-655.858) * [-650.726] (-645.964) (-657.050) (-654.013) -- 0:00:28
873000 -- [-654.952] (-663.835) (-650.893) (-652.877) * [-650.924] (-655.811) (-660.896) (-658.071) -- 0:00:28
874000 -- (-650.093) (-652.232) [-655.630] (-650.120) * [-651.887] (-651.410) (-651.991) (-653.705) -- 0:00:28
875000 -- (-649.903) [-649.220] (-661.790) (-652.271) * (-648.205) [-653.268] (-656.143) (-654.128) -- 0:00:28
Average standard deviation of split frequencies: 0.007658
876000 -- (-654.313) [-644.526] (-659.430) (-654.643) * (-651.246) (-650.999) [-650.319] (-654.209) -- 0:00:27
877000 -- [-650.496] (-657.812) (-656.690) (-653.567) * (-656.988) (-661.095) (-662.499) [-655.415] -- 0:00:27
878000 -- [-650.800] (-655.409) (-662.235) (-660.994) * (-660.587) (-648.245) (-655.281) [-656.874] -- 0:00:27
879000 -- (-651.797) (-656.094) [-651.775] (-655.925) * (-650.728) (-653.129) (-652.072) [-647.084] -- 0:00:27
880000 -- (-660.834) (-654.652) [-647.655] (-650.107) * (-655.440) (-653.048) (-653.002) [-648.276] -- 0:00:27
Average standard deviation of split frequencies: 0.007617
881000 -- (-649.368) [-651.461] (-646.464) (-654.358) * [-648.546] (-649.174) (-646.879) (-651.802) -- 0:00:26
882000 -- (-657.694) (-656.382) (-656.154) [-645.616] * [-651.530] (-664.495) (-652.868) (-656.914) -- 0:00:26
883000 -- (-647.949) (-662.005) [-649.710] (-660.668) * (-651.140) (-661.545) (-652.224) [-647.779] -- 0:00:26
884000 -- (-665.266) (-660.397) [-653.948] (-654.502) * (-645.234) (-663.452) (-654.810) [-651.211] -- 0:00:26
885000 -- (-653.317) (-653.043) (-656.351) [-656.702] * [-661.390] (-651.579) (-656.276) (-652.249) -- 0:00:25
Average standard deviation of split frequencies: 0.007899
886000 -- (-655.119) [-652.143] (-659.302) (-651.675) * (-667.988) (-650.860) (-653.003) [-649.390] -- 0:00:25
887000 -- (-649.663) [-649.139] (-648.147) (-654.469) * (-651.142) [-652.379] (-652.533) (-650.191) -- 0:00:25
888000 -- (-650.802) [-645.626] (-651.313) (-653.999) * (-660.039) [-651.769] (-656.645) (-653.380) -- 0:00:25
889000 -- (-656.007) (-659.745) [-657.616] (-666.692) * (-656.667) [-648.415] (-653.383) (-650.046) -- 0:00:24
890000 -- (-659.065) (-656.391) [-654.954] (-656.678) * (-659.455) (-650.727) [-652.788] (-663.933) -- 0:00:24
Average standard deviation of split frequencies: 0.007613
891000 -- (-653.621) [-648.441] (-651.833) (-658.127) * (-652.047) [-655.951] (-649.096) (-657.041) -- 0:00:24
892000 -- [-650.483] (-652.624) (-648.125) (-656.069) * (-653.449) [-651.746] (-649.998) (-652.197) -- 0:00:24
893000 -- (-658.901) (-654.978) [-651.880] (-651.754) * [-648.618] (-666.826) (-651.257) (-659.376) -- 0:00:24
894000 -- (-659.602) (-654.318) [-645.143] (-662.794) * (-656.499) (-665.216) (-651.481) [-652.719] -- 0:00:23
895000 -- (-654.152) (-652.109) (-656.654) [-649.992] * (-653.365) (-660.721) [-652.000] (-655.474) -- 0:00:23
Average standard deviation of split frequencies: 0.007204
896000 -- [-649.373] (-651.489) (-669.524) (-651.667) * (-650.669) [-656.335] (-652.689) (-651.823) -- 0:00:23
897000 -- [-654.998] (-664.729) (-656.348) (-652.150) * (-648.644) (-657.569) [-651.263] (-660.728) -- 0:00:23
898000 -- (-664.194) (-654.474) (-657.954) [-651.725] * (-658.569) (-658.794) [-648.488] (-662.711) -- 0:00:22
899000 -- (-657.571) (-651.340) (-658.097) [-650.409] * (-655.313) (-655.430) [-648.896] (-653.576) -- 0:00:22
900000 -- (-660.176) (-652.916) [-652.017] (-652.243) * (-646.787) [-647.495] (-660.855) (-652.673) -- 0:00:22
Average standard deviation of split frequencies: 0.007287
901000 -- (-660.676) [-652.680] (-649.274) (-654.784) * (-648.005) (-660.225) [-650.748] (-658.118) -- 0:00:22
902000 -- (-662.114) (-660.021) (-647.692) [-654.499] * (-655.356) (-650.530) [-661.036] (-658.655) -- 0:00:22
903000 -- (-666.052) (-652.080) [-651.219] (-659.955) * (-660.404) (-663.595) (-666.823) [-654.110] -- 0:00:21
904000 -- (-672.945) (-655.006) (-663.133) [-647.454] * (-653.338) (-655.290) (-660.208) [-655.509] -- 0:00:21
905000 -- (-665.805) (-655.731) (-649.756) [-649.215] * (-651.062) [-650.312] (-653.755) (-653.404) -- 0:00:21
Average standard deviation of split frequencies: 0.007024
906000 -- (-659.997) (-652.847) [-646.795] (-648.378) * (-656.968) [-649.910] (-658.017) (-651.549) -- 0:00:21
907000 -- (-658.794) (-664.404) (-650.938) [-648.404] * [-653.653] (-658.283) (-652.467) (-656.633) -- 0:00:20
908000 -- (-653.374) [-652.382] (-649.023) (-660.832) * (-658.137) [-650.188] (-651.629) (-649.521) -- 0:00:20
909000 -- (-649.132) [-648.188] (-647.206) (-656.700) * (-653.384) (-647.015) [-650.970] (-659.202) -- 0:00:20
910000 -- (-652.920) [-650.075] (-652.231) (-647.710) * (-652.870) (-650.686) (-661.029) [-648.415] -- 0:00:20
Average standard deviation of split frequencies: 0.007008
911000 -- (-659.237) (-667.885) (-652.464) [-654.444] * (-656.386) (-647.354) [-650.211] (-655.661) -- 0:00:20
912000 -- (-652.838) (-653.902) [-647.055] (-656.409) * (-649.933) (-652.510) [-652.074] (-652.845) -- 0:00:19
913000 -- [-644.591] (-646.232) (-653.331) (-654.111) * (-654.235) [-654.131] (-650.639) (-655.313) -- 0:00:19
914000 -- (-656.257) [-655.152] (-654.864) (-643.621) * (-650.174) [-647.708] (-652.120) (-653.151) -- 0:00:19
915000 -- (-656.290) (-654.618) (-659.084) [-655.909] * [-645.509] (-651.845) (-657.143) (-649.879) -- 0:00:19
Average standard deviation of split frequencies: 0.007324
916000 -- (-653.805) [-654.423] (-656.341) (-645.687) * (-652.834) (-657.011) (-650.142) [-649.633] -- 0:00:18
917000 -- (-658.042) (-649.264) (-652.493) [-648.247] * [-650.382] (-659.058) (-652.442) (-653.973) -- 0:00:18
918000 -- (-653.025) [-648.321] (-658.763) (-651.679) * (-658.646) [-653.921] (-656.206) (-662.771) -- 0:00:18
919000 -- (-658.032) [-655.176] (-662.402) (-651.752) * (-658.029) [-652.029] (-655.188) (-657.183) -- 0:00:18
920000 -- (-648.062) [-648.074] (-657.898) (-649.180) * (-662.997) [-653.056] (-657.109) (-656.347) -- 0:00:18
Average standard deviation of split frequencies: 0.007168
921000 -- (-656.980) (-652.099) [-657.250] (-658.744) * (-662.081) (-652.382) [-651.686] (-650.986) -- 0:00:17
922000 -- (-657.273) [-649.442] (-650.717) (-647.805) * (-660.249) (-654.578) [-653.727] (-651.874) -- 0:00:17
923000 -- (-655.124) (-657.049) (-658.752) [-650.500] * (-657.039) (-653.882) (-647.479) [-650.815] -- 0:00:17
924000 -- [-646.749] (-656.574) (-655.913) (-668.152) * (-658.195) (-652.744) (-645.863) [-649.756] -- 0:00:17
925000 -- [-652.143] (-652.774) (-658.049) (-658.344) * [-647.629] (-652.095) (-651.610) (-667.449) -- 0:00:16
Average standard deviation of split frequencies: 0.007323
926000 -- (-659.107) [-647.225] (-664.864) (-654.560) * [-648.075] (-663.255) (-653.118) (-653.545) -- 0:00:16
927000 -- (-648.742) [-648.013] (-654.710) (-655.486) * (-650.636) (-663.555) [-647.997] (-664.364) -- 0:00:16
928000 -- (-651.675) (-659.389) [-654.522] (-658.268) * (-649.413) [-647.279] (-654.827) (-657.631) -- 0:00:16
929000 -- (-657.291) [-652.172] (-654.966) (-654.562) * (-662.628) [-650.120] (-658.596) (-652.572) -- 0:00:15
930000 -- (-655.819) (-653.299) [-656.159] (-648.974) * [-647.076] (-652.003) (-665.090) (-655.902) -- 0:00:15
Average standard deviation of split frequencies: 0.007019
931000 -- (-658.252) (-649.895) (-654.337) [-647.747] * (-657.306) (-652.950) [-648.678] (-648.663) -- 0:00:15
932000 -- [-653.102] (-654.057) (-662.618) (-650.072) * (-660.924) (-658.185) [-653.045] (-655.291) -- 0:00:15
933000 -- [-654.433] (-647.487) (-659.900) (-651.631) * (-656.620) (-655.623) (-657.473) [-653.226] -- 0:00:15
934000 -- (-653.278) (-660.674) (-665.143) [-651.500] * (-654.594) (-652.233) (-656.682) [-652.966] -- 0:00:14
935000 -- (-649.901) (-654.783) (-658.767) [-658.694] * (-655.688) (-651.570) [-657.007] (-653.561) -- 0:00:14
Average standard deviation of split frequencies: 0.006835
936000 -- (-659.851) (-668.730) [-653.503] (-653.958) * (-662.261) (-658.228) (-663.669) [-653.382] -- 0:00:14
937000 -- [-653.066] (-656.157) (-653.359) (-658.984) * (-662.513) [-655.581] (-661.792) (-656.074) -- 0:00:14
938000 -- (-654.828) (-649.236) [-653.385] (-653.184) * (-656.396) (-648.212) [-651.457] (-652.110) -- 0:00:13
939000 -- (-648.786) [-660.844] (-650.523) (-654.220) * (-659.395) (-648.741) [-650.081] (-664.795) -- 0:00:13
940000 -- [-649.179] (-662.256) (-660.996) (-653.858) * (-664.601) (-653.495) [-653.728] (-662.007) -- 0:00:13
Average standard deviation of split frequencies: 0.006980
941000 -- (-650.615) (-652.909) (-656.736) [-652.836] * (-657.071) [-644.725] (-659.416) (-653.791) -- 0:00:13
942000 -- [-651.728] (-648.329) (-652.629) (-656.772) * [-658.678] (-651.727) (-669.977) (-659.069) -- 0:00:13
943000 -- (-659.136) (-651.190) (-655.453) [-653.755] * [-646.189] (-648.563) (-658.651) (-659.135) -- 0:00:12
944000 -- [-651.092] (-650.074) (-653.324) (-652.817) * (-647.230) [-654.595] (-660.731) (-649.775) -- 0:00:12
945000 -- (-651.550) [-647.747] (-654.944) (-649.303) * (-648.458) [-654.568] (-652.232) (-667.661) -- 0:00:12
Average standard deviation of split frequencies: 0.006976
946000 -- (-655.951) (-650.516) [-649.657] (-657.977) * (-653.921) [-651.672] (-649.118) (-656.033) -- 0:00:12
947000 -- (-652.375) (-652.792) [-652.338] (-651.327) * (-647.925) (-651.338) [-656.291] (-661.912) -- 0:00:11
948000 -- (-646.383) [-649.636] (-655.552) (-653.750) * (-660.918) (-653.607) [-658.981] (-649.014) -- 0:00:11
949000 -- (-649.323) (-650.488) (-649.837) [-650.750] * [-648.150] (-651.780) (-650.814) (-649.848) -- 0:00:11
950000 -- (-668.992) (-660.317) [-648.875] (-654.460) * (-650.667) (-656.518) [-649.692] (-652.447) -- 0:00:11
Average standard deviation of split frequencies: 0.006980
951000 -- [-650.567] (-650.299) (-656.714) (-661.252) * [-656.442] (-657.435) (-661.160) (-649.700) -- 0:00:11
952000 -- (-658.310) (-652.681) (-653.968) [-663.336] * [-651.421] (-661.554) (-650.831) (-659.205) -- 0:00:10
953000 -- (-649.881) (-651.398) [-648.160] (-654.013) * (-655.728) [-650.351] (-649.218) (-652.294) -- 0:00:10
954000 -- (-646.572) (-654.141) [-650.811] (-655.876) * (-660.058) (-656.924) (-649.901) [-654.739] -- 0:00:10
955000 -- (-659.739) (-655.155) (-660.677) [-653.942] * (-651.309) [-649.930] (-651.774) (-651.585) -- 0:00:10
Average standard deviation of split frequencies: 0.006752
956000 -- (-653.150) [-645.232] (-655.232) (-659.724) * [-647.717] (-662.853) (-655.671) (-650.736) -- 0:00:09
957000 -- [-653.594] (-659.804) (-656.177) (-653.694) * (-649.122) [-648.955] (-664.327) (-652.142) -- 0:00:09
958000 -- (-655.250) (-650.914) (-650.444) [-653.617] * (-653.708) [-652.267] (-653.595) (-655.155) -- 0:00:09
959000 -- (-649.702) [-646.883] (-651.155) (-651.349) * [-649.787] (-649.966) (-658.946) (-650.788) -- 0:00:09
960000 -- (-662.817) [-651.626] (-657.484) (-655.188) * (-657.617) (-653.448) (-655.385) [-647.106] -- 0:00:09
Average standard deviation of split frequencies: 0.006414
961000 -- (-650.313) (-650.796) [-647.439] (-654.053) * (-649.985) [-648.444] (-654.548) (-658.863) -- 0:00:08
962000 -- (-653.228) (-656.236) (-649.517) [-649.317] * [-661.166] (-647.964) (-651.674) (-655.372) -- 0:00:08
963000 -- (-662.870) [-652.240] (-649.577) (-655.441) * (-658.921) (-656.690) [-651.219] (-658.716) -- 0:00:08
964000 -- (-658.534) [-654.328] (-658.896) (-654.220) * (-655.094) (-651.175) [-650.538] (-652.170) -- 0:00:08
965000 -- (-663.629) (-666.391) (-651.825) [-647.887] * (-657.715) [-662.051] (-666.244) (-667.739) -- 0:00:07
Average standard deviation of split frequencies: 0.006588
966000 -- (-662.203) (-650.885) [-650.999] (-662.498) * (-658.045) (-656.167) [-653.184] (-661.882) -- 0:00:07
967000 -- (-650.132) [-651.244] (-659.396) (-651.749) * [-657.120] (-660.945) (-654.589) (-655.475) -- 0:00:07
968000 -- [-652.934] (-654.856) (-655.700) (-653.697) * (-662.146) [-648.132] (-644.227) (-661.245) -- 0:00:07
969000 -- [-650.927] (-650.419) (-656.311) (-652.855) * (-659.437) (-658.962) [-654.813] (-653.587) -- 0:00:06
970000 -- (-660.010) [-645.301] (-654.267) (-655.587) * (-656.568) (-657.032) (-649.889) [-651.138] -- 0:00:06
Average standard deviation of split frequencies: 0.006626
971000 -- (-651.975) (-650.120) [-649.197] (-654.147) * (-671.585) (-649.995) [-651.078] (-650.553) -- 0:00:06
972000 -- (-654.288) (-646.940) (-652.913) [-648.996] * (-657.934) (-654.855) [-651.770] (-655.082) -- 0:00:06
973000 -- (-647.924) [-652.073] (-653.510) (-651.248) * (-648.923) (-653.088) (-652.219) [-649.644] -- 0:00:06
974000 -- (-674.842) [-654.620] (-654.693) (-656.067) * (-652.909) (-659.759) (-656.444) [-651.708] -- 0:00:05
975000 -- (-652.040) (-658.831) (-659.659) [-650.868] * [-662.741] (-650.167) (-652.596) (-654.028) -- 0:00:05
Average standard deviation of split frequencies: 0.006658
976000 -- (-651.599) [-650.645] (-664.065) (-651.582) * [-657.520] (-658.915) (-659.183) (-658.612) -- 0:00:05
977000 -- (-651.767) [-653.304] (-658.202) (-651.139) * [-652.699] (-655.872) (-661.969) (-646.494) -- 0:00:05
978000 -- (-654.804) [-651.948] (-657.324) (-657.683) * (-658.220) [-652.731] (-648.072) (-650.893) -- 0:00:04
979000 -- (-652.552) (-647.291) (-651.323) [-649.599] * (-655.626) (-657.748) (-663.588) [-651.576] -- 0:00:04
980000 -- (-654.317) [-646.518] (-656.599) (-649.891) * (-654.031) (-659.991) (-650.687) [-651.447] -- 0:00:04
Average standard deviation of split frequencies: 0.006627
981000 -- (-650.846) [-651.561] (-649.548) (-654.457) * (-660.833) (-654.368) [-650.694] (-651.318) -- 0:00:04
982000 -- (-649.372) (-659.117) [-651.051] (-652.264) * [-648.085] (-660.222) (-652.123) (-650.913) -- 0:00:04
983000 -- (-653.961) (-650.572) (-658.879) [-651.112] * (-658.608) [-655.233] (-657.937) (-658.497) -- 0:00:03
984000 -- (-655.060) (-657.365) [-653.417] (-652.990) * (-657.275) (-663.016) (-651.024) [-648.444] -- 0:00:03
985000 -- (-655.885) (-650.515) (-648.899) [-651.627] * (-643.327) (-656.113) (-650.445) [-649.096] -- 0:00:03
Average standard deviation of split frequencies: 0.006557
986000 -- (-654.414) [-652.118] (-658.337) (-652.215) * (-649.111) [-649.503] (-660.596) (-651.811) -- 0:00:03
987000 -- (-654.433) (-647.971) [-652.607] (-659.303) * (-650.863) [-652.319] (-653.294) (-655.666) -- 0:00:02
988000 -- (-651.472) [-648.822] (-650.330) (-658.394) * [-649.862] (-651.080) (-657.250) (-648.604) -- 0:00:02
989000 -- (-651.150) (-651.078) (-652.006) [-653.825] * (-662.098) (-648.798) [-647.919] (-657.554) -- 0:00:02
990000 -- [-649.162] (-660.519) (-651.319) (-662.732) * (-652.042) (-654.359) (-651.282) [-655.651] -- 0:00:02
Average standard deviation of split frequencies: 0.006866
991000 -- (-649.486) [-649.460] (-650.064) (-652.189) * [-647.367] (-653.379) (-652.890) (-651.659) -- 0:00:02
992000 -- [-654.054] (-650.002) (-654.274) (-663.073) * (-657.099) [-652.020] (-657.814) (-654.548) -- 0:00:01
993000 -- (-657.269) [-649.830] (-664.647) (-659.955) * (-653.305) (-663.037) [-657.181] (-654.980) -- 0:00:01
994000 -- (-651.454) (-653.698) (-655.437) [-660.990] * [-654.118] (-662.757) (-646.286) (-656.182) -- 0:00:01
995000 -- (-653.869) (-654.407) (-653.558) [-650.161] * [-645.646] (-652.389) (-652.839) (-653.757) -- 0:00:01
Average standard deviation of split frequencies: 0.006761
996000 -- (-654.125) (-647.595) (-654.604) [-659.483] * [-654.517] (-668.192) (-652.240) (-656.941) -- 0:00:00
997000 -- (-656.241) (-649.194) [-655.824] (-648.447) * (-651.352) [-657.162] (-650.814) (-655.574) -- 0:00:00
998000 -- (-661.110) [-648.954] (-647.864) (-654.006) * (-654.915) (-650.560) [-659.894] (-649.844) -- 0:00:00
999000 -- (-661.801) [-650.060] (-649.050) (-653.935) * (-654.103) (-654.712) [-652.993] (-652.009) -- 0:00:00
1000000 -- (-659.194) (-664.454) [-658.199] (-657.121) * (-659.012) (-653.871) [-649.242] (-666.624) -- 0:00:00
Average standard deviation of split frequencies: 0.006764
Analysis completed in 3 mins 45 seconds
Analysis used 224.28 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -641.15
Likelihood of best state for "cold" chain of run 2 was -641.34
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
68.4 % ( 66 %) Dirichlet(Revmat{all})
85.1 % ( 75 %) Slider(Revmat{all})
36.3 % ( 31 %) Dirichlet(Pi{all})
37.0 % ( 25 %) Slider(Pi{all})
79.1 % ( 47 %) Multiplier(Alpha{1,2})
74.3 % ( 53 %) Multiplier(Alpha{3})
80.4 % ( 52 %) Slider(Pinvar{all})
57.0 % ( 52 %) ExtSPR(Tau{all},V{all})
59.9 % ( 64 %) ExtTBR(Tau{all},V{all})
67.4 % ( 64 %) NNI(Tau{all},V{all})
51.1 % ( 49 %) ParsSPR(Tau{all},V{all})
27.4 % ( 26 %) Multiplier(V{all})
67.8 % ( 64 %) Nodeslider(V{all})
27.3 % ( 16 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
68.9 % ( 63 %) Dirichlet(Revmat{all})
85.4 % ( 83 %) Slider(Revmat{all})
36.5 % ( 27 %) Dirichlet(Pi{all})
36.9 % ( 16 %) Slider(Pi{all})
79.8 % ( 63 %) Multiplier(Alpha{1,2})
74.8 % ( 47 %) Multiplier(Alpha{3})
80.6 % ( 57 %) Slider(Pinvar{all})
57.4 % ( 58 %) ExtSPR(Tau{all},V{all})
59.8 % ( 61 %) ExtTBR(Tau{all},V{all})
67.3 % ( 71 %) NNI(Tau{all},V{all})
51.3 % ( 45 %) ParsSPR(Tau{all},V{all})
27.3 % ( 26 %) Multiplier(V{all})
67.8 % ( 76 %) Nodeslider(V{all})
27.9 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.71 0.48 0.30
2 | 166518 0.73 0.51
3 | 166967 166326 0.74
4 | 166569 166904 166716
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.71 0.48 0.30
2 | 165949 0.73 0.50
3 | 166145 166919 0.74
4 | 167600 166648 166739
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -650.11
| 1 1 |
| 2 |
| 1 2 |
|2 12 1 22 21 2 1 1 1 2 1 1 1 |
| 1 * 2 2 1 |
| 11 2 12 2 21 1 2 2 12 |
| 2 112 1 1 1 2 1 1 2 1*212 |
| 2 1 2 2 121 2 11 2 2 22|
| 1 2 1 21 2 2 1 1 |
| 1 2 2 2 2 1 2 2 2 2 |
|1 2 2 2 2 12 2 * 2 |
| 2 1 2 1 1 2 1|
| 1 1 1 1 1 1 |
| 1 1 |
| 1 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -653.97
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -647.82 -660.96
2 -647.93 -665.33
--------------------------------------
TOTAL -647.87 -664.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.094619 0.000665 0.050248 0.148044 0.091328 1421.47 1441.77 1.000
r(A<->C){all} 0.105840 0.003778 0.008375 0.228855 0.094510 316.81 425.09 1.000
r(A<->G){all} 0.172186 0.006908 0.032141 0.335241 0.159813 318.51 361.90 1.000
r(A<->T){all} 0.080640 0.002776 0.001671 0.178999 0.071481 327.85 469.68 1.001
r(C<->G){all} 0.039367 0.001549 0.000008 0.119285 0.027322 349.85 497.00 1.001
r(C<->T){all} 0.505276 0.010267 0.310899 0.698400 0.505749 446.42 470.40 1.000
r(G<->T){all} 0.096691 0.003135 0.005646 0.203415 0.087039 462.70 479.18 1.002
pi(A){all} 0.241701 0.000468 0.199043 0.283782 0.241689 1119.63 1226.01 1.000
pi(C){all} 0.250569 0.000503 0.208812 0.296062 0.249816 1173.45 1223.01 1.001
pi(G){all} 0.192929 0.000398 0.155918 0.233177 0.192453 1288.05 1294.35 1.000
pi(T){all} 0.314801 0.000550 0.271634 0.361426 0.313900 1199.69 1217.12 1.000
alpha{1,2} 0.600158 0.564324 0.000015 2.072402 0.337430 1044.67 1169.53 1.000
alpha{3} 1.197001 1.047704 0.000705 3.243417 0.934710 925.73 1004.67 1.000
pinvar{all} 0.572390 0.037415 0.169863 0.876821 0.605757 745.32 758.27 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
---------------
1 -- .********
2 -- .*.......
3 -- ..*......
4 -- ...*.....
5 -- ....*....
6 -- .....*...
7 -- ......*..
8 -- .......*.
9 -- ........*
10 -- ...*..*..
11 -- .******.*
12 -- .*.****.*
13 -- .*.******
14 -- ..*******
15 -- ..*....*.
16 -- .....*..*
17 -- ...*.**..
18 -- ...****.*
19 -- ...**.*..
20 -- ....*...*
21 -- ....**...
22 -- ...*..*.*
23 -- ...******
---------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
10 2899 0.965690 0.003298 0.963358 0.968021 2
11 1055 0.351432 0.003298 0.349101 0.353764 2
12 1015 0.338108 0.006124 0.333777 0.342438 2
13 764 0.254497 0.013191 0.245170 0.263824 2
14 512 0.170553 0.005653 0.166556 0.174550 2
15 421 0.140240 0.005182 0.136576 0.143904 2
16 390 0.129913 0.008480 0.123917 0.135909 2
17 380 0.126582 0.000000 0.126582 0.126582 2
18 375 0.124917 0.004240 0.121919 0.127915 2
19 365 0.121586 0.001413 0.120586 0.122585 2
20 353 0.117588 0.010835 0.109927 0.125250 2
21 349 0.116256 0.021199 0.101266 0.131246 2
22 349 0.116256 0.007066 0.111259 0.121252 2
23 294 0.097935 0.004711 0.094604 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.015670 0.000064 0.003274 0.030893 0.014304 1.000 2
length{all}[2] 0.011390 0.000038 0.001499 0.023244 0.010223 1.000 2
length{all}[3] 0.020761 0.000081 0.006531 0.038920 0.019344 1.001 2
length{all}[4] 0.002118 0.000005 0.000000 0.006335 0.001448 1.000 2
length{all}[5] 0.002110 0.000005 0.000002 0.006368 0.001459 1.000 2
length{all}[6] 0.002093 0.000005 0.000001 0.006255 0.001455 1.000 2
length{all}[7] 0.002165 0.000005 0.000000 0.006306 0.001428 1.000 2
length{all}[8] 0.017391 0.000071 0.003780 0.033645 0.015890 1.000 2
length{all}[9] 0.002068 0.000005 0.000000 0.006727 0.001319 1.000 2
length{all}[10] 0.004223 0.000010 0.000052 0.010255 0.003422 1.000 2
length{all}[11] 0.005600 0.000022 0.000001 0.014513 0.004347 0.999 2
length{all}[12] 0.004683 0.000014 0.000059 0.011793 0.003707 0.999 2
length{all}[13] 0.004831 0.000018 0.000031 0.013374 0.003695 1.000 2
length{all}[14] 0.005614 0.000020 0.000012 0.013944 0.004342 0.998 2
length{all}[15] 0.003957 0.000014 0.000008 0.011165 0.003078 0.998 2
length{all}[16] 0.002164 0.000005 0.000002 0.006372 0.001429 1.001 2
length{all}[17] 0.002092 0.000004 0.000006 0.006275 0.001392 0.998 2
length{all}[18] 0.003143 0.000011 0.000014 0.008877 0.002373 0.998 2
length{all}[19] 0.001765 0.000003 0.000003 0.005469 0.001210 1.000 2
length{all}[20] 0.002118 0.000005 0.000004 0.006379 0.001433 1.000 2
length{all}[21] 0.002101 0.000004 0.000010 0.005711 0.001609 1.007 2
length{all}[22] 0.002076 0.000004 0.000004 0.005661 0.001496 0.997 2
length{all}[23] 0.004110 0.000013 0.000011 0.010394 0.003103 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006764
Maximum standard deviation of split frequencies = 0.021199
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
|
|------------------------------------------------------------------------ C5 (5)
|
+------------------------------------------------------------------------ C6 (6)
|
|------------------------------------------------------------------------ C8 (8)
|
|------------------------------------------------------------------------ C9 (9)
|
| /------------------------------------ C4 (4)
\-----------------97----------------+
\------------------------------------ C7 (7)
Phylogram (based on average branch lengths):
/----------------------------------------------------- C1 (1)
|
|-------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
|
|----- C5 (5)
|
+----- C6 (6)
|
|----------------------------------------------------------- C8 (8)
|
|----- C9 (9)
|
| /----- C4 (4)
\------------+
\----- C7 (7)
|-----------------| 0.005 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1869 trees sampled):
50 % credible set contains 459 trees
90 % credible set contains 1569 trees
95 % credible set contains 1719 trees
99 % credible set contains 1839 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Tue Oct 25 21:14:53 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=9, Len=121
C1 ------------------MMRVQRPPTLLLLLLVANAFSKPIGTPIPEHC
C2 ------------------MMRVQRPPTLLLILLVANAFSKPIGTSIPEHC
C3 MMSMRSRRSMFIEHFNELMMRVQRPPTLFLILLVANAFSKPIGTPIPEHC
C4 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C6 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C7 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C8 -------------------MRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C9 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
*********:*:*************.:****
C1 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C2 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C3 STLAGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C4 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C6 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C7 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C8 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C9 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
***.**********************************************
C1 SYDTSDPQLLSDIGYSFDYGK
C2 SYDTSDPQLLSDIGYSFDYGK
C3 SYDTSDPQQLSDIGYSFDYGK
C4 SYDTSDPQLLSDIGYSFDYGK
C5 SYDTSDPQLLSDIGYSFDYGK
C6 SYDTSDPQLLSDIGYSFDYGK
C7 SYDTSDPQLLSDIGYSFDYGK
C8 SYDNSDPQSLSDIGYSFDYGK
C9 SYDTSDPQLLSDIGYSFDYGK
***.**** ************
-- Starting log on Tue Oct 25 21:56:15 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/codeml,TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 363 sites
reading seq# 2 C2 363 sites
reading seq# 3 C3 363 sites
reading seq# 4 C4 363 sites
reading seq# 5 C5 363 sites
reading seq# 6 C6 363 sites
reading seq# 7 C7 363 sites
reading seq# 8 C8 363 sites
reading seq# 9 C9 363 sitesns = 9 ls = 363
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Sites with gaps or missing data are removed.
54 ambiguity characters in seq. 1
54 ambiguity characters in seq. 2
57 ambiguity characters in seq. 8
19 sites are removed. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 102 / 102 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 102 / 102 sites (100.0%), 0:00
Counting codons..
288 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 5, 6, 8, 9, (4, 7)); MP score: 25
0.017545 0.108163 0.027250 0.036210 0.012286 0.026663 0.088322 0.011979 0.074204 0.043297 0.300000 0.571264 0.262810
ntime & nrate & np: 10 2 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.860845
np = 13
lnL0 = -621.962630
Iterating by ming2
Initial: fx= 621.962630
x= 0.01754 0.10816 0.02725 0.03621 0.01229 0.02666 0.08832 0.01198 0.07420 0.04330 0.30000 0.57126 0.26281
1 h-m-p 0.0000 0.0001 480.9792 ++ 604.279662 m 0.0001 18 | 1/13
2 h-m-p 0.0000 0.0002 244.9736 ++ 593.688264 m 0.0002 34 | 2/13
3 h-m-p 0.0000 0.0000 4604.9763 ++ 591.260378 m 0.0000 50 | 3/13
4 h-m-p 0.0000 0.0000 59243.0286 ++ 583.827071 m 0.0000 66 | 4/13
5 h-m-p 0.0000 0.0000 536.3216 ++ 582.178563 m 0.0000 82 | 5/13
6 h-m-p 0.0001 0.0091 60.1841 ++++ 567.429062 m 0.0091 100 | 6/13
7 h-m-p 0.0003 0.0015 175.3360 CCCCC 566.049812 4 0.0004 124 | 6/13
8 h-m-p 0.0048 0.0241 8.7630 +YCYCCC 561.865597 5 0.0146 149 | 5/13
9 h-m-p 0.0000 0.0002 352.0029 YCYCCC 560.596462 5 0.0001 173 | 5/13
10 h-m-p 0.0055 0.0275 1.7999 ++ 560.307605 m 0.0275 189 | 5/13
11 h-m-p 0.0089 0.0445 2.3130 CCCCC 560.027704 4 0.0150 213 | 5/13
12 h-m-p 0.1171 1.1377 0.2959 +CCYCC 556.143537 4 0.8037 238 | 5/13
13 h-m-p 0.3242 1.6211 0.2236 +YYYCCC 553.474561 5 1.2088 270 | 5/13
14 h-m-p 0.8424 4.7783 0.3208 CYCCC 552.251176 4 0.9823 301 | 5/13
15 h-m-p 0.4057 2.0287 0.2443 +YCYCCC 551.376232 5 1.1633 334 | 5/13
16 h-m-p 1.6000 8.0000 0.1686 YCCC 550.598047 3 3.1540 363 | 5/13
17 h-m-p 1.6000 8.0000 0.1498 YCCCC 550.037128 4 3.2700 394 | 5/13
18 h-m-p 1.6000 8.0000 0.1606 CCCC 549.630177 3 2.3567 424 | 5/13
19 h-m-p 0.9375 4.6876 0.1883 CCCC 549.392675 3 1.4311 454 | 5/13
20 h-m-p 1.6000 8.0000 0.1622 CCC 549.207660 2 2.3633 482 | 5/13
21 h-m-p 1.6000 8.0000 0.1351 YCCC 549.148151 3 3.0769 511 | 5/13
22 h-m-p 1.6000 8.0000 0.0922 CC 549.129591 1 1.9854 537 | 5/13
23 h-m-p 1.6000 8.0000 0.0172 C 549.124420 0 1.5389 561 | 5/13
24 h-m-p 1.2277 8.0000 0.0215 CC 549.123393 1 1.6554 587 | 5/13
25 h-m-p 1.6000 8.0000 0.0145 CC 549.122961 1 2.4316 613 | 5/13
26 h-m-p 1.6000 8.0000 0.0008 C 549.122921 0 1.3264 637 | 5/13
27 h-m-p 1.5545 8.0000 0.0007 Y 549.122912 0 2.9900 661 | 5/13
28 h-m-p 1.6000 8.0000 0.0006 Y 549.122912 0 1.2008 685 | 5/13
29 h-m-p 1.6000 8.0000 0.0000 Y 549.122912 0 1.0074 709 | 5/13
30 h-m-p 1.6000 8.0000 0.0000 Y 549.122912 0 1.6000 733 | 5/13
31 h-m-p 1.6000 8.0000 0.0000 -C 549.122912 0 0.1000 758 | 5/13
32 h-m-p 1.6000 8.0000 0.0000 -C 549.122912 0 0.1000 783
Out..
lnL = -549.122912
784 lfun, 2352 eigenQcodon, 15680 P(t)
end of tree file.
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 5, 6, 8, 9, (4, 7)); MP score: 25
0.028986 0.027100 0.061506 0.058945 0.109081 0.018748 0.104552 0.104003 0.026721 0.097357 4.544908 1.132982 0.482734 0.142655 1.370238
ntime & nrate & np: 10 3 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.690422
np = 15
lnL0 = -605.810211
Iterating by ming2
Initial: fx= 605.810211
x= 0.02899 0.02710 0.06151 0.05895 0.10908 0.01875 0.10455 0.10400 0.02672 0.09736 4.54491 1.13298 0.48273 0.14265 1.37024
1 h-m-p 0.0000 0.0003 395.2294 +++ 584.001025 m 0.0003 21 | 1/15
2 h-m-p 0.0001 0.0003 235.8216 ++ 570.835071 m 0.0003 39 | 2/15
3 h-m-p 0.0000 0.0000 52927.5263 ++ 558.155880 m 0.0000 57 | 3/15
4 h-m-p 0.0000 0.0000 384.3229 ++ 556.810282 m 0.0000 75 | 4/15
5 h-m-p 0.0000 0.0000 307.9301 ++ 556.343341 m 0.0000 93 | 5/15
6 h-m-p 0.0001 0.0035 33.5080 ++YYCCC 555.992762 4 0.0011 119 | 5/15
7 h-m-p 0.0005 0.0025 37.1929 ++ 555.039416 m 0.0025 137 | 6/15
8 h-m-p 0.0044 0.0589 11.0650 +CYYCCC 553.368434 5 0.0349 165 | 6/15
9 h-m-p 0.0109 0.0543 13.2652 ++ 551.664017 m 0.0543 183 | 7/15
10 h-m-p 0.0137 0.0687 4.2139 YCCCC 551.180954 4 0.0299 208 | 6/15
11 h-m-p 0.0030 0.0151 14.8986 YCCC 551.095540 3 0.0017 231 | 6/15
12 h-m-p 0.1118 1.8205 0.2273 +CYCCCC 549.580081 5 0.7880 259 | 6/15
13 h-m-p 1.1631 8.0000 0.1540 YCCC 549.226288 3 2.7072 291 | 5/15
14 h-m-p 1.1496 7.5301 0.3627 CCCCC 549.029515 4 1.4161 326 | 5/15
15 h-m-p 0.6179 8.0000 0.8313 +YCCC 548.667438 3 1.8728 360 | 5/15
16 h-m-p 1.2140 8.0000 1.2824 YCCC 547.672298 3 2.3808 393 | 5/15
17 h-m-p 1.6000 8.0000 1.3607 CYCC 546.909463 3 1.9462 416 | 5/15
18 h-m-p 0.6924 3.4619 0.4652 CCCCC 546.671617 4 0.8864 442 | 5/15
19 h-m-p 0.3900 8.0000 1.0574 +CCCC 546.280049 3 2.5139 477 | 5/15
20 h-m-p 1.5397 8.0000 1.7265 +CCCC 545.573026 3 5.1991 502 | 5/15
21 h-m-p 1.6000 8.0000 3.2341 CCCC 545.331905 3 1.1535 526 | 5/15
22 h-m-p 1.1431 8.0000 3.2635 CCCC 545.242735 3 0.4611 550 | 5/15
23 h-m-p 0.8963 8.0000 1.6787 +YCCC 545.204990 3 2.6315 574 | 5/15
24 h-m-p 1.6000 8.0000 0.4591 CC 545.199582 1 1.9033 594 | 5/15
25 h-m-p 1.6000 8.0000 0.1769 CC 545.199348 1 1.3192 624 | 5/15
26 h-m-p 1.6000 8.0000 0.0951 C 545.199242 0 1.5165 652 | 5/15
27 h-m-p 1.6000 8.0000 0.0364 +YC 545.199044 1 5.2343 682 | 5/15
28 h-m-p 1.6000 8.0000 0.0044 C 545.199020 0 1.5684 710 | 5/15
29 h-m-p 0.5762 8.0000 0.0121 Y 545.199019 0 1.3687 738 | 5/15
30 h-m-p 1.6000 8.0000 0.0026 C 545.199019 0 1.8886 766 | 5/15
31 h-m-p 1.6000 8.0000 0.0002 ++ 545.199019 m 8.0000 794 | 5/15
32 h-m-p 0.9911 8.0000 0.0019 Y 545.199018 0 1.6223 822 | 5/15
33 h-m-p 1.6000 8.0000 0.0009 +Y 545.199018 0 4.3493 851 | 5/15
34 h-m-p 1.6000 8.0000 0.0010 ++ 545.199017 m 8.0000 879 | 5/15
35 h-m-p 0.2224 8.0000 0.0347 +Y 545.199012 0 2.0052 908 | 5/15
36 h-m-p 1.6000 8.0000 0.0269 ++ 545.198980 m 8.0000 936 | 5/15
37 h-m-p 0.2501 8.0000 0.8608 ++YC 545.198877 1 2.6663 967 | 5/15
38 h-m-p 1.6000 8.0000 0.2106 C 545.198862 0 1.2951 995 | 5/15
39 h-m-p 1.2828 8.0000 0.2127 +Y 545.198856 0 6.3245 1024 | 5/15
40 h-m-p 1.6000 8.0000 0.2816 C 545.198853 0 2.0998 1052 | 5/15
41 h-m-p 1.6000 8.0000 0.3181 Y 545.198852 0 3.7901 1080 | 5/15
42 h-m-p 1.6000 8.0000 0.3488 C 545.198852 0 1.9164 1108 | 5/15
43 h-m-p 1.6000 8.0000 0.3314 Y 545.198852 0 3.6411 1136 | 5/15
44 h-m-p 1.6000 8.0000 0.3505 C 545.198852 0 1.9694 1164 | 5/15
45 h-m-p 1.6000 8.0000 0.3357 Y 545.198852 0 3.4738 1192 | 5/15
46 h-m-p 1.6000 8.0000 0.3501 C 545.198852 0 2.0263 1220 | 5/15
47 h-m-p 1.6000 8.0000 0.3076 Y 545.198852 0 3.0807 1248 | 5/15
48 h-m-p 1.6000 8.0000 0.4204 Y 545.198852 0 2.7134 1276 | 5/15
49 h-m-p 1.6000 8.0000 0.1761 C 545.198852 0 1.5134 1304 | 5/15
50 h-m-p 1.3395 8.0000 0.1990 ++ 545.198852 m 8.0000 1332 | 5/15
51 h-m-p 0.4367 8.0000 3.6454 Y 545.198852 0 0.2514 1360 | 5/15
52 h-m-p 0.1415 8.0000 6.4782 C 545.198852 0 0.1415 1378 | 5/15
53 h-m-p 0.0021 0.1726 444.0565 ------------.. | 5/15
54 h-m-p 0.0160 8.0000 0.0012 ------------- | 5/15
55 h-m-p 0.0160 8.0000 0.0006 -------------
Out..
lnL = -545.198852
1475 lfun, 5900 eigenQcodon, 44250 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -554.084851 S = -526.546753 -50.615076
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:19
did 20 / 56 patterns 0:19
did 30 / 56 patterns 0:19
did 40 / 56 patterns 0:19
did 50 / 56 patterns 0:19
did 56 / 56 patterns 0:19end of tree file.
Time used: 0:19
Model 7: beta
TREE # 1
(1, 2, 3, 5, 6, 8, 9, (4, 7)); MP score: 25
0.080018 0.064959 0.043859 0.026504 0.105293 0.071358 0.034219 0.100641 0.027721 0.062229 6.580532 0.956808 1.966809
ntime & nrate & np: 10 1 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 3.882676
np = 13
lnL0 = -585.506747
Iterating by ming2
Initial: fx= 585.506747
x= 0.08002 0.06496 0.04386 0.02650 0.10529 0.07136 0.03422 0.10064 0.02772 0.06223 6.58053 0.95681 1.96681
1 h-m-p 0.0000 0.0003 250.8319 +++ 569.181260 m 0.0003 32 | 1/13
2 h-m-p 0.0000 0.0000 1035.1863 ++ 568.588703 m 0.0000 61 | 2/13
3 h-m-p 0.0000 0.0000 1378.9684 ++ 566.009794 m 0.0000 89 | 3/13
4 h-m-p 0.0001 0.0004 196.6653 +YCYYCCC 557.912884 6 0.0004 127 | 3/13
5 h-m-p 0.0000 0.0001 86.7259 ++ 556.861262 m 0.0001 153 | 4/13
6 h-m-p 0.0000 0.0000 3851.2980 ++ 552.822942 m 0.0000 179 | 5/13
7 h-m-p 0.0015 0.0127 9.2325 YYC 552.768558 2 0.0011 206 | 5/13
8 h-m-p 0.0016 0.1463 6.4213 ++CYCCC 551.951623 4 0.0468 239 | 5/13
9 h-m-p 0.0006 0.0030 232.7490 CYCYC 550.870444 4 0.0014 270 | 5/13
10 h-m-p 0.7233 5.6026 0.4439 CYCCC 550.320676 4 0.5684 301 | 5/13
11 h-m-p 0.3820 1.9100 0.5812 CYC 550.229482 2 0.1285 328 | 5/13
12 h-m-p 0.1996 3.7428 0.3742 +YCCCCC 550.043589 5 0.9770 362 | 5/13
13 h-m-p 0.8725 8.0000 0.4191 +YCCC 549.822099 3 2.5815 392 | 5/13
14 h-m-p 0.4898 2.4490 0.8880 CYCYC 549.681126 4 0.9814 423 | 5/13
15 h-m-p 0.3379 1.6894 1.0794 YCCCCC 549.588759 5 0.4951 456 | 5/13
16 h-m-p 0.2713 1.3563 0.6680 YCYCCC 549.480846 5 0.7479 488 | 5/13
17 h-m-p 0.5498 2.7492 0.8260 YYC 549.398175 2 0.4275 514 | 5/13
18 h-m-p 0.2363 1.5393 1.4947 CCC 549.354804 2 0.1987 542 | 5/13
19 h-m-p 0.5676 2.8378 0.1787 CCCC 549.330736 3 0.6634 572 | 5/13
20 h-m-p 0.8927 8.0000 0.1328 YCC 549.324573 2 0.3679 599 | 5/13
21 h-m-p 1.6000 8.0000 0.0110 CC 549.324053 1 1.3144 625 | 5/13
22 h-m-p 1.6000 8.0000 0.0047 C 549.323972 0 2.1436 649 | 5/13
23 h-m-p 1.4394 8.0000 0.0070 C 549.323937 0 1.8742 673 | 5/13
24 h-m-p 1.6000 8.0000 0.0006 Y 549.323936 0 1.0541 697 | 5/13
25 h-m-p 1.6000 8.0000 0.0001 Y 549.323936 0 1.0082 721 | 5/13
26 h-m-p 1.6000 8.0000 0.0000 Y 549.323936 0 0.8969 745 | 5/13
27 h-m-p 1.6000 8.0000 0.0000 +Y 549.323936 0 6.4000 770 | 5/13
28 h-m-p 1.2022 8.0000 0.0000 C 549.323936 0 0.3493 794 | 5/13
29 h-m-p 0.5549 8.0000 0.0000 --------Y 549.323936 0 0.0000 826
Out..
lnL = -549.323936
827 lfun, 9097 eigenQcodon, 82700 P(t)
end of tree file.
Time used: 0:45
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 5, 6, 8, 9, (4, 7)); MP score: 25
0.065633 0.056451 0.011750 0.104207 0.080512 0.096671 0.068715 0.071966 0.106791 0.044950 4.594509 0.900000 0.907084 1.600660 1.300000
ntime & nrate & np: 10 2 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.323539
np = 15
lnL0 = -606.197940
Iterating by ming2
Initial: fx= 606.197940
x= 0.06563 0.05645 0.01175 0.10421 0.08051 0.09667 0.06871 0.07197 0.10679 0.04495 4.59451 0.90000 0.90708 1.60066 1.30000
1 h-m-p 0.0000 0.0005 708.8624 +++ 582.315393 m 0.0005 36 | 1/15
2 h-m-p 0.0001 0.0003 196.0766 ++ 573.137383 m 0.0003 69 | 2/15
3 h-m-p 0.0000 0.0000 4422.4930 ++ 569.791752 m 0.0000 101 | 3/15
4 h-m-p 0.0000 0.0001 303.9825 ++ 565.457300 m 0.0001 132 | 4/15
5 h-m-p 0.0000 0.0000 229.9410 ++ 565.199372 m 0.0000 162 | 5/15
6 h-m-p 0.0001 0.0118 13.5012 ++YCCC 564.925111 3 0.0026 198 | 5/15
7 h-m-p 0.0007 0.0033 34.9191 +CYC 564.263914 2 0.0028 230 | 5/15
8 h-m-p 0.0001 0.0003 55.7903 ++ 564.112730 m 0.0003 258 | 5/15
9 h-m-p 0.0012 0.0593 14.5630 ++CYYYYCCCCC 560.620515 9 0.0406 302 | 5/15
10 h-m-p 0.0260 0.1300 3.8215 YCYCCC 559.720070 5 0.0636 338 | 5/15
11 h-m-p 0.0511 0.5287 4.7550 +YCC 558.376553 2 0.1355 370 | 5/15
12 h-m-p 0.4197 7.4756 1.5349 CCCC 557.220811 3 0.3987 404 | 5/15
13 h-m-p 0.6112 3.0561 0.4584 YCCCC 554.557944 4 1.5744 439 | 5/15
14 h-m-p 0.6718 3.3589 0.3981 +YYYYC 551.062256 4 2.5973 472 | 5/15
15 h-m-p 0.1685 0.8425 3.4885 YCCCCC 549.675522 5 0.3266 509 | 5/15
16 h-m-p 1.2735 6.3676 0.1570 CYCCCC 547.950775 5 2.7103 546 | 5/15
17 h-m-p 0.1024 0.5122 0.5007 CYCCC 547.891007 4 0.1480 581 | 5/15
18 h-m-p 0.3232 5.2695 0.2293 YCCC 547.816785 3 0.6372 614 | 5/15
19 h-m-p 1.1172 8.0000 0.1308 +CCC 547.708269 2 4.0980 647 | 5/15
20 h-m-p 0.7892 8.0000 0.6792 +YCCC 547.408873 3 2.4232 681 | 5/15
21 h-m-p 0.8160 4.0800 1.1568 CCCC 547.243993 3 0.9210 715 | 5/15
22 h-m-p 1.5614 8.0000 0.6824 YCCC 546.942354 3 2.5940 748 | 5/15
23 h-m-p 0.3524 1.7618 2.9425 YCYCCC 546.591500 5 0.7432 784 | 5/15
24 h-m-p 0.5173 8.0000 4.2276 +CYCCC 545.723048 4 2.4824 820 | 5/15
25 h-m-p 0.8146 4.0729 3.2997 CCCCC 545.527650 4 1.0529 856 | 5/15
26 h-m-p 1.2279 8.0000 2.8292 CCC 545.401912 2 1.4434 888 | 5/15
27 h-m-p 1.6000 8.0000 2.2741 CCC 545.330958 2 2.3738 920 | 5/15
28 h-m-p 1.6000 8.0000 1.0271 YC 545.320912 1 1.0825 949 | 5/15
29 h-m-p 1.3035 8.0000 0.8530 CCC 545.314951 2 1.6481 981 | 5/15
30 h-m-p 1.6000 8.0000 0.2382 +YC 545.311288 1 4.2052 1011 | 5/15
31 h-m-p 1.6000 8.0000 0.4089 YC 545.307317 1 3.3688 1040 | 5/15
32 h-m-p 1.6000 8.0000 0.2120 ++ 545.295656 m 8.0000 1068 | 5/15
33 h-m-p 1.6000 8.0000 0.1195 +YC 545.267810 1 5.1499 1098 | 5/15
34 h-m-p 1.6000 8.0000 0.2817 CYC 545.254556 2 2.0250 1129 | 5/15
35 h-m-p 1.5859 8.0000 0.3597 YC 545.244526 1 3.2624 1158 | 5/15
36 h-m-p 1.6000 8.0000 0.3276 C 545.242689 0 1.6000 1186 | 5/15
37 h-m-p 1.6000 8.0000 0.1525 YC 545.242653 1 1.0147 1215 | 5/15
38 h-m-p 1.6000 8.0000 0.0037 +Y 545.242642 0 5.3626 1244 | 5/15
39 h-m-p 1.6000 8.0000 0.0062 ++ 545.242581 m 8.0000 1272 | 5/15
40 h-m-p 0.7003 8.0000 0.0705 ++ 545.242300 m 8.0000 1300 | 5/15
41 h-m-p 1.6000 8.0000 0.2413 ++ 545.240657 m 8.0000 1328 | 5/15
42 h-m-p 1.2126 8.0000 1.5922 ++ 545.231865 m 8.0000 1356 | 5/15
43 h-m-p 1.6000 8.0000 6.9095 YCC 545.219995 2 3.3923 1387 | 5/15
44 h-m-p 1.0171 5.0853 7.3597 +CC 545.213677 1 3.5230 1418 | 5/15
45 h-m-p 0.1808 0.9038 12.7208 ++ 545.211348 m 0.9038 1446 | 6/15
46 h-m-p 0.4060 8.0000 3.7091 ---------------.. | 6/15
47 h-m-p 0.0000 0.0178 0.8345 C 545.211333 0 0.0000 1514 | 6/15
48 h-m-p 0.0001 0.0369 1.0420 +CC 545.211209 1 0.0004 1544 | 6/15
49 h-m-p 0.0004 0.1658 1.1145 C 545.211118 0 0.0004 1571 | 6/15
50 h-m-p 0.0160 8.0000 0.0634 C 545.211108 0 0.0054 1598 | 6/15
51 h-m-p 0.0160 8.0000 0.0805 -Y 545.211104 0 0.0020 1626 | 6/15
52 h-m-p 0.0160 8.0000 0.0434 -C 545.211103 0 0.0015 1654 | 6/15
53 h-m-p 0.0160 8.0000 0.0081 +++++ 545.210666 m 8.0000 1684 | 6/15
54 h-m-p 0.2130 8.0000 0.3032 +CC 545.209759 1 0.9632 1714 | 6/15
55 h-m-p 1.6000 8.0000 0.0022 ++ 545.209739 m 8.0000 1741 | 6/15
56 h-m-p 1.6000 8.0000 0.0110 Y 545.209733 0 1.1254 1768 | 6/15
57 h-m-p 1.6000 8.0000 0.0010 ++ 545.209726 m 8.0000 1795 | 6/15
58 h-m-p 0.1146 8.0000 0.0729 ++C 545.209671 0 1.9611 1824 | 6/15
59 h-m-p 1.6000 8.0000 0.0537 +YC 545.209570 1 4.6723 1853 | 6/15
60 h-m-p 1.6000 8.0000 0.0046 Y 545.209570 0 1.1577 1880 | 6/15
61 h-m-p 1.6000 8.0000 0.0008 --Y 545.209570 0 0.0250 1909 | 6/15
62 h-m-p 0.0260 8.0000 0.0008 Y 545.209570 0 0.0260 1936 | 6/15
63 h-m-p 0.0262 8.0000 0.0008 ---Y 545.209570 0 0.0002 1966
Out..
lnL = -545.209570
1967 lfun, 23604 eigenQcodon, 216370 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -553.329233 S = -526.547130 -69.573125
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 1:52
did 20 / 56 patterns 1:52
did 30 / 56 patterns 1:52
did 40 / 56 patterns 1:53
did 50 / 56 patterns 1:53
did 56 / 56 patterns 1:53end of tree file.
Time used: 1:53
The loglikelihoods for models M1, M2, M7 and M8 are -549.122912 -545.198852 -549.323936 -545.209570 respectively
The loglikelihood for model M2a is significantly different from that for M1a. Twice the difference is 7.848120
The loglikelihood for model M8 is significantly different from that for M7. Twice the difference is 8.228732
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------MMRVQRPPTLLLLLLVANAFSKPIGTPIPEHCSTLVGREFQS
BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------MMRVQRPPTLLLILLVANAFSKPIGTSIPEHCSTLVGREFQS
BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLFLILLVANAFSKPIGTPIPEHCSTLAGREFQS
HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHCSTLVGREFQS
TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHCSTLVGREFQS
TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHCSTLVGREFQS
LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHCSTLVGREFQS
YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 -------------------MRVQRPPTLLLILLVANAFSKPIGTPIPEHCSTLVGREFQS
TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHCSTLVGREFQS
*********:*:*************.:*******.******
BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 CIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYG
BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 CIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYG
BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 CIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQQLSDIGYSFDYG
HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 CIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYG
TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 CIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYG
TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 CIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYG
LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 CIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYG
YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 CIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDNSDPQSLSDIGYSFDYG
TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 CIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYG
*******************************************.**** ***********
BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 K
BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 K
BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 K
HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 K
TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 K
TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 K
LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 K
YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 K
TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 K
*
>BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------------------------------------------ATGATGCGTGTGCAAAGACCACCCACACTCCTGCTTCTCTTACTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATACCTGAACACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGATACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------------------------------------------ATGATGCGTGTGCAAAGACCACCCACACTTCTGCTCATATTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTTCTATACCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTTCTCATCTTACTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACCCCTATACCTGAGCACTGTTCTACCCTTGCTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACAGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGCAGTTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATGCCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATACCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATACCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATGCCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ---------------------------------------------------------ATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTACTAGTTGCTAATGCTTTTTCAAAGCCCATTGGCACTCCTATACCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTTATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGATACCTCTTACGACAATTCTGACCCTCAGTCTCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATACCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG
>BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------MMRVQRPPTLLLLLLVANAFSKPIGTPIPEHCSTLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYGK >BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------MMRVQRPPTLLLILLVANAFSKPIGTSIPEHCSTLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYGK >BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLFLILLVANAFSKPIGTPIPEHCSTLAGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQQLSDIGYSFDYGK >HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHCSTLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYGK >TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHCSTLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYGK >TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHCSTLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYGK >LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHCSTLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYGK >YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 -------------------MRVQRPPTLLLILLVANAFSKPIGTPIPEHCSTLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDNSDPQSLSDIGYSFDYGK >TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHCSTLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDTSYDTSDPQLLSDIGYSFDYGK
Reading sequence file /data//pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/codeml/fasta/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1
Found 9 sequences of length 363
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 1.9%
Found 5 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 1
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 14 polymorphic sites
**p-Value(s)**
----------
NSS: 1.65e-01 (1000 permutations)
Max Chi^2: 6.83e-01 (1000 permutations)
PHI (Permutation): 1.81e-01 (1000 permutations)
PHI (Normal): 5.44e-02
#NEXUS
[ID: 4997353928]
begin taxa;
dimensions ntax=9;
taxlabels
BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5
HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
;
end;
begin trees;
translate
1 BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
2 BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
3 BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
4 HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
5 TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
6 TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
7 LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
8 YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
9 TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.430354e-02,2:1.022255e-02,3:1.934356e-02,5:1.458703e-03,6:1.454980e-03,8:1.589036e-02,9:1.319323e-03,(4:1.447644e-03,7:1.428240e-03)0.966:3.421920e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.430354e-02,2:1.022255e-02,3:1.934356e-02,5:1.458703e-03,6:1.454980e-03,8:1.589036e-02,9:1.319323e-03,(4:1.447644e-03,7:1.428240e-03):3.421920e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -647.82 -660.96
2 -647.93 -665.33
--------------------------------------
TOTAL -647.87 -664.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.094619 0.000665 0.050248 0.148044 0.091328 1421.47 1441.77 1.000
r(A<->C){all} 0.105840 0.003778 0.008375 0.228855 0.094510 316.81 425.09 1.000
r(A<->G){all} 0.172186 0.006908 0.032141 0.335241 0.159813 318.51 361.90 1.000
r(A<->T){all} 0.080640 0.002776 0.001671 0.178999 0.071481 327.85 469.68 1.001
r(C<->G){all} 0.039367 0.001549 0.000008 0.119285 0.027322 349.85 497.00 1.001
r(C<->T){all} 0.505276 0.010267 0.310899 0.698400 0.505749 446.42 470.40 1.000
r(G<->T){all} 0.096691 0.003135 0.005646 0.203415 0.087039 462.70 479.18 1.002
pi(A){all} 0.241701 0.000468 0.199043 0.283782 0.241689 1119.63 1226.01 1.000
pi(C){all} 0.250569 0.000503 0.208812 0.296062 0.249816 1173.45 1223.01 1.001
pi(G){all} 0.192929 0.000398 0.155918 0.233177 0.192453 1288.05 1294.35 1.000
pi(T){all} 0.314801 0.000550 0.271634 0.361426 0.313900 1199.69 1217.12 1.000
alpha{1,2} 0.600158 0.564324 0.000015 2.072402 0.337430 1044.67 1169.53 1.000
alpha{3} 1.197001 1.047704 0.000705 3.243417 0.934710 925.73 1004.67 1.000
pinvar{all} 0.572390 0.037415 0.169863 0.876821 0.605757 745.32 758.27 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 9 ls = 102
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 4 3 3 3 | Ser TCT 5 6 5 5 5 5 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 2 2 2 2 2 2
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 1 2 1 2 2 2 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 2 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 1 1 1 1 | Pro CCT 4 3 4 4 4 4 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 3 2 3 3 3 3 | CCC 2 2 2 2 2 2 | CAC 2 2 2 2 2 2 | CGC 2 2 2 2 2 2
CTA 1 0 1 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 3 3 3 3 3 3 | CGA 2 2 2 2 2 2
CTG 2 2 0 1 1 1 | CCG 0 0 0 0 0 0 | CAG 2 2 3 2 2 2 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 5 5 5 | Thr ACT 7 7 6 7 7 7 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 1 1 2 1 1 1 | ACC 2 2 3 2 2 2 | AAC 0 0 0 0 0 0 | AGC 0 0 0 0 0 0
ATA 1 2 1 0 1 1 | ACA 1 1 2 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 2 2 2 2 2 2
Met ATG 2 2 2 3 2 2 | ACG 1 1 0 1 1 1 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 1 2 2 2 | Ala GCT 4 4 5 4 4 4 | Asp GAT 6 5 5 5 5 5 | Gly GGT 2 2 2 2 2 2
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 3 4 4 4 4 4 | GGC 2 2 2 2 2 2
GTA 0 0 0 0 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 1 0 0 0 0 0 | GGA 0 0 0 0 0 0
GTG 2 2 2 2 2 2 | GCG 0 0 0 0 0 0 | GAG 1 2 2 2 2 2 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------
Phe TTT 3 4 3 | Ser TCT 5 6 5 | Tyr TAT 2 2 2 | Cys TGT 2 2 2
TTC 1 0 1 | TCC 1 1 1 | TAC 3 3 3 | TGC 0 0 0
Leu TTA 2 1 2 | TCA 1 1 1 | *** TAA 0 0 0 | *** TGA 0 0 0
TTG 2 1 2 | TCG 0 0 0 | TAG 0 0 0 | Trp TGG 0 0 0
--------------------------------------------------------------------------------------
Leu CTT 1 1 1 | Pro CCT 4 4 4 | His CAT 1 1 1 | Arg CGT 3 3 3
CTC 3 3 3 | CCC 2 2 2 | CAC 2 2 2 | CGC 2 2 2
CTA 0 1 0 | CCA 1 1 1 | Gln CAA 3 3 3 | CGA 2 2 2
CTG 1 1 1 | CCG 0 0 0 | CAG 2 2 2 | CGG 0 0 0
--------------------------------------------------------------------------------------
Ile ATT 5 5 5 | Thr ACT 7 6 7 | Asn AAT 2 3 2 | Ser AGT 0 0 0
ATC 1 1 1 | ACC 2 2 2 | AAC 0 0 0 | AGC 0 0 0
ATA 0 1 1 | ACA 1 1 1 | Lys AAA 0 0 0 | Arg AGA 2 2 2
Met ATG 3 2 2 | ACG 1 1 1 | AAG 2 2 2 | AGG 0 0 0
--------------------------------------------------------------------------------------
Val GTT 2 3 2 | Ala GCT 4 4 4 | Asp GAT 5 6 5 | Gly GGT 2 2 2
GTC 1 0 1 | GCC 0 0 0 | GAC 4 3 4 | GGC 2 2 2
GTA 0 0 0 | GCA 2 2 2 | Glu GAA 0 0 0 | GGA 0 0 0
GTG 2 2 2 | GCG 0 0 0 | GAG 2 2 2 | GGG 1 1 1
--------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.19608 C:0.29412 A:0.24510 G:0.26471
position 2: T:0.26471 C:0.30392 A:0.27451 G:0.15686
position 3: T:0.48039 C:0.22549 A:0.15686 G:0.13725
Average T:0.31373 C:0.27451 A:0.22549 G:0.18627
#2: C2
position 1: T:0.21569 C:0.26471 A:0.25490 G:0.26471
position 2: T:0.26471 C:0.30392 A:0.27451 G:0.15686
position 3: T:0.47059 C:0.22549 A:0.15686 G:0.14706
Average T:0.31699 C:0.26471 A:0.22876 G:0.18954
#3: C3
position 1: T:0.20588 C:0.27451 A:0.25490 G:0.26471
position 2: T:0.24510 C:0.31373 A:0.28431 G:0.15686
position 3: T:0.46078 C:0.25490 A:0.15686 G:0.12745
Average T:0.30392 C:0.28105 A:0.23203 G:0.18301
#4: C4
position 1: T:0.21569 C:0.26471 A:0.25490 G:0.26471
position 2: T:0.26471 C:0.30392 A:0.27451 G:0.15686
position 3: T:0.47059 C:0.23529 A:0.13725 G:0.15686
Average T:0.31699 C:0.26797 A:0.22222 G:0.19281
#5: C5
position 1: T:0.21569 C:0.26471 A:0.25490 G:0.26471
position 2: T:0.26471 C:0.30392 A:0.27451 G:0.15686
position 3: T:0.47059 C:0.23529 A:0.14706 G:0.14706
Average T:0.31699 C:0.26797 A:0.22549 G:0.18954
#6: C6
position 1: T:0.21569 C:0.26471 A:0.25490 G:0.26471
position 2: T:0.26471 C:0.30392 A:0.27451 G:0.15686
position 3: T:0.47059 C:0.23529 A:0.14706 G:0.14706
Average T:0.31699 C:0.26797 A:0.22549 G:0.18954
#7: C7
position 1: T:0.21569 C:0.26471 A:0.25490 G:0.26471
position 2: T:0.26471 C:0.30392 A:0.27451 G:0.15686
position 3: T:0.47059 C:0.23529 A:0.13725 G:0.15686
Average T:0.31699 C:0.26797 A:0.22222 G:0.19281
#8: C8
position 1: T:0.20588 C:0.27451 A:0.25490 G:0.26471
position 2: T:0.25490 C:0.30392 A:0.28431 G:0.15686
position 3: T:0.50980 C:0.20588 A:0.14706 G:0.13725
Average T:0.32353 C:0.26144 A:0.22876 G:0.18627
#9: C9
position 1: T:0.21569 C:0.26471 A:0.25490 G:0.26471
position 2: T:0.26471 C:0.30392 A:0.27451 G:0.15686
position 3: T:0.47059 C:0.23529 A:0.14706 G:0.14706
Average T:0.31699 C:0.26797 A:0.22549 G:0.18954
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 29 | Ser S TCT 47 | Tyr Y TAT 18 | Cys C TGT 18
TTC 8 | TCC 9 | TAC 27 | TGC 0
Leu L TTA 15 | TCA 9 | *** * TAA 0 | *** * TGA 0
TTG 14 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 11 | Pro P CCT 35 | His H CAT 9 | Arg R CGT 27
CTC 26 | CCC 18 | CAC 18 | CGC 18
CTA 3 | CCA 9 | Gln Q CAA 27 | CGA 18
CTG 10 | CCG 0 | CAG 19 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 42 | Thr T ACT 61 | Asn N AAT 19 | Ser S AGT 0
ATC 10 | ACC 19 | AAC 0 | AGC 0
ATA 8 | ACA 10 | Lys K AAA 0 | Arg R AGA 18
Met M ATG 20 | ACG 8 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 37 | Asp D GAT 47 | Gly G GGT 18
GTC 8 | GCC 0 | GAC 34 | GGC 18
GTA 0 | GCA 18 | Glu E GAA 1 | GGA 0
GTG 18 | GCG 0 | GAG 17 | GGG 9
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21133 C:0.27015 A:0.25381 G:0.26471
position 2: T:0.26144 C:0.30501 A:0.27669 G:0.15686
position 3: T:0.47495 C:0.23203 A:0.14815 G:0.14488
Average T:0.31590 C:0.26906 A:0.22622 G:0.18882
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 5, 6, 8, 9, (4, 7)); MP score: 25
lnL(ntime: 10 np: 13): -549.122912 +0.000000
10..1 10..2 10..3 10..5 10..6 10..8 10..9 10..11 11..4 11..7
0.074739 0.042147 0.096821 0.000004 0.000004 0.074381 0.000004 0.010242 0.000004 0.000004 4.544908 0.912929 0.056039
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.298349
(1: 0.074739, 2: 0.042147, 3: 0.096821, 5: 0.000004, 6: 0.000004, 8: 0.074381, 9: 0.000004, (4: 0.000004, 7: 0.000004): 0.010242);
(C1: 0.074739, C2: 0.042147, C3: 0.096821, C5: 0.000004, C6: 0.000004, C8: 0.074381, C9: 0.000004, (C4: 0.000004, C7: 0.000004): 0.010242);
Detailed output identifying parameters
kappa (ts/tv) = 4.54491
MLEs of dN/dS (w) for site classes (K=2)
p: 0.91293 0.08707
w: 0.05604 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.075 226.9 79.1 0.1382 0.0095 0.0690 2.2 5.5
10..2 0.042 226.9 79.1 0.1382 0.0054 0.0389 1.2 3.1
10..3 0.097 226.9 79.1 0.1382 0.0124 0.0894 2.8 7.1
10..5 0.000 226.9 79.1 0.1382 0.0000 0.0000 0.0 0.0
10..6 0.000 226.9 79.1 0.1382 0.0000 0.0000 0.0 0.0
10..8 0.074 226.9 79.1 0.1382 0.0095 0.0687 2.2 5.4
10..9 0.000 226.9 79.1 0.1382 0.0000 0.0000 0.0 0.0
10..11 0.010 226.9 79.1 0.1382 0.0013 0.0095 0.3 0.7
11..4 0.000 226.9 79.1 0.1382 0.0000 0.0000 0.0 0.0
11..7 0.000 226.9 79.1 0.1382 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 5, 6, 8, 9, (4, 7)); MP score: 25
check convergence..
lnL(ntime: 10 np: 15): -545.198852 +0.000000
10..1 10..2 10..3 10..5 10..6 10..8 10..9 10..11 11..4 11..7
0.103383 0.057519 0.147263 0.000004 0.000004 0.091184 0.000004 0.013585 0.000004 0.000004 6.580532 0.989340 0.000000 0.114462 29.686936
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.412953
(1: 0.103383, 2: 0.057519, 3: 0.147263, 5: 0.000004, 6: 0.000004, 8: 0.091184, 9: 0.000004, (4: 0.000004, 7: 0.000004): 0.013585);
(C1: 0.103383, C2: 0.057519, C3: 0.147263, C5: 0.000004, C6: 0.000004, C8: 0.091184, C9: 0.000004, (C4: 0.000004, C7: 0.000004): 0.013585);
Detailed output identifying parameters
kappa (ts/tv) = 6.58053
MLEs of dN/dS (w) for site classes (K=3)
p: 0.98934 0.00000 0.01066
w: 0.11446 1.00000 29.68694
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.103 223.7 82.3 0.4297 0.0254 0.0591 5.7 4.9
10..2 0.058 223.7 82.3 0.4297 0.0141 0.0329 3.2 2.7
10..3 0.147 223.7 82.3 0.4297 0.0362 0.0842 8.1 6.9
10..5 0.000 223.7 82.3 0.4297 0.0000 0.0000 0.0 0.0
10..6 0.000 223.7 82.3 0.4297 0.0000 0.0000 0.0 0.0
10..8 0.091 223.7 82.3 0.4297 0.0224 0.0521 5.0 4.3
10..9 0.000 223.7 82.3 0.4297 0.0000 0.0000 0.0 0.0
10..11 0.014 223.7 82.3 0.4297 0.0033 0.0078 0.7 0.6
11..4 0.000 223.7 82.3 0.4297 0.0000 0.0000 0.0 0.0
11..7 0.000 223.7 82.3 0.4297 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.999** 29.672
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.957* 6.994 +- 2.866
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.661 0.311 0.027 0.001 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.050 0.055 0.064 0.075 0.088 0.101 0.116 0.133 0.150 0.168
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.036
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.019 0.228
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.010 0.095 0.603
sum of density on p0-p1 = 1.000000
Time used: 0:19
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 5, 6, 8, 9, (4, 7)); MP score: 25
lnL(ntime: 10 np: 13): -549.323936 +0.000000
10..1 10..2 10..3 10..5 10..6 10..8 10..9 10..11 11..4 11..7
0.074676 0.042045 0.096376 0.000004 0.000004 0.074346 0.000004 0.010187 0.000004 0.000004 4.594509 0.058639 0.340605
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.297650
(1: 0.074676, 2: 0.042045, 3: 0.096376, 5: 0.000004, 6: 0.000004, 8: 0.074346, 9: 0.000004, (4: 0.000004, 7: 0.000004): 0.010187);
(C1: 0.074676, C2: 0.042045, C3: 0.096376, C5: 0.000004, C6: 0.000004, C8: 0.074346, C9: 0.000004, (C4: 0.000004, C7: 0.000004): 0.010187);
Detailed output identifying parameters
kappa (ts/tv) = 4.59451
Parameters in M7 (beta):
p = 0.05864 q = 0.34060
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00036 0.00623 0.06866 0.43364 0.96185
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.075 226.8 79.2 0.1471 0.0100 0.0677 2.3 5.4
10..2 0.042 226.8 79.2 0.1471 0.0056 0.0381 1.3 3.0
10..3 0.096 226.8 79.2 0.1471 0.0128 0.0873 2.9 6.9
10..5 0.000 226.8 79.2 0.1471 0.0000 0.0000 0.0 0.0
10..6 0.000 226.8 79.2 0.1471 0.0000 0.0000 0.0 0.0
10..8 0.074 226.8 79.2 0.1471 0.0099 0.0674 2.2 5.3
10..9 0.000 226.8 79.2 0.1471 0.0000 0.0000 0.0 0.0
10..11 0.010 226.8 79.2 0.1471 0.0014 0.0092 0.3 0.7
11..4 0.000 226.8 79.2 0.1471 0.0000 0.0000 0.0 0.0
11..7 0.000 226.8 79.2 0.1471 0.0000 0.0000 0.0 0.0
Time used: 0:45
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 5, 6, 8, 9, (4, 7)); MP score: 25
lnL(ntime: 10 np: 15): -545.209570 +0.000000
10..1 10..2 10..3 10..5 10..6 10..8 10..9 10..11 11..4 11..7
0.103413 0.057532 0.147284 0.000004 0.000004 0.091204 0.000004 0.013587 0.000004 0.000004 6.584445 0.989339 12.883479 99.000000 29.723362
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.413040
(1: 0.103413, 2: 0.057532, 3: 0.147284, 5: 0.000004, 6: 0.000004, 8: 0.091204, 9: 0.000004, (4: 0.000004, 7: 0.000004): 0.013587);
(C1: 0.103413, C2: 0.057532, C3: 0.147284, C5: 0.000004, C6: 0.000004, C8: 0.091204, C9: 0.000004, (C4: 0.000004, C7: 0.000004): 0.013587);
Detailed output identifying parameters
kappa (ts/tv) = 6.58444
Parameters in M8 (beta&w>1):
p0 = 0.98934 p = 12.88348 q = 99.00000
(p1 = 0.01066) w = 29.72336
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09893 0.09893 0.09893 0.09893 0.09893 0.09893 0.09893 0.09893 0.09893 0.09893 0.01066
w: 0.06993 0.08433 0.09372 0.10167 0.10913 0.11666 0.12473 0.13409 0.14634 0.16821 29.72336
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.103 223.7 82.3 0.4305 0.0254 0.0591 5.7 4.9
10..2 0.058 223.7 82.3 0.4305 0.0141 0.0329 3.2 2.7
10..3 0.147 223.7 82.3 0.4305 0.0362 0.0841 8.1 6.9
10..5 0.000 223.7 82.3 0.4305 0.0000 0.0000 0.0 0.0
10..6 0.000 223.7 82.3 0.4305 0.0000 0.0000 0.0 0.0
10..8 0.091 223.7 82.3 0.4305 0.0224 0.0521 5.0 4.3
10..9 0.000 223.7 82.3 0.4305 0.0000 0.0000 0.0 0.0
10..11 0.014 223.7 82.3 0.4305 0.0033 0.0078 0.7 0.6
11..4 0.000 223.7 82.3 0.4305 0.0000 0.0000 0.0 0.0
11..7 0.000 223.7 82.3 0.4305 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.999** 29.707
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.976* 6.635 +- 2.877
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.014 0.985
p : 0.721 0.220 0.048 0.009 0.002 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.006 0.034 0.065 0.092 0.116 0.138 0.160 0.183 0.206
ws: 0.061 0.072 0.081 0.088 0.094 0.102 0.110 0.120 0.130 0.141
Time used: 1:53
Model 1: NearlyNeutral -549.122912
Model 2: PositiveSelection -545.198852
Model 7: beta -549.323936
Model 8: beta&w>1 -545.209570
Model 2 vs 1 7.848120
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.999** 29.672
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.957* 6.994 +- 2.866
Model 8 vs 7 8.228732
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.999** 29.707
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
90 L 0.976* 6.635 +- 2.877
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
