--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1067.96 -1097.64
2 -1069.66 -1103.07
--------------------------------------
TOTAL -1068.48 -1102.38
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.423846 0.002804 0.326037 0.530339 0.420690 1366.55 1383.56 1.000
r(A<->C){all} 0.091389 0.001129 0.032276 0.160658 0.088500 534.99 545.09 1.000
r(A<->G){all} 0.172207 0.001669 0.100152 0.254588 0.168477 611.76 675.21 1.000
r(A<->T){all} 0.081730 0.000488 0.042295 0.127442 0.080033 692.83 758.04 1.000
r(C<->G){all} 0.032199 0.000610 0.000045 0.080253 0.026518 556.68 585.80 1.000
r(C<->T){all} 0.531572 0.003082 0.420104 0.635364 0.533030 640.46 647.85 1.000
r(G<->T){all} 0.090903 0.000741 0.044897 0.147332 0.088133 713.18 761.25 1.000
pi(A){all} 0.296715 0.000557 0.250362 0.341705 0.296233 892.08 950.26 1.000
pi(C){all} 0.145053 0.000298 0.112492 0.178976 0.144243 762.10 790.27 1.000
pi(G){all} 0.193555 0.000393 0.156533 0.234158 0.193303 1099.28 1162.24 1.000
pi(T){all} 0.364676 0.000578 0.316428 0.409807 0.364229 804.08 955.16 1.000
alpha{1,2} 0.729988 0.265502 0.138972 1.663839 0.586726 1066.68 1125.87 1.000
alpha{3} 1.608187 0.861166 0.370928 3.505420 1.389508 1296.55 1350.82 1.000
pinvar{all} 0.205208 0.015207 0.000006 0.421413 0.200471 790.90 912.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -817.312563
Model 2: PositiveSelection -817.293493
Model 7: beta -818.877794
Model 8: beta&w>1 -817.335504
Model 2 vs 1 .038140
Model 8 vs 7 3.084580
-- Starting log on Fri Nov 18 14:39:27 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/DcCoV_HKU23_camel_Morocco_CAC2586_2016_NA_QEY10634_1_2016_03_05_Morocco_Camel_Betacoronavirus_1.result--
-- Starting log on Fri Nov 18 14:41:03 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/DcCoV_HKU23_camel_Morocco_CAC2586_2016_NA_QEY10634_1_2016_03_05_Morocco_Camel_Betacoronavirus_1.result--
-- Starting log on Fri Nov 18 22:34:43 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/DcCoV_HKU23_camel_Morocco_CAC2586_2016_NA_QEY10634_1_2016_03_05_Morocco_Camel_Betacoronavirus_1.result/gapped_alignment/codeml,DcCoV_HKU23_camel_Morocco_CAC2586_2016_NA_QEY10634_1_2016_03_05_Morocco_Camel_Betacoronavirus_1.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 30 taxa and 327 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C224
Taxon 2 -> C21
Taxon 3 -> C71
Taxon 4 -> C161
Taxon 5 -> C251
Taxon 6 -> C290
Taxon 7 -> C39
Taxon 8 -> C19
Taxon 9 -> C22
Taxon 10 -> C174
Taxon 11 -> C114
Taxon 12 -> C236
Taxon 13 -> C104
Taxon 14 -> C101
Taxon 15 -> C124
Taxon 16 -> C129
Taxon 17 -> C10
Taxon 18 -> C133
Taxon 19 -> C137
Taxon 20 -> C14
Taxon 21 -> C165
Taxon 22 -> C175
Taxon 23 -> C190
Taxon 24 -> C193
Taxon 25 -> C36
Taxon 26 -> C205
Taxon 27 -> C208
Taxon 28 -> C25
Taxon 29 -> C231
Taxon 30 -> C233
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1668810885
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 34051189
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 7645956928
Seed = 306660050
Swapseed = 1668810885
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 27 unique site patterns
Division 2 has 31 unique site patterns
Division 3 has 44 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2005.330139 -- 82.122948
Chain 2 -- -1983.056913 -- 82.122948
Chain 3 -- -2078.219126 -- 82.122948
Chain 4 -- -2010.469616 -- 82.122948
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1971.302613 -- 82.122948
Chain 2 -- -1895.287808 -- 82.122948
Chain 3 -- -2020.171273 -- 82.122948
Chain 4 -- -1995.128754 -- 82.122948
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2005.330] (-1983.057) (-2078.219) (-2010.470) * [-1971.303] (-1895.288) (-2020.171) (-1995.129)
1000 -- [-1150.153] (-1298.536) (-1199.142) (-1185.703) * (-1161.399) [-1173.961] (-1192.384) (-1161.984) -- 0:16:39
2000 -- (-1134.983) (-1164.680) [-1113.005] (-1099.881) * (-1116.164) (-1128.691) (-1120.759) [-1106.766] -- 0:08:19
3000 -- (-1116.962) (-1143.598) (-1116.203) [-1080.501] * [-1102.264] (-1108.282) (-1116.658) (-1109.324) -- 0:11:04
4000 -- (-1100.055) (-1123.716) [-1082.549] (-1089.168) * (-1112.351) (-1096.185) [-1073.630] (-1097.305) -- 0:12:27
5000 -- (-1095.656) (-1107.221) [-1086.405] (-1088.582) * (-1108.543) [-1094.123] (-1089.452) (-1114.173) -- 0:13:16
Average standard deviation of split frequencies: 0.089419
6000 -- (-1098.028) [-1104.765] (-1110.769) (-1080.831) * (-1083.721) [-1084.263] (-1092.189) (-1100.706) -- 0:11:02
7000 -- [-1076.399] (-1112.983) (-1099.697) (-1087.012) * (-1089.638) [-1089.107] (-1096.173) (-1093.225) -- 0:11:49
8000 -- (-1090.538) (-1084.403) [-1088.643] (-1122.753) * [-1096.567] (-1090.142) (-1104.102) (-1084.995) -- 0:12:24
9000 -- (-1081.349) [-1080.493] (-1088.470) (-1098.652) * (-1093.502) [-1082.491] (-1099.491) (-1105.367) -- 0:12:50
10000 -- (-1105.066) (-1077.068) (-1085.316) [-1085.155] * (-1094.473) (-1084.606) (-1102.672) [-1096.696] -- 0:11:33
Average standard deviation of split frequencies: 0.086771
11000 -- (-1085.058) (-1074.436) (-1095.835) [-1085.892] * (-1100.119) [-1083.771] (-1101.697) (-1102.530) -- 0:11:59
12000 -- (-1090.488) (-1088.952) (-1108.228) [-1077.602] * (-1081.229) [-1078.523] (-1103.039) (-1077.372) -- 0:12:21
13000 -- [-1082.825] (-1097.494) (-1092.698) (-1100.390) * (-1085.951) (-1084.363) (-1098.188) [-1083.483] -- 0:12:39
14000 -- (-1105.221) (-1085.407) (-1091.748) [-1084.585] * [-1075.083] (-1092.567) (-1094.683) (-1087.602) -- 0:11:44
15000 -- (-1087.348) (-1093.538) (-1100.260) [-1085.838] * (-1086.871) (-1106.920) [-1093.075] (-1085.105) -- 0:12:02
Average standard deviation of split frequencies: 0.059959
16000 -- (-1079.275) [-1070.183] (-1100.269) (-1079.921) * (-1093.525) (-1093.069) [-1075.525] (-1090.474) -- 0:12:18
17000 -- (-1106.160) [-1080.972] (-1095.290) (-1096.844) * [-1080.254] (-1095.976) (-1083.355) (-1089.848) -- 0:11:33
18000 -- [-1082.664] (-1099.804) (-1092.195) (-1084.378) * (-1089.953) (-1086.084) [-1085.520] (-1106.545) -- 0:11:49
19000 -- (-1112.350) (-1083.664) [-1084.239] (-1075.389) * [-1074.079] (-1094.599) (-1096.315) (-1085.969) -- 0:12:02
20000 -- (-1102.945) (-1095.914) (-1095.889) [-1076.940] * (-1095.148) (-1100.303) (-1089.844) [-1079.240] -- 0:12:15
Average standard deviation of split frequencies: 0.051797
21000 -- (-1104.396) (-1091.370) (-1079.975) [-1078.595] * (-1088.384) [-1085.510] (-1080.708) (-1085.117) -- 0:11:39
22000 -- (-1091.307) (-1079.125) [-1080.001] (-1095.270) * (-1090.477) [-1081.408] (-1091.240) (-1089.795) -- 0:11:51
23000 -- (-1089.828) (-1087.476) [-1071.683] (-1089.911) * (-1093.083) (-1080.220) (-1094.486) [-1080.918] -- 0:12:02
24000 -- (-1099.548) (-1096.873) [-1072.895] (-1095.441) * (-1085.554) [-1086.448] (-1105.384) (-1076.073) -- 0:12:12
25000 -- (-1081.096) (-1098.424) [-1085.280] (-1080.930) * (-1076.419) (-1098.337) (-1090.810) [-1081.514] -- 0:11:42
Average standard deviation of split frequencies: 0.044477
26000 -- (-1110.368) [-1088.786] (-1087.532) (-1085.700) * (-1087.861) (-1097.855) (-1100.244) [-1077.078] -- 0:11:51
27000 -- (-1080.290) (-1091.579) [-1071.465] (-1081.004) * (-1094.703) (-1092.001) [-1076.419] (-1087.798) -- 0:12:00
28000 -- (-1098.080) (-1095.857) [-1068.320] (-1088.726) * (-1104.390) (-1104.060) [-1079.459] (-1093.585) -- 0:11:34
29000 -- (-1097.723) [-1083.920] (-1084.584) (-1084.952) * (-1102.300) (-1095.085) (-1077.055) [-1099.392] -- 0:11:43
30000 -- (-1099.452) (-1109.005) [-1087.854] (-1092.425) * [-1081.484] (-1094.798) (-1091.376) (-1077.494) -- 0:11:51
Average standard deviation of split frequencies: 0.046390
31000 -- [-1093.671] (-1098.837) (-1080.291) (-1078.692) * (-1081.725) [-1086.515] (-1090.471) (-1072.283) -- 0:11:58
32000 -- (-1095.346) (-1106.560) (-1087.351) [-1089.197] * (-1092.706) (-1082.208) (-1116.011) [-1086.152] -- 0:11:35
33000 -- [-1086.601] (-1109.258) (-1085.047) (-1103.286) * (-1105.610) [-1075.924] (-1091.338) (-1096.447) -- 0:11:43
34000 -- (-1086.416) [-1079.547] (-1103.747) (-1097.328) * (-1102.426) (-1101.992) (-1078.568) [-1099.095] -- 0:11:50
35000 -- (-1091.681) (-1094.912) [-1066.544] (-1086.738) * (-1081.806) (-1096.973) (-1095.138) [-1088.238] -- 0:11:56
Average standard deviation of split frequencies: 0.046838
36000 -- (-1097.374) [-1079.941] (-1097.564) (-1074.903) * (-1095.999) [-1080.850] (-1099.434) (-1095.935) -- 0:11:36
37000 -- (-1096.985) (-1078.324) (-1087.327) [-1082.170] * (-1077.228) [-1076.210] (-1097.443) (-1075.944) -- 0:11:42
38000 -- (-1088.954) (-1099.294) (-1087.569) [-1078.496] * (-1099.725) [-1075.181] (-1109.152) (-1069.532) -- 0:11:48
39000 -- (-1096.728) [-1086.942] (-1087.637) (-1083.423) * (-1090.464) [-1076.277] (-1098.408) (-1073.409) -- 0:11:29
40000 -- (-1104.457) (-1090.170) [-1083.197] (-1085.981) * (-1111.598) (-1086.254) (-1090.318) [-1090.034] -- 0:11:36
Average standard deviation of split frequencies: 0.047050
41000 -- (-1097.349) [-1086.316] (-1092.574) (-1089.596) * (-1095.805) (-1095.938) (-1077.923) [-1074.911] -- 0:11:41
42000 -- [-1093.452] (-1083.635) (-1098.018) (-1087.651) * (-1092.536) [-1081.631] (-1077.197) (-1092.520) -- 0:11:47
43000 -- (-1089.034) (-1092.290) (-1081.968) [-1095.034] * (-1099.675) [-1078.357] (-1080.975) (-1092.146) -- 0:11:29
44000 -- (-1084.425) (-1088.099) (-1078.742) [-1092.384] * (-1093.442) (-1077.833) (-1071.329) [-1082.307] -- 0:11:35
45000 -- [-1080.655] (-1086.274) (-1086.556) (-1106.370) * [-1075.320] (-1097.980) (-1108.983) (-1100.252) -- 0:11:40
Average standard deviation of split frequencies: 0.044947
46000 -- (-1108.909) [-1081.373] (-1091.620) (-1104.668) * (-1089.685) (-1092.512) (-1108.020) [-1082.313] -- 0:11:24
47000 -- (-1101.756) (-1093.415) [-1074.765] (-1087.199) * [-1083.812] (-1094.248) (-1102.469) (-1095.755) -- 0:11:29
48000 -- [-1082.300] (-1098.144) (-1088.430) (-1086.768) * (-1112.411) (-1090.212) (-1087.960) [-1098.124] -- 0:11:34
49000 -- (-1092.659) [-1089.573] (-1109.786) (-1101.554) * (-1095.750) (-1085.724) (-1094.849) [-1086.801] -- 0:11:38
50000 -- [-1079.989] (-1095.260) (-1089.345) (-1080.311) * (-1091.181) [-1073.675] (-1091.279) (-1090.983) -- 0:11:24
Average standard deviation of split frequencies: 0.034934
51000 -- [-1075.113] (-1083.644) (-1093.445) (-1116.958) * (-1067.895) [-1067.787] (-1091.365) (-1097.536) -- 0:11:28
52000 -- (-1081.617) (-1102.078) (-1092.462) [-1080.404] * (-1093.139) [-1072.759] (-1093.330) (-1092.998) -- 0:11:32
53000 -- (-1089.037) [-1080.009] (-1085.828) (-1073.862) * (-1103.426) (-1088.495) (-1076.787) [-1071.025] -- 0:11:36
54000 -- [-1072.333] (-1073.998) (-1090.809) (-1098.464) * (-1111.126) (-1081.607) [-1076.064] (-1079.486) -- 0:11:23
55000 -- [-1078.025] (-1099.871) (-1087.478) (-1102.170) * (-1104.545) (-1087.544) (-1082.772) [-1090.993] -- 0:11:27
Average standard deviation of split frequencies: 0.031835
56000 -- [-1073.519] (-1112.164) (-1096.450) (-1087.235) * (-1105.008) [-1070.248] (-1098.007) (-1091.370) -- 0:11:31
57000 -- [-1074.295] (-1093.459) (-1102.830) (-1077.296) * (-1093.939) [-1077.035] (-1075.807) (-1089.415) -- 0:11:18
58000 -- (-1087.539) [-1089.753] (-1106.213) (-1088.637) * [-1092.874] (-1087.251) (-1084.790) (-1088.147) -- 0:11:22
59000 -- (-1084.660) (-1097.374) (-1085.522) [-1084.397] * (-1107.510) [-1064.063] (-1091.473) (-1082.394) -- 0:11:25
60000 -- (-1097.585) (-1094.344) (-1095.732) [-1078.876] * (-1089.962) [-1080.771] (-1089.258) (-1086.938) -- 0:11:29
Average standard deviation of split frequencies: 0.035320
61000 -- [-1063.757] (-1115.427) (-1075.916) (-1086.537) * (-1103.033) (-1101.124) [-1077.812] (-1081.481) -- 0:11:17
62000 -- (-1081.323) (-1077.552) [-1074.030] (-1090.515) * [-1089.317] (-1081.693) (-1084.692) (-1089.729) -- 0:11:20
63000 -- (-1082.241) (-1083.775) [-1076.861] (-1097.713) * [-1085.514] (-1092.908) (-1095.582) (-1104.095) -- 0:11:24
64000 -- (-1096.279) (-1090.787) [-1080.495] (-1106.128) * (-1069.213) (-1079.619) (-1087.104) [-1083.520] -- 0:11:12
65000 -- (-1114.336) (-1094.576) [-1078.897] (-1083.933) * [-1075.226] (-1084.428) (-1104.506) (-1090.343) -- 0:11:16
Average standard deviation of split frequencies: 0.034112
66000 -- (-1090.198) [-1078.940] (-1074.050) (-1088.744) * (-1077.448) (-1081.042) (-1098.515) [-1081.693] -- 0:11:19
67000 -- (-1110.393) (-1075.027) [-1075.950] (-1092.440) * (-1083.379) (-1091.067) (-1101.997) [-1091.001] -- 0:11:22
68000 -- (-1099.657) (-1091.670) [-1067.035] (-1082.053) * (-1086.912) (-1084.014) (-1091.972) [-1083.718] -- 0:11:11
69000 -- (-1085.329) (-1097.813) [-1067.435] (-1084.850) * (-1072.267) (-1089.473) (-1105.222) [-1073.674] -- 0:11:14
70000 -- [-1079.688] (-1104.693) (-1084.083) (-1092.748) * (-1081.451) (-1091.098) (-1110.262) [-1084.348] -- 0:11:17
Average standard deviation of split frequencies: 0.035276
71000 -- [-1072.304] (-1095.625) (-1087.762) (-1084.161) * [-1073.951] (-1071.583) (-1093.787) (-1073.748) -- 0:11:20
72000 -- [-1071.216] (-1084.556) (-1088.665) (-1096.748) * (-1091.857) (-1095.191) (-1089.755) [-1073.425] -- 0:11:10
73000 -- (-1087.520) [-1072.610] (-1094.616) (-1096.389) * (-1092.785) (-1104.788) (-1089.407) [-1079.907] -- 0:11:13
74000 -- (-1089.140) (-1077.572) [-1072.146] (-1115.014) * (-1093.469) (-1072.808) (-1088.186) [-1082.170] -- 0:11:15
75000 -- (-1090.651) [-1085.427] (-1084.913) (-1095.374) * (-1098.217) (-1102.127) (-1085.846) [-1083.892] -- 0:11:06
Average standard deviation of split frequencies: 0.032319
76000 -- (-1096.752) [-1070.305] (-1087.003) (-1097.671) * (-1089.923) (-1100.262) [-1076.018] (-1077.812) -- 0:11:08
77000 -- (-1077.924) (-1084.111) [-1085.093] (-1083.700) * (-1091.988) (-1103.462) [-1083.098] (-1088.345) -- 0:11:11
78000 -- (-1086.232) [-1081.801] (-1096.828) (-1091.430) * [-1083.538] (-1113.587) (-1090.149) (-1087.126) -- 0:11:13
79000 -- (-1087.237) (-1085.514) [-1079.278] (-1097.225) * (-1095.819) (-1101.050) (-1094.856) [-1081.500] -- 0:11:04
80000 -- (-1103.810) (-1091.941) [-1084.872] (-1107.464) * (-1094.261) (-1099.326) [-1089.515] (-1106.648) -- 0:11:07
Average standard deviation of split frequencies: 0.031306
81000 -- (-1096.730) (-1088.803) [-1082.991] (-1089.816) * (-1090.328) (-1116.012) (-1081.481) [-1084.110] -- 0:11:09
82000 -- (-1085.763) (-1073.508) (-1074.660) [-1075.391] * (-1096.540) (-1098.745) (-1085.855) [-1091.360] -- 0:11:11
83000 -- (-1083.371) (-1081.297) [-1087.458] (-1094.556) * (-1080.088) (-1079.465) [-1076.075] (-1098.002) -- 0:11:02
84000 -- [-1076.590] (-1099.635) (-1089.550) (-1085.014) * (-1086.218) [-1075.502] (-1089.313) (-1086.087) -- 0:11:05
85000 -- (-1077.464) (-1081.877) [-1067.375] (-1105.882) * (-1106.890) (-1082.345) (-1099.220) [-1083.222] -- 0:11:07
Average standard deviation of split frequencies: 0.030999
86000 -- [-1087.907] (-1091.294) (-1080.348) (-1094.114) * (-1107.088) [-1098.382] (-1091.632) (-1099.918) -- 0:11:09
87000 -- (-1081.303) [-1084.550] (-1086.190) (-1096.900) * (-1101.124) [-1093.556] (-1085.048) (-1081.121) -- 0:11:01
88000 -- (-1090.536) (-1083.541) [-1083.248] (-1104.634) * (-1079.253) (-1083.900) [-1081.072] (-1094.684) -- 0:11:03
89000 -- [-1074.897] (-1087.466) (-1087.898) (-1103.206) * (-1089.951) (-1086.697) (-1104.654) [-1096.352] -- 0:11:05
90000 -- (-1099.854) [-1070.827] (-1086.337) (-1099.208) * [-1078.447] (-1093.535) (-1096.906) (-1088.421) -- 0:11:07
Average standard deviation of split frequencies: 0.032960
91000 -- (-1115.780) (-1079.748) (-1104.030) [-1078.596] * [-1083.781] (-1107.809) (-1098.405) (-1093.521) -- 0:10:59
92000 -- (-1087.280) [-1090.167] (-1090.152) (-1086.713) * [-1078.295] (-1079.419) (-1103.480) (-1093.660) -- 0:11:01
93000 -- (-1093.783) (-1087.895) [-1081.638] (-1107.847) * (-1086.045) [-1082.427] (-1074.814) (-1094.350) -- 0:11:03
94000 -- (-1099.146) (-1077.285) [-1079.767] (-1105.284) * (-1095.949) (-1086.850) (-1082.667) [-1079.775] -- 0:10:55
95000 -- (-1110.326) [-1081.088] (-1089.211) (-1100.607) * (-1091.326) (-1086.300) (-1089.560) [-1091.195] -- 0:10:57
Average standard deviation of split frequencies: 0.031554
96000 -- (-1092.715) (-1098.027) [-1079.668] (-1089.566) * (-1088.505) (-1097.731) (-1076.506) [-1091.308] -- 0:10:59
97000 -- (-1072.274) (-1097.229) [-1089.816] (-1082.894) * (-1076.581) (-1092.988) [-1076.780] (-1076.030) -- 0:11:00
98000 -- (-1102.249) (-1077.101) [-1087.435] (-1083.184) * (-1114.907) (-1101.702) [-1066.423] (-1082.874) -- 0:10:53
99000 -- (-1099.870) (-1071.662) [-1077.832] (-1092.679) * (-1103.548) (-1076.417) (-1083.288) [-1078.774] -- 0:10:55
100000 -- (-1103.781) [-1077.294] (-1084.874) (-1115.142) * (-1112.766) [-1066.024] (-1105.154) (-1073.226) -- 0:10:57
Average standard deviation of split frequencies: 0.029864
101000 -- [-1080.099] (-1078.748) (-1089.688) (-1094.517) * [-1079.032] (-1072.907) (-1085.767) (-1117.829) -- 0:10:58
102000 -- (-1083.844) [-1081.789] (-1107.374) (-1089.423) * (-1104.281) (-1076.089) (-1085.861) [-1089.873] -- 0:10:51
103000 -- (-1091.956) [-1089.947] (-1085.889) (-1103.396) * [-1079.588] (-1087.971) (-1074.338) (-1084.497) -- 0:10:53
104000 -- (-1096.538) [-1090.964] (-1092.425) (-1113.742) * [-1071.180] (-1103.284) (-1115.849) (-1088.929) -- 0:10:54
105000 -- (-1086.186) (-1099.907) [-1074.751] (-1079.688) * (-1073.596) (-1113.312) (-1109.114) [-1081.132] -- 0:10:47
Average standard deviation of split frequencies: 0.030160
106000 -- [-1076.991] (-1097.013) (-1078.176) (-1084.998) * [-1079.728] (-1098.534) (-1101.642) (-1109.672) -- 0:10:49
107000 -- (-1084.470) (-1096.099) [-1082.609] (-1094.245) * (-1086.862) [-1090.980] (-1090.145) (-1084.923) -- 0:10:50
108000 -- (-1092.319) (-1101.832) [-1080.279] (-1096.443) * (-1093.959) (-1089.253) [-1076.786] (-1091.871) -- 0:10:52
109000 -- (-1092.560) (-1088.559) (-1102.581) [-1069.033] * [-1085.139] (-1096.262) (-1098.585) (-1089.634) -- 0:10:45
110000 -- (-1092.003) (-1100.456) (-1088.243) [-1078.594] * [-1070.160] (-1100.802) (-1084.739) (-1088.970) -- 0:10:47
Average standard deviation of split frequencies: 0.027372
111000 -- [-1079.111] (-1108.129) (-1096.310) (-1075.982) * (-1073.465) (-1116.275) [-1082.564] (-1103.353) -- 0:10:48
112000 -- (-1085.244) [-1083.286] (-1095.132) (-1090.025) * (-1089.609) (-1103.900) [-1073.338] (-1078.553) -- 0:10:50
113000 -- [-1071.694] (-1090.674) (-1094.016) (-1075.273) * (-1091.160) (-1102.770) [-1075.581] (-1087.562) -- 0:10:43
114000 -- (-1086.057) (-1083.354) (-1098.596) [-1078.604] * [-1080.997] (-1095.277) (-1083.270) (-1108.259) -- 0:10:45
115000 -- (-1091.111) [-1094.121] (-1094.982) (-1095.166) * [-1077.314] (-1104.663) (-1084.996) (-1105.384) -- 0:10:46
Average standard deviation of split frequencies: 0.026252
116000 -- (-1104.668) (-1073.578) (-1091.175) [-1069.025] * [-1080.395] (-1096.810) (-1078.677) (-1110.280) -- 0:10:47
117000 -- (-1098.023) (-1089.570) (-1074.204) [-1089.485] * [-1065.796] (-1080.643) (-1094.448) (-1100.776) -- 0:10:41
118000 -- (-1098.936) (-1082.288) [-1067.181] (-1090.398) * (-1087.623) [-1085.020] (-1094.270) (-1087.934) -- 0:10:42
119000 -- (-1097.333) (-1090.066) (-1078.414) [-1075.492] * (-1092.861) (-1102.217) (-1085.121) [-1087.882] -- 0:10:44
120000 -- (-1088.113) (-1103.927) (-1074.815) [-1080.901] * (-1101.196) (-1088.769) (-1105.754) [-1076.787] -- 0:10:38
Average standard deviation of split frequencies: 0.025237
121000 -- (-1094.635) (-1100.844) (-1089.412) [-1083.175] * (-1089.625) (-1088.551) (-1101.495) [-1073.869] -- 0:10:39
122000 -- (-1089.782) [-1095.355] (-1101.946) (-1080.159) * (-1078.145) [-1085.469] (-1096.494) (-1077.365) -- 0:10:40
123000 -- [-1073.363] (-1103.872) (-1095.398) (-1084.964) * (-1079.938) [-1083.051] (-1097.963) (-1094.498) -- 0:10:41
124000 -- (-1081.695) (-1116.355) (-1098.007) [-1080.612] * (-1084.856) (-1081.895) (-1098.785) [-1086.486] -- 0:10:35
125000 -- [-1086.517] (-1088.252) (-1090.419) (-1088.274) * [-1081.553] (-1091.939) (-1095.384) (-1098.090) -- 0:10:37
Average standard deviation of split frequencies: 0.024031
126000 -- (-1095.270) (-1082.792) [-1080.639] (-1097.753) * (-1078.475) (-1083.690) [-1091.849] (-1078.585) -- 0:10:38
127000 -- [-1080.759] (-1096.245) (-1089.073) (-1098.226) * [-1073.990] (-1096.554) (-1091.044) (-1085.875) -- 0:10:39
128000 -- [-1074.637] (-1084.550) (-1106.159) (-1092.177) * (-1087.597) [-1091.529] (-1094.158) (-1101.602) -- 0:10:33
129000 -- (-1096.599) (-1092.476) (-1092.163) [-1083.768] * (-1089.999) [-1076.707] (-1087.059) (-1087.221) -- 0:10:34
130000 -- (-1076.630) (-1106.320) (-1083.042) [-1080.470] * [-1079.106] (-1084.764) (-1086.295) (-1074.691) -- 0:10:35
Average standard deviation of split frequencies: 0.024005
131000 -- [-1071.836] (-1106.334) (-1085.142) (-1099.847) * [-1081.708] (-1086.224) (-1089.728) (-1084.136) -- 0:10:36
132000 -- (-1088.019) (-1083.827) [-1089.435] (-1103.596) * (-1099.585) [-1088.926] (-1090.182) (-1090.181) -- 0:10:31
133000 -- [-1082.998] (-1093.013) (-1076.515) (-1093.950) * (-1093.845) (-1082.647) (-1075.704) [-1079.043] -- 0:10:32
134000 -- [-1072.472] (-1083.541) (-1094.036) (-1085.642) * [-1088.520] (-1106.214) (-1079.503) (-1089.916) -- 0:10:33
135000 -- (-1087.780) (-1088.747) (-1097.619) [-1075.095] * (-1088.164) (-1090.516) [-1080.409] (-1111.531) -- 0:10:27
Average standard deviation of split frequencies: 0.023130
136000 -- (-1098.007) [-1076.299] (-1097.971) (-1085.562) * (-1092.248) [-1074.691] (-1086.372) (-1101.121) -- 0:10:28
137000 -- (-1099.578) (-1082.804) [-1076.641] (-1092.650) * (-1090.422) (-1080.891) [-1087.902] (-1076.395) -- 0:10:29
138000 -- (-1109.401) (-1094.372) (-1084.910) [-1088.737] * (-1091.597) (-1100.003) (-1093.626) [-1087.576] -- 0:10:30
139000 -- (-1097.805) (-1085.582) (-1091.480) [-1088.915] * (-1089.387) (-1092.994) (-1079.141) [-1079.468] -- 0:10:25
140000 -- (-1108.794) (-1090.830) (-1092.735) [-1080.362] * (-1100.228) (-1097.068) (-1085.396) [-1087.017] -- 0:10:26
Average standard deviation of split frequencies: 0.022843
141000 -- (-1108.383) [-1076.860] (-1092.595) (-1103.694) * (-1101.620) (-1082.062) [-1072.993] (-1099.104) -- 0:10:27
142000 -- (-1096.043) [-1080.734] (-1086.036) (-1104.406) * (-1098.451) [-1077.818] (-1066.603) (-1120.845) -- 0:10:28
143000 -- (-1095.651) (-1080.736) [-1078.615] (-1091.776) * (-1102.885) (-1095.211) [-1071.790] (-1094.908) -- 0:10:23
144000 -- (-1091.142) (-1103.998) (-1082.489) [-1079.789] * (-1096.850) (-1087.177) (-1071.191) [-1083.285] -- 0:10:24
145000 -- (-1092.985) (-1083.504) [-1076.062] (-1077.055) * [-1084.308] (-1092.235) (-1095.167) (-1094.354) -- 0:10:25
Average standard deviation of split frequencies: 0.020535
146000 -- (-1114.635) (-1089.822) [-1082.169] (-1082.386) * (-1094.344) (-1101.130) [-1072.442] (-1099.866) -- 0:10:20
147000 -- [-1074.279] (-1093.873) (-1081.340) (-1094.727) * (-1089.787) (-1089.772) [-1085.625] (-1096.439) -- 0:10:20
148000 -- (-1091.960) [-1080.712] (-1078.162) (-1086.826) * [-1083.521] (-1087.067) (-1091.329) (-1088.947) -- 0:10:21
149000 -- (-1087.368) (-1092.175) (-1095.542) [-1073.756] * [-1072.969] (-1084.262) (-1092.024) (-1086.375) -- 0:10:22
150000 -- (-1082.014) [-1080.055] (-1108.410) (-1081.927) * [-1083.139] (-1090.770) (-1095.538) (-1087.013) -- 0:10:17
Average standard deviation of split frequencies: 0.021071
151000 -- [-1077.906] (-1100.436) (-1093.393) (-1094.888) * (-1093.375) (-1092.806) (-1082.124) [-1091.267] -- 0:10:18
152000 -- [-1089.950] (-1124.002) (-1099.594) (-1088.047) * (-1098.755) (-1078.779) [-1092.482] (-1095.633) -- 0:10:19
153000 -- (-1098.829) (-1092.245) (-1095.249) [-1088.965] * (-1092.770) (-1091.430) (-1086.696) [-1084.891] -- 0:10:20
154000 -- (-1110.192) (-1105.095) (-1085.054) [-1090.023] * (-1094.792) [-1084.821] (-1101.690) (-1092.720) -- 0:10:15
155000 -- (-1105.334) (-1106.141) [-1083.055] (-1086.571) * (-1094.557) [-1082.901] (-1107.292) (-1097.342) -- 0:10:16
Average standard deviation of split frequencies: 0.020166
156000 -- (-1091.249) (-1094.713) [-1079.358] (-1104.647) * [-1072.966] (-1078.097) (-1099.978) (-1107.754) -- 0:10:16
157000 -- (-1086.389) [-1077.698] (-1101.431) (-1114.066) * [-1096.620] (-1084.105) (-1088.188) (-1095.665) -- 0:10:12
158000 -- (-1094.222) (-1086.437) [-1080.474] (-1082.918) * (-1106.305) [-1076.832] (-1090.735) (-1100.849) -- 0:10:12
159000 -- (-1088.890) (-1100.122) (-1113.813) [-1090.525] * (-1095.453) [-1076.967] (-1086.569) (-1090.656) -- 0:10:13
160000 -- (-1091.885) [-1074.722] (-1083.487) (-1087.863) * (-1099.972) (-1098.182) (-1096.616) [-1073.427] -- 0:10:14
Average standard deviation of split frequencies: 0.019580
161000 -- [-1080.967] (-1084.872) (-1081.373) (-1094.863) * (-1086.892) (-1093.311) (-1096.890) [-1072.894] -- 0:10:09
162000 -- (-1081.077) [-1078.501] (-1099.795) (-1097.835) * (-1087.449) (-1084.958) [-1099.432] (-1085.812) -- 0:10:10
163000 -- (-1101.144) (-1089.732) [-1093.028] (-1094.906) * (-1105.865) (-1107.697) (-1088.592) [-1080.935] -- 0:10:11
164000 -- (-1079.464) (-1092.174) (-1093.108) [-1091.094] * (-1102.946) [-1078.498] (-1079.824) (-1092.671) -- 0:10:11
165000 -- [-1081.150] (-1090.458) (-1103.073) (-1077.617) * [-1082.963] (-1093.215) (-1087.849) (-1089.123) -- 0:10:07
Average standard deviation of split frequencies: 0.017436
166000 -- (-1085.395) [-1080.056] (-1091.233) (-1083.562) * (-1080.748) (-1085.441) [-1081.702] (-1092.217) -- 0:10:07
167000 -- (-1103.671) (-1087.960) (-1081.385) [-1084.549] * (-1088.822) (-1073.468) [-1086.367] (-1096.855) -- 0:10:08
168000 -- (-1088.811) (-1098.362) (-1079.561) [-1073.484] * [-1084.522] (-1092.685) (-1085.189) (-1101.408) -- 0:10:04
169000 -- (-1078.721) (-1103.170) [-1091.975] (-1087.511) * (-1084.617) (-1095.740) (-1091.473) [-1083.886] -- 0:10:04
170000 -- (-1089.586) [-1073.399] (-1086.371) (-1097.274) * (-1080.918) (-1107.944) (-1107.697) [-1091.293] -- 0:10:05
Average standard deviation of split frequencies: 0.017954
171000 -- (-1081.718) [-1093.523] (-1090.128) (-1082.055) * (-1078.551) (-1107.522) (-1103.473) [-1084.093] -- 0:10:05
172000 -- (-1082.928) [-1088.117] (-1111.270) (-1095.191) * (-1104.164) (-1094.967) [-1078.199] (-1085.109) -- 0:10:01
173000 -- (-1082.068) [-1073.173] (-1094.171) (-1095.537) * (-1102.170) (-1075.657) (-1094.556) [-1074.134] -- 0:10:02
174000 -- (-1078.493) [-1080.643] (-1089.825) (-1097.020) * (-1089.584) [-1066.145] (-1091.507) (-1093.875) -- 0:10:02
175000 -- [-1077.802] (-1102.109) (-1086.678) (-1092.050) * (-1081.730) (-1103.827) (-1089.600) [-1078.196] -- 0:09:58
Average standard deviation of split frequencies: 0.019419
176000 -- (-1081.254) (-1095.059) (-1113.781) [-1089.926] * (-1094.964) (-1085.171) (-1094.644) [-1070.869] -- 0:09:59
177000 -- (-1072.547) (-1085.665) [-1079.702] (-1092.651) * (-1085.949) (-1080.410) (-1085.951) [-1074.275] -- 0:09:59
178000 -- (-1089.675) [-1086.042] (-1085.171) (-1098.716) * (-1088.634) (-1103.139) (-1095.476) [-1077.579] -- 0:10:00
179000 -- (-1096.171) [-1081.487] (-1074.177) (-1105.857) * (-1087.791) (-1092.639) (-1082.642) [-1082.591] -- 0:09:56
180000 -- (-1088.697) (-1083.646) [-1072.293] (-1092.124) * (-1093.151) [-1090.887] (-1096.654) (-1097.507) -- 0:09:56
Average standard deviation of split frequencies: 0.019204
181000 -- [-1086.933] (-1091.352) (-1078.214) (-1091.901) * (-1095.320) [-1079.958] (-1084.449) (-1092.139) -- 0:09:57
182000 -- (-1088.707) (-1107.401) [-1070.468] (-1098.113) * (-1083.619) (-1087.771) [-1072.660] (-1089.712) -- 0:09:53
183000 -- (-1090.249) (-1077.961) [-1082.995] (-1106.737) * (-1083.301) (-1095.939) [-1080.023] (-1074.119) -- 0:09:53
184000 -- (-1092.974) (-1079.827) (-1083.246) [-1080.254] * (-1084.879) (-1112.780) (-1085.554) [-1076.776] -- 0:09:54
185000 -- (-1080.487) (-1079.195) (-1083.020) [-1079.139] * (-1087.736) (-1112.602) [-1085.151] (-1073.248) -- 0:09:54
Average standard deviation of split frequencies: 0.019083
186000 -- [-1082.811] (-1082.818) (-1102.032) (-1094.925) * (-1088.784) (-1093.416) [-1079.667] (-1097.669) -- 0:09:50
187000 -- (-1080.680) [-1080.823] (-1095.950) (-1104.929) * [-1082.800] (-1093.414) (-1093.453) (-1082.125) -- 0:09:51
188000 -- (-1091.069) (-1089.230) [-1087.010] (-1101.623) * (-1081.262) (-1080.884) (-1089.982) [-1090.066] -- 0:09:51
189000 -- (-1082.058) [-1088.666] (-1095.665) (-1094.314) * (-1086.292) (-1087.504) (-1077.394) [-1083.123] -- 0:09:52
190000 -- (-1084.850) [-1089.092] (-1088.466) (-1092.243) * [-1079.168] (-1101.784) (-1084.613) (-1090.146) -- 0:09:48
Average standard deviation of split frequencies: 0.018921
191000 -- [-1083.980] (-1091.784) (-1094.263) (-1108.781) * (-1098.052) (-1083.247) (-1078.217) [-1083.558] -- 0:09:48
192000 -- (-1085.961) (-1079.546) (-1107.141) [-1091.918] * (-1093.449) (-1077.497) (-1086.781) [-1079.049] -- 0:09:49
193000 -- (-1097.193) [-1077.447] (-1089.259) (-1103.103) * [-1093.563] (-1082.297) (-1099.447) (-1091.643) -- 0:09:49
194000 -- (-1088.328) (-1095.104) (-1111.936) [-1089.872] * [-1083.070] (-1081.596) (-1082.895) (-1091.813) -- 0:09:45
195000 -- (-1092.681) (-1100.169) [-1083.921] (-1074.820) * (-1104.736) (-1085.135) [-1078.802] (-1100.825) -- 0:09:46
Average standard deviation of split frequencies: 0.018357
196000 -- (-1080.059) (-1084.660) (-1099.161) [-1083.787] * (-1096.983) (-1080.448) (-1084.765) [-1086.722] -- 0:09:46
197000 -- (-1097.892) (-1071.105) [-1075.759] (-1109.072) * (-1093.736) (-1087.420) (-1083.741) [-1083.490] -- 0:09:42
198000 -- (-1088.732) (-1101.935) [-1069.600] (-1085.049) * (-1088.236) (-1089.291) [-1092.166] (-1084.399) -- 0:09:43
199000 -- (-1095.150) (-1087.444) [-1091.762] (-1089.706) * [-1087.002] (-1101.308) (-1090.431) (-1083.742) -- 0:09:43
200000 -- (-1079.236) (-1097.720) (-1098.543) [-1080.964] * (-1083.504) [-1082.711] (-1096.558) (-1075.294) -- 0:09:44
Average standard deviation of split frequencies: 0.018010
201000 -- (-1095.617) [-1087.477] (-1100.078) (-1089.597) * (-1083.508) (-1086.990) (-1087.066) [-1075.989] -- 0:09:40
202000 -- [-1091.725] (-1095.556) (-1090.610) (-1092.444) * [-1083.881] (-1091.328) (-1084.362) (-1094.103) -- 0:09:40
203000 -- (-1088.739) [-1087.221] (-1082.341) (-1079.492) * (-1082.688) (-1080.644) (-1094.084) [-1090.914] -- 0:09:41
204000 -- [-1082.321] (-1102.375) (-1087.830) (-1093.212) * (-1094.906) [-1091.499] (-1097.988) (-1096.426) -- 0:09:41
205000 -- (-1087.884) (-1092.762) [-1091.426] (-1101.215) * (-1097.440) (-1087.908) [-1076.617] (-1082.721) -- 0:09:37
Average standard deviation of split frequencies: 0.015698
206000 -- [-1078.636] (-1088.471) (-1093.014) (-1094.709) * [-1088.619] (-1093.961) (-1082.748) (-1088.252) -- 0:09:38
207000 -- (-1093.195) [-1075.502] (-1103.272) (-1088.757) * [-1077.962] (-1097.907) (-1092.880) (-1093.246) -- 0:09:38
208000 -- (-1100.188) (-1080.646) (-1082.239) [-1077.729] * (-1090.951) [-1093.161] (-1090.688) (-1097.604) -- 0:09:38
209000 -- (-1094.433) (-1101.551) (-1097.090) [-1084.210] * (-1087.728) [-1078.219] (-1098.539) (-1093.911) -- 0:09:35
210000 -- (-1086.487) (-1083.176) (-1082.776) [-1075.833] * (-1097.930) (-1079.289) [-1084.945] (-1108.939) -- 0:09:35
Average standard deviation of split frequencies: 0.014903
211000 -- (-1090.744) (-1076.545) [-1083.803] (-1082.334) * (-1085.605) (-1097.414) (-1086.593) [-1086.269] -- 0:09:35
212000 -- (-1097.737) [-1078.180] (-1089.560) (-1089.614) * [-1074.952] (-1093.148) (-1093.273) (-1080.292) -- 0:09:32
213000 -- [-1091.099] (-1075.136) (-1106.394) (-1097.928) * [-1073.416] (-1096.742) (-1096.747) (-1088.735) -- 0:09:32
214000 -- (-1106.514) (-1077.329) [-1084.228] (-1087.287) * (-1091.694) [-1078.032] (-1099.619) (-1098.493) -- 0:09:32
215000 -- [-1096.877] (-1083.117) (-1089.455) (-1076.485) * (-1115.008) (-1091.064) (-1095.519) [-1084.971] -- 0:09:33
Average standard deviation of split frequencies: 0.014119
216000 -- (-1100.526) [-1080.060] (-1084.607) (-1093.243) * (-1094.281) [-1086.934] (-1080.827) (-1086.623) -- 0:09:29
217000 -- (-1089.790) (-1097.284) (-1084.617) [-1088.371] * (-1085.163) [-1097.820] (-1088.792) (-1088.476) -- 0:09:30
218000 -- (-1091.162) [-1074.719] (-1085.373) (-1091.065) * (-1090.095) (-1092.723) (-1093.840) [-1076.773] -- 0:09:30
219000 -- (-1097.858) (-1087.438) (-1082.720) [-1084.583] * (-1079.693) (-1101.763) [-1087.114] (-1082.863) -- 0:09:30
220000 -- (-1104.639) (-1091.030) (-1106.892) [-1081.174] * (-1095.374) (-1095.188) [-1067.742] (-1068.753) -- 0:09:27
Average standard deviation of split frequencies: 0.014780
221000 -- (-1108.045) (-1091.376) (-1093.871) [-1082.521] * (-1102.077) [-1098.064] (-1080.382) (-1090.099) -- 0:09:27
222000 -- (-1077.737) (-1094.324) [-1075.328] (-1085.482) * (-1081.824) (-1106.093) [-1078.876] (-1099.952) -- 0:09:27
223000 -- (-1095.840) (-1079.342) (-1083.555) [-1084.383] * [-1083.687] (-1085.553) (-1094.202) (-1109.023) -- 0:09:27
224000 -- (-1103.017) (-1105.112) (-1094.907) [-1082.957] * [-1081.566] (-1076.851) (-1081.089) (-1093.880) -- 0:09:24
225000 -- (-1078.055) (-1093.430) (-1091.851) [-1085.708] * [-1084.728] (-1075.983) (-1083.390) (-1078.914) -- 0:09:24
Average standard deviation of split frequencies: 0.015069
226000 -- (-1083.472) (-1103.545) [-1076.216] (-1094.011) * (-1100.554) (-1079.139) [-1086.487] (-1103.385) -- 0:09:25
227000 -- (-1102.208) (-1081.932) [-1079.278] (-1088.924) * (-1103.763) [-1082.576] (-1086.167) (-1097.266) -- 0:09:25
228000 -- [-1086.200] (-1093.143) (-1101.620) (-1082.327) * (-1101.813) [-1090.802] (-1081.098) (-1099.690) -- 0:09:22
229000 -- [-1077.622] (-1084.466) (-1095.668) (-1082.955) * [-1078.615] (-1087.669) (-1094.879) (-1104.028) -- 0:09:22
230000 -- [-1075.805] (-1092.735) (-1093.453) (-1088.896) * (-1100.466) (-1072.295) (-1105.268) [-1081.403] -- 0:09:22
Average standard deviation of split frequencies: 0.015614
231000 -- [-1074.969] (-1093.428) (-1082.642) (-1098.713) * (-1085.952) (-1105.007) (-1080.162) [-1081.961] -- 0:09:19
232000 -- (-1085.647) [-1082.743] (-1088.862) (-1096.125) * (-1080.858) (-1091.321) [-1079.824] (-1082.296) -- 0:09:19
233000 -- [-1073.155] (-1082.153) (-1089.216) (-1091.439) * [-1069.056] (-1094.039) (-1075.428) (-1092.666) -- 0:09:19
234000 -- (-1100.329) [-1092.559] (-1079.177) (-1086.769) * (-1084.228) (-1099.664) [-1086.416] (-1081.605) -- 0:09:19
235000 -- [-1079.576] (-1091.328) (-1093.655) (-1092.671) * [-1068.459] (-1071.172) (-1088.555) (-1098.715) -- 0:09:16
Average standard deviation of split frequencies: 0.016499
236000 -- (-1099.088) (-1092.957) (-1086.733) [-1080.849] * (-1087.901) (-1102.030) (-1089.790) [-1076.896] -- 0:09:16
237000 -- (-1086.131) (-1077.337) (-1096.030) [-1081.026] * [-1087.051] (-1097.209) (-1083.855) (-1069.249) -- 0:09:16
238000 -- (-1088.402) (-1089.782) [-1091.997] (-1089.625) * (-1094.475) (-1095.088) [-1088.937] (-1080.531) -- 0:09:17
239000 -- [-1089.443] (-1084.912) (-1095.342) (-1091.783) * (-1081.560) (-1096.173) (-1095.500) [-1081.051] -- 0:09:14
240000 -- (-1089.320) (-1096.785) [-1086.307] (-1117.217) * (-1081.005) (-1106.726) [-1084.355] (-1089.585) -- 0:09:14
Average standard deviation of split frequencies: 0.016589
241000 -- (-1088.859) (-1085.471) [-1082.851] (-1094.234) * [-1069.377] (-1086.073) (-1098.322) (-1080.899) -- 0:09:14
242000 -- (-1095.321) [-1082.605] (-1084.158) (-1084.164) * (-1073.893) (-1096.217) (-1107.385) [-1086.900] -- 0:09:14
243000 -- (-1079.122) (-1082.635) (-1075.760) [-1096.398] * [-1084.393] (-1105.615) (-1077.469) (-1094.158) -- 0:09:11
244000 -- [-1074.397] (-1101.539) (-1110.293) (-1079.527) * (-1093.071) (-1081.550) (-1085.122) [-1079.273] -- 0:09:11
245000 -- (-1097.759) (-1105.264) (-1074.463) [-1081.467] * (-1106.815) (-1071.994) (-1091.957) [-1078.618] -- 0:09:11
Average standard deviation of split frequencies: 0.015828
246000 -- (-1099.506) (-1093.730) [-1075.418] (-1082.840) * (-1089.575) [-1077.046] (-1084.342) (-1095.339) -- 0:09:11
247000 -- [-1071.911] (-1103.601) (-1088.877) (-1087.939) * (-1076.627) (-1102.404) (-1100.731) [-1072.388] -- 0:09:08
248000 -- [-1075.310] (-1096.680) (-1100.108) (-1077.890) * [-1076.770] (-1091.952) (-1101.781) (-1075.102) -- 0:09:08
249000 -- (-1081.161) [-1088.031] (-1084.051) (-1088.615) * [-1083.467] (-1093.641) (-1095.487) (-1082.744) -- 0:09:08
250000 -- (-1094.305) (-1099.492) (-1096.086) [-1082.419] * [-1070.054] (-1102.759) (-1091.103) (-1085.572) -- 0:09:06
Average standard deviation of split frequencies: 0.013804
251000 -- [-1086.023] (-1090.372) (-1087.429) (-1083.846) * (-1073.780) [-1096.690] (-1098.608) (-1085.097) -- 0:09:06
252000 -- (-1094.120) (-1081.963) (-1089.843) [-1083.219] * (-1084.612) (-1088.190) (-1099.900) [-1082.417] -- 0:09:06
253000 -- (-1102.298) (-1094.104) (-1088.206) [-1071.317] * (-1104.348) [-1101.917] (-1087.160) (-1082.844) -- 0:09:06
254000 -- (-1073.257) [-1080.609] (-1096.125) (-1090.000) * (-1093.763) [-1081.596] (-1111.652) (-1096.531) -- 0:09:03
255000 -- (-1067.898) [-1082.805] (-1093.070) (-1108.724) * (-1101.589) (-1086.687) (-1088.955) [-1085.223] -- 0:09:03
Average standard deviation of split frequencies: 0.013700
256000 -- [-1081.669] (-1084.707) (-1092.148) (-1096.507) * (-1095.317) (-1100.723) [-1077.074] (-1090.230) -- 0:09:03
257000 -- (-1085.758) [-1085.814] (-1087.165) (-1092.088) * (-1083.971) [-1099.022] (-1095.578) (-1094.069) -- 0:09:03
258000 -- (-1105.498) (-1081.772) [-1081.827] (-1094.431) * (-1095.582) [-1092.792] (-1091.089) (-1105.433) -- 0:09:00
259000 -- (-1088.913) (-1096.133) [-1083.102] (-1097.563) * [-1085.980] (-1096.537) (-1085.109) (-1090.818) -- 0:09:00
260000 -- [-1093.112] (-1091.763) (-1103.437) (-1084.185) * (-1100.486) (-1087.693) [-1084.463] (-1089.369) -- 0:09:00
Average standard deviation of split frequencies: 0.013840
261000 -- [-1083.059] (-1084.625) (-1112.714) (-1085.979) * (-1087.206) (-1077.290) [-1098.109] (-1101.795) -- 0:08:57
262000 -- (-1106.738) (-1075.742) (-1089.614) [-1082.004] * [-1084.022] (-1084.361) (-1093.882) (-1088.725) -- 0:08:58
263000 -- (-1093.343) [-1068.021] (-1097.380) (-1092.969) * (-1101.250) [-1078.773] (-1090.140) (-1095.520) -- 0:08:58
264000 -- (-1093.465) [-1070.940] (-1081.911) (-1091.041) * [-1071.506] (-1092.260) (-1095.659) (-1099.182) -- 0:08:58
265000 -- (-1089.569) (-1098.368) (-1082.883) [-1091.373] * (-1080.939) (-1088.873) [-1094.542] (-1084.461) -- 0:08:55
Average standard deviation of split frequencies: 0.014250
266000 -- [-1076.109] (-1103.770) (-1081.151) (-1095.446) * (-1096.534) [-1094.971] (-1108.796) (-1087.260) -- 0:08:55
267000 -- (-1099.895) [-1093.620] (-1087.661) (-1098.128) * [-1087.134] (-1090.811) (-1120.640) (-1087.458) -- 0:08:55
268000 -- (-1077.266) (-1104.323) (-1101.268) [-1082.928] * (-1095.788) (-1093.063) (-1095.114) [-1078.011] -- 0:08:52
269000 -- [-1079.382] (-1091.906) (-1089.956) (-1089.594) * (-1086.920) (-1103.908) [-1089.244] (-1095.433) -- 0:08:52
270000 -- (-1084.154) (-1097.018) (-1088.681) [-1082.125] * (-1089.722) (-1088.842) (-1101.799) [-1075.092] -- 0:08:52
Average standard deviation of split frequencies: 0.013045
271000 -- (-1079.120) [-1092.134] (-1100.012) (-1091.032) * (-1087.750) [-1082.513] (-1092.231) (-1106.740) -- 0:08:52
272000 -- (-1077.121) [-1075.823] (-1086.963) (-1082.982) * (-1102.746) [-1075.708] (-1104.915) (-1085.269) -- 0:08:49
273000 -- (-1093.459) [-1092.781] (-1099.757) (-1091.874) * (-1074.838) (-1087.027) (-1089.667) [-1075.265] -- 0:08:49
274000 -- (-1091.911) [-1075.498] (-1080.719) (-1094.661) * (-1089.822) [-1080.629] (-1100.182) (-1090.775) -- 0:08:49
275000 -- (-1104.114) (-1096.726) (-1080.319) [-1084.702] * (-1082.547) (-1098.941) [-1082.426] (-1096.127) -- 0:08:47
Average standard deviation of split frequencies: 0.013699
276000 -- (-1100.445) (-1085.034) (-1082.127) [-1092.187] * (-1079.141) (-1099.838) [-1070.344] (-1089.220) -- 0:08:47
277000 -- (-1098.537) (-1082.109) (-1081.980) [-1084.772] * (-1095.052) (-1098.315) [-1070.549] (-1082.195) -- 0:08:47
278000 -- (-1085.358) (-1098.845) [-1071.511] (-1091.292) * [-1071.537] (-1086.043) (-1090.244) (-1095.271) -- 0:08:47
279000 -- (-1081.264) (-1084.717) [-1077.613] (-1083.891) * [-1079.921] (-1085.236) (-1098.003) (-1092.420) -- 0:08:44
280000 -- (-1092.222) (-1090.869) [-1079.947] (-1092.342) * (-1085.840) (-1089.203) [-1081.666] (-1076.809) -- 0:08:44
Average standard deviation of split frequencies: 0.013779
281000 -- [-1088.434] (-1094.239) (-1084.903) (-1090.045) * (-1088.903) (-1097.377) [-1082.990] (-1089.937) -- 0:08:44
282000 -- [-1081.432] (-1091.324) (-1102.037) (-1098.351) * [-1080.013] (-1085.431) (-1107.998) (-1076.521) -- 0:08:44
283000 -- (-1085.772) [-1083.610] (-1093.459) (-1085.513) * (-1084.413) [-1075.036] (-1085.835) (-1085.234) -- 0:08:41
284000 -- (-1089.219) (-1071.289) [-1079.800] (-1109.998) * (-1089.057) (-1089.434) [-1080.103] (-1083.940) -- 0:08:41
285000 -- (-1078.931) [-1075.594] (-1086.394) (-1092.292) * (-1096.701) [-1085.234] (-1087.529) (-1093.912) -- 0:08:41
Average standard deviation of split frequencies: 0.013085
286000 -- [-1076.412] (-1085.720) (-1086.020) (-1093.166) * (-1094.237) (-1100.367) (-1093.937) [-1084.857] -- 0:08:39
287000 -- (-1088.410) [-1074.851] (-1079.929) (-1100.661) * (-1082.890) (-1112.784) (-1112.733) [-1081.255] -- 0:08:39
288000 -- (-1089.961) (-1084.472) [-1081.047] (-1100.860) * (-1085.761) [-1077.218] (-1087.753) (-1089.771) -- 0:08:39
289000 -- (-1101.296) (-1085.801) [-1081.735] (-1107.614) * [-1077.492] (-1108.101) (-1091.759) (-1082.794) -- 0:08:39
290000 -- (-1093.472) [-1084.288] (-1091.065) (-1083.513) * [-1081.728] (-1089.967) (-1090.924) (-1078.515) -- 0:08:36
Average standard deviation of split frequencies: 0.012445
291000 -- (-1107.821) (-1088.781) [-1072.979] (-1086.345) * (-1095.264) (-1099.043) (-1086.305) [-1076.731] -- 0:08:36
292000 -- [-1074.690] (-1102.910) (-1076.661) (-1098.787) * [-1083.074] (-1091.685) (-1082.326) (-1075.236) -- 0:08:36
293000 -- (-1081.243) (-1094.558) [-1078.015] (-1091.577) * [-1080.829] (-1108.498) (-1081.700) (-1086.973) -- 0:08:33
294000 -- [-1097.288] (-1086.538) (-1078.441) (-1088.782) * [-1084.845] (-1119.993) (-1080.496) (-1093.307) -- 0:08:33
295000 -- (-1096.861) (-1091.696) (-1099.026) [-1075.264] * (-1096.041) (-1111.950) (-1087.384) [-1093.444] -- 0:08:33
Average standard deviation of split frequencies: 0.012091
296000 -- (-1085.437) (-1095.332) (-1107.147) [-1088.560] * (-1099.286) (-1105.644) [-1074.039] (-1081.187) -- 0:08:33
297000 -- [-1071.768] (-1089.003) (-1095.162) (-1080.291) * [-1083.998] (-1086.792) (-1080.756) (-1092.367) -- 0:08:31
298000 -- (-1093.555) (-1090.526) [-1076.732] (-1083.170) * [-1076.131] (-1095.995) (-1084.186) (-1096.687) -- 0:08:31
299000 -- (-1083.844) [-1084.728] (-1084.807) (-1091.504) * (-1091.273) (-1089.401) [-1074.031] (-1084.540) -- 0:08:31
300000 -- [-1086.258] (-1085.133) (-1113.263) (-1096.463) * (-1084.133) [-1082.900] (-1087.954) (-1076.880) -- 0:08:31
Average standard deviation of split frequencies: 0.012639
301000 -- [-1079.898] (-1079.609) (-1103.519) (-1104.359) * (-1096.822) [-1072.983] (-1087.625) (-1102.143) -- 0:08:28
302000 -- [-1088.709] (-1080.404) (-1096.410) (-1106.488) * (-1082.745) (-1070.426) (-1088.971) [-1098.020] -- 0:08:28
303000 -- (-1086.461) (-1073.695) [-1086.774] (-1098.090) * (-1089.897) (-1090.725) (-1092.774) [-1091.884] -- 0:08:28
304000 -- (-1104.395) [-1075.322] (-1092.769) (-1080.094) * (-1081.567) [-1087.003] (-1087.621) (-1099.113) -- 0:08:25
305000 -- (-1089.051) (-1091.852) [-1083.362] (-1085.235) * [-1083.013] (-1091.995) (-1084.929) (-1084.613) -- 0:08:25
Average standard deviation of split frequencies: 0.012230
306000 -- (-1081.164) (-1092.906) (-1086.333) [-1083.889] * [-1085.929] (-1092.096) (-1080.283) (-1085.745) -- 0:08:25
307000 -- (-1091.495) (-1094.377) (-1083.955) [-1073.953] * (-1087.543) (-1094.328) (-1100.731) [-1070.109] -- 0:08:25
308000 -- [-1087.231] (-1101.648) (-1080.716) (-1069.653) * [-1085.120] (-1091.518) (-1091.589) (-1076.652) -- 0:08:23
309000 -- (-1085.091) [-1087.604] (-1088.885) (-1085.207) * (-1077.774) (-1081.264) (-1086.868) [-1077.704] -- 0:08:23
310000 -- (-1088.451) (-1089.050) [-1083.016] (-1120.769) * (-1086.964) (-1101.647) [-1084.355] (-1088.035) -- 0:08:23
Average standard deviation of split frequencies: 0.013099
311000 -- [-1079.279] (-1086.987) (-1099.265) (-1088.051) * (-1095.023) (-1086.536) [-1072.070] (-1084.058) -- 0:08:22
312000 -- (-1090.200) (-1097.982) (-1082.577) [-1089.447] * (-1108.380) (-1074.037) [-1075.615] (-1083.066) -- 0:08:20
313000 -- (-1080.156) (-1092.572) (-1098.449) [-1076.708] * (-1087.674) [-1082.193] (-1099.951) (-1086.440) -- 0:08:20
314000 -- [-1088.980] (-1086.059) (-1079.166) (-1095.804) * [-1092.419] (-1094.711) (-1094.659) (-1112.114) -- 0:08:20
315000 -- [-1078.504] (-1082.649) (-1084.421) (-1103.179) * (-1095.505) (-1101.302) [-1081.112] (-1097.037) -- 0:08:20
Average standard deviation of split frequencies: 0.013213
316000 -- (-1093.379) [-1080.395] (-1083.912) (-1083.450) * (-1093.740) (-1105.704) [-1079.589] (-1095.819) -- 0:08:17
317000 -- (-1084.969) (-1089.810) (-1086.974) [-1081.117] * [-1088.017] (-1107.261) (-1074.447) (-1105.018) -- 0:08:17
318000 -- (-1076.481) (-1092.373) (-1100.069) [-1082.532] * (-1095.193) (-1092.664) [-1072.449] (-1099.820) -- 0:08:17
319000 -- (-1083.891) (-1098.326) (-1102.915) [-1086.683] * (-1082.794) (-1083.858) [-1083.383] (-1094.096) -- 0:08:17
320000 -- [-1075.579] (-1087.937) (-1094.647) (-1098.978) * (-1093.981) (-1075.201) (-1109.203) [-1088.487] -- 0:08:15
Average standard deviation of split frequencies: 0.012584
321000 -- [-1083.295] (-1084.791) (-1100.086) (-1102.584) * (-1087.261) [-1068.970] (-1100.885) (-1092.243) -- 0:08:14
322000 -- (-1102.829) [-1075.743] (-1084.619) (-1067.906) * [-1077.088] (-1092.914) (-1105.097) (-1086.397) -- 0:08:14
323000 -- (-1090.543) (-1089.630) (-1085.486) [-1081.742] * (-1077.471) [-1089.154] (-1104.734) (-1084.587) -- 0:08:12
324000 -- (-1097.406) (-1093.847) (-1103.817) [-1087.172] * (-1092.667) [-1078.660] (-1105.803) (-1092.125) -- 0:08:12
325000 -- [-1093.046] (-1099.972) (-1081.597) (-1094.265) * (-1094.166) (-1069.122) [-1085.532] (-1099.231) -- 0:08:12
Average standard deviation of split frequencies: 0.012291
326000 -- [-1074.168] (-1097.176) (-1103.850) (-1096.299) * (-1085.489) [-1080.924] (-1089.546) (-1089.615) -- 0:08:12
327000 -- (-1090.619) (-1083.198) [-1087.039] (-1092.696) * (-1099.489) [-1076.977] (-1095.482) (-1094.383) -- 0:08:09
328000 -- [-1093.170] (-1089.580) (-1109.018) (-1106.671) * (-1093.045) (-1095.687) (-1098.152) [-1078.604] -- 0:08:09
329000 -- (-1096.626) (-1095.548) (-1083.629) [-1081.957] * (-1081.387) (-1097.939) [-1089.726] (-1099.683) -- 0:08:09
330000 -- (-1101.598) (-1102.821) (-1093.050) [-1081.589] * (-1077.547) [-1080.566] (-1114.126) (-1103.213) -- 0:08:09
Average standard deviation of split frequencies: 0.012032
331000 -- (-1104.320) (-1083.851) [-1085.183] (-1088.905) * (-1085.478) [-1075.330] (-1099.146) (-1100.065) -- 0:08:07
332000 -- (-1086.336) [-1089.058] (-1100.416) (-1089.137) * (-1107.772) (-1084.296) [-1083.388] (-1093.261) -- 0:08:06
333000 -- [-1076.345] (-1084.785) (-1093.564) (-1083.220) * (-1088.231) [-1088.848] (-1098.613) (-1075.093) -- 0:08:06
334000 -- (-1078.156) (-1078.873) (-1101.499) [-1077.741] * (-1084.326) (-1103.176) [-1075.352] (-1087.544) -- 0:08:06
335000 -- (-1082.624) [-1090.416] (-1094.256) (-1091.231) * (-1089.950) (-1094.023) [-1074.460] (-1096.084) -- 0:08:04
Average standard deviation of split frequencies: 0.012026
336000 -- [-1072.534] (-1069.797) (-1088.089) (-1096.580) * (-1086.972) (-1085.214) [-1071.017] (-1097.321) -- 0:08:04
337000 -- (-1093.579) (-1083.784) [-1083.133] (-1090.098) * (-1085.054) (-1092.397) [-1071.129] (-1095.501) -- 0:08:03
338000 -- (-1089.130) [-1075.837] (-1090.614) (-1078.326) * (-1099.431) (-1085.667) [-1077.105] (-1105.222) -- 0:08:03
339000 -- (-1079.043) (-1082.688) [-1075.935] (-1093.690) * (-1087.806) (-1098.575) (-1086.051) [-1081.550] -- 0:08:01
340000 -- (-1098.069) [-1077.218] (-1077.068) (-1103.428) * (-1111.116) [-1079.611] (-1082.138) (-1104.601) -- 0:08:01
Average standard deviation of split frequencies: 0.011679
341000 -- (-1115.633) (-1092.776) [-1094.022] (-1078.015) * (-1113.102) [-1078.958] (-1082.125) (-1081.681) -- 0:08:01
342000 -- [-1082.857] (-1091.091) (-1101.339) (-1096.622) * (-1100.294) [-1072.566] (-1080.160) (-1090.142) -- 0:08:00
343000 -- (-1102.797) [-1081.814] (-1087.455) (-1089.367) * (-1090.876) (-1081.498) [-1070.125] (-1082.064) -- 0:07:58
344000 -- (-1095.124) (-1092.430) [-1074.630] (-1098.713) * (-1090.454) [-1081.437] (-1085.877) (-1084.380) -- 0:07:58
345000 -- (-1097.128) (-1105.134) [-1079.827] (-1089.274) * [-1089.867] (-1097.464) (-1089.056) (-1080.312) -- 0:07:58
Average standard deviation of split frequencies: 0.011928
346000 -- (-1099.078) [-1078.301] (-1102.691) (-1082.903) * (-1099.595) (-1083.054) (-1096.399) [-1085.491] -- 0:07:58
347000 -- [-1090.220] (-1079.336) (-1113.301) (-1085.955) * (-1093.867) (-1082.978) (-1089.375) [-1080.611] -- 0:07:56
348000 -- (-1084.844) (-1097.662) [-1103.160] (-1099.219) * [-1076.747] (-1079.710) (-1098.918) (-1083.559) -- 0:07:55
349000 -- (-1097.586) (-1085.675) (-1080.993) [-1086.284] * [-1083.878] (-1083.908) (-1099.203) (-1094.024) -- 0:07:55
350000 -- (-1099.008) (-1090.388) [-1077.628] (-1086.987) * [-1077.371] (-1091.963) (-1085.731) (-1110.295) -- 0:07:55
Average standard deviation of split frequencies: 0.011385
351000 -- (-1096.910) (-1099.709) (-1089.105) [-1104.421] * [-1083.092] (-1080.061) (-1092.253) (-1103.425) -- 0:07:53
352000 -- (-1090.484) [-1086.842] (-1108.356) (-1086.735) * (-1087.028) (-1099.631) [-1079.343] (-1101.994) -- 0:07:53
353000 -- (-1097.195) [-1090.534] (-1096.887) (-1095.498) * (-1100.133) (-1091.559) [-1079.440] (-1099.811) -- 0:07:52
354000 -- (-1088.036) [-1085.811] (-1084.309) (-1093.603) * (-1105.787) (-1082.172) [-1094.205] (-1103.465) -- 0:07:50
355000 -- (-1079.826) [-1078.376] (-1081.638) (-1093.846) * (-1090.711) (-1088.279) [-1096.747] (-1114.561) -- 0:07:50
Average standard deviation of split frequencies: 0.010514
356000 -- [-1086.189] (-1087.172) (-1078.602) (-1104.225) * [-1075.188] (-1077.900) (-1113.865) (-1095.201) -- 0:07:50
357000 -- (-1094.081) (-1105.109) [-1086.278] (-1106.304) * (-1073.637) (-1090.019) (-1101.360) [-1088.587] -- 0:07:50
358000 -- (-1074.247) [-1075.556] (-1099.340) (-1090.689) * [-1082.930] (-1094.904) (-1082.669) (-1096.141) -- 0:07:48
359000 -- (-1090.150) (-1089.979) [-1093.630] (-1076.161) * (-1094.510) (-1094.990) [-1094.126] (-1100.589) -- 0:07:47
360000 -- (-1093.382) (-1080.008) [-1084.136] (-1090.199) * (-1091.126) [-1078.698] (-1086.493) (-1093.706) -- 0:07:47
Average standard deviation of split frequencies: 0.010865
361000 -- (-1088.279) (-1104.772) [-1075.641] (-1075.186) * [-1085.879] (-1085.479) (-1091.445) (-1093.119) -- 0:07:47
362000 -- (-1090.690) (-1092.892) (-1088.738) [-1080.071] * (-1087.019) (-1090.652) [-1082.590] (-1089.067) -- 0:07:45
363000 -- (-1089.190) (-1092.719) (-1090.324) [-1067.534] * (-1095.993) (-1099.063) (-1103.468) [-1082.771] -- 0:07:45
364000 -- (-1100.030) (-1102.742) (-1088.761) [-1085.313] * [-1085.416] (-1088.223) (-1123.380) (-1082.901) -- 0:07:44
365000 -- (-1090.875) (-1102.222) [-1071.670] (-1075.448) * (-1080.838) (-1085.333) (-1105.487) [-1085.192] -- 0:07:42
Average standard deviation of split frequencies: 0.011102
366000 -- (-1091.851) (-1089.291) [-1086.159] (-1082.219) * [-1082.583] (-1087.037) (-1083.551) (-1101.904) -- 0:07:42
367000 -- (-1109.980) (-1094.705) (-1109.541) [-1090.943] * (-1097.739) (-1078.950) [-1075.094] (-1093.876) -- 0:07:42
368000 -- (-1084.180) [-1082.583] (-1112.142) (-1093.026) * (-1081.635) (-1087.354) (-1080.087) [-1086.654] -- 0:07:41
369000 -- [-1091.438] (-1087.264) (-1099.024) (-1076.656) * (-1091.434) [-1078.284] (-1095.956) (-1086.122) -- 0:07:39
370000 -- [-1086.174] (-1099.118) (-1075.799) (-1114.079) * (-1089.411) [-1074.120] (-1097.771) (-1093.294) -- 0:07:39
Average standard deviation of split frequencies: 0.011497
371000 -- (-1083.279) [-1079.729] (-1091.305) (-1093.581) * (-1089.541) [-1079.819] (-1104.114) (-1096.383) -- 0:07:39
372000 -- (-1083.566) (-1091.086) (-1082.125) [-1083.718] * [-1078.732] (-1080.207) (-1087.598) (-1084.166) -- 0:07:39
373000 -- (-1078.481) (-1089.119) (-1075.874) [-1086.910] * (-1082.517) [-1101.510] (-1090.014) (-1092.577) -- 0:07:37
374000 -- [-1072.702] (-1091.701) (-1081.196) (-1096.559) * [-1088.882] (-1077.863) (-1101.871) (-1112.399) -- 0:07:36
375000 -- (-1072.484) (-1093.536) [-1073.123] (-1095.278) * (-1090.506) [-1080.272] (-1093.865) (-1105.798) -- 0:07:36
Average standard deviation of split frequencies: 0.011835
376000 -- (-1092.577) (-1103.314) (-1094.777) [-1093.721] * (-1087.365) (-1085.957) [-1094.341] (-1109.072) -- 0:07:34
377000 -- [-1080.749] (-1085.652) (-1076.773) (-1095.322) * (-1082.913) [-1072.906] (-1107.214) (-1095.387) -- 0:07:34
378000 -- (-1084.450) [-1081.319] (-1086.022) (-1093.076) * (-1077.932) [-1077.630] (-1105.979) (-1093.957) -- 0:07:34
379000 -- (-1088.673) [-1079.466] (-1080.126) (-1090.645) * (-1081.414) [-1080.689] (-1090.090) (-1096.038) -- 0:07:33
380000 -- (-1092.554) [-1080.959] (-1097.224) (-1074.421) * (-1087.504) (-1088.587) (-1084.289) [-1089.952] -- 0:07:31
Average standard deviation of split frequencies: 0.011170
381000 -- (-1094.987) [-1076.995] (-1086.691) (-1113.529) * (-1094.572) [-1101.638] (-1079.753) (-1092.918) -- 0:07:31
382000 -- [-1086.022] (-1083.261) (-1101.119) (-1080.755) * (-1087.258) (-1087.530) [-1085.831] (-1084.326) -- 0:07:31
383000 -- (-1079.070) (-1091.792) [-1086.771] (-1100.129) * (-1094.036) (-1107.904) [-1088.744] (-1089.895) -- 0:07:29
384000 -- (-1079.256) (-1095.141) [-1073.813] (-1096.775) * (-1074.677) (-1114.968) [-1084.482] (-1087.344) -- 0:07:29
385000 -- (-1086.953) [-1071.055] (-1100.423) (-1106.059) * (-1081.971) (-1100.825) (-1091.183) [-1090.653] -- 0:07:28
Average standard deviation of split frequencies: 0.010464
386000 -- (-1094.566) [-1075.477] (-1094.722) (-1078.324) * [-1075.351] (-1086.804) (-1096.015) (-1088.102) -- 0:07:28
387000 -- (-1077.100) (-1092.600) (-1091.786) [-1089.801] * [-1071.594] (-1098.236) (-1096.889) (-1085.314) -- 0:07:26
388000 -- (-1075.094) [-1077.303] (-1095.177) (-1092.282) * (-1104.436) [-1073.100] (-1095.202) (-1098.387) -- 0:07:26
389000 -- (-1089.205) (-1074.492) [-1096.685] (-1093.241) * [-1089.285] (-1086.306) (-1092.399) (-1116.316) -- 0:07:26
390000 -- (-1096.797) (-1077.192) (-1082.825) [-1084.118] * (-1076.902) [-1070.298] (-1082.781) (-1101.603) -- 0:07:25
Average standard deviation of split frequencies: 0.010718
391000 -- (-1109.075) [-1084.209] (-1085.675) (-1097.587) * (-1078.182) [-1076.576] (-1072.755) (-1096.743) -- 0:07:23
392000 -- (-1097.676) [-1077.685] (-1085.952) (-1093.689) * [-1076.864] (-1096.123) (-1084.680) (-1109.572) -- 0:07:23
393000 -- [-1081.410] (-1087.622) (-1082.745) (-1088.874) * [-1083.536] (-1088.838) (-1097.205) (-1097.245) -- 0:07:23
394000 -- (-1081.409) [-1086.787] (-1082.102) (-1094.449) * (-1106.209) (-1092.323) [-1076.070] (-1095.484) -- 0:07:21
395000 -- [-1088.645] (-1077.619) (-1083.151) (-1077.741) * (-1089.132) [-1070.937] (-1085.605) (-1084.402) -- 0:07:21
Average standard deviation of split frequencies: 0.010200
396000 -- (-1079.194) (-1092.653) (-1087.909) [-1079.139] * (-1081.304) (-1083.260) [-1094.319] (-1092.988) -- 0:07:20
397000 -- [-1073.905] (-1088.683) (-1108.442) (-1087.297) * (-1073.801) (-1089.423) (-1084.304) [-1080.469] -- 0:07:20
398000 -- (-1091.444) [-1088.646] (-1106.862) (-1094.861) * [-1087.376] (-1097.338) (-1082.777) (-1088.765) -- 0:07:18
399000 -- [-1084.019] (-1091.839) (-1104.807) (-1074.154) * (-1089.097) (-1087.424) (-1098.166) [-1067.573] -- 0:07:18
400000 -- [-1075.377] (-1091.158) (-1084.760) (-1101.676) * (-1079.846) [-1089.062] (-1085.978) (-1095.024) -- 0:07:18
Average standard deviation of split frequencies: 0.009966
401000 -- (-1082.678) (-1097.515) (-1101.850) [-1097.450] * [-1084.789] (-1094.024) (-1100.241) (-1085.676) -- 0:07:17
402000 -- (-1092.823) [-1097.669] (-1110.320) (-1085.154) * (-1101.211) (-1100.000) [-1080.827] (-1089.321) -- 0:07:15
403000 -- [-1090.971] (-1092.060) (-1104.115) (-1094.366) * (-1082.659) (-1113.119) (-1081.364) [-1080.047] -- 0:07:15
404000 -- (-1089.848) (-1082.697) (-1103.141) [-1092.808] * (-1089.987) (-1097.743) (-1090.872) [-1080.063] -- 0:07:15
405000 -- (-1095.580) (-1087.733) (-1103.048) [-1090.734] * (-1098.055) (-1107.512) (-1083.073) [-1089.347] -- 0:07:14
Average standard deviation of split frequencies: 0.009812
406000 -- (-1096.935) (-1078.833) (-1119.563) [-1085.567] * (-1089.846) (-1079.785) [-1075.845] (-1091.926) -- 0:07:13
407000 -- (-1097.466) (-1087.045) [-1076.614] (-1095.995) * (-1087.653) (-1100.013) [-1068.454] (-1085.215) -- 0:07:12
408000 -- (-1071.586) (-1107.026) [-1065.780] (-1088.013) * (-1088.080) (-1110.357) [-1073.066] (-1097.533) -- 0:07:12
409000 -- [-1083.265] (-1092.093) (-1098.222) (-1088.626) * (-1090.759) (-1109.720) (-1069.011) [-1078.892] -- 0:07:10
410000 -- (-1079.317) (-1083.239) [-1071.690] (-1086.598) * (-1076.116) [-1081.099] (-1091.096) (-1095.467) -- 0:07:10
Average standard deviation of split frequencies: 0.009881
411000 -- (-1107.474) (-1086.874) [-1086.233] (-1087.453) * (-1069.676) [-1082.322] (-1114.195) (-1105.575) -- 0:07:09
412000 -- (-1093.028) (-1081.394) [-1080.349] (-1084.490) * [-1073.232] (-1087.111) (-1090.855) (-1086.603) -- 0:07:09
413000 -- (-1091.520) (-1087.918) [-1086.530] (-1107.634) * [-1078.755] (-1093.490) (-1083.036) (-1088.101) -- 0:07:07
414000 -- [-1088.088] (-1097.356) (-1111.170) (-1083.335) * [-1076.286] (-1099.128) (-1099.521) (-1086.305) -- 0:07:07
415000 -- (-1091.991) (-1094.660) [-1081.941] (-1100.065) * (-1079.300) [-1077.224] (-1103.670) (-1086.128) -- 0:07:07
Average standard deviation of split frequencies: 0.010289
416000 -- [-1092.470] (-1086.843) (-1082.892) (-1091.975) * (-1091.231) [-1075.418] (-1093.046) (-1105.631) -- 0:07:06
417000 -- (-1095.541) (-1085.694) (-1091.966) [-1086.641] * [-1088.651] (-1087.066) (-1088.673) (-1093.796) -- 0:07:05
418000 -- (-1076.874) (-1096.028) (-1099.971) [-1081.334] * (-1101.854) (-1081.733) [-1078.627] (-1080.411) -- 0:07:04
419000 -- (-1076.717) [-1091.877] (-1112.049) (-1076.428) * (-1089.721) (-1094.070) [-1077.413] (-1079.552) -- 0:07:04
420000 -- (-1104.587) (-1087.646) (-1092.636) [-1070.549] * (-1075.166) (-1099.260) (-1076.795) [-1075.982] -- 0:07:03
Average standard deviation of split frequencies: 0.010354
421000 -- (-1081.251) [-1088.315] (-1096.033) (-1088.745) * (-1092.562) (-1078.996) (-1095.133) [-1093.599] -- 0:07:02
422000 -- [-1070.168] (-1103.069) (-1105.630) (-1083.514) * (-1092.155) [-1074.998] (-1084.083) (-1097.122) -- 0:07:01
423000 -- (-1091.833) [-1089.048] (-1096.268) (-1086.520) * (-1100.513) (-1097.929) [-1073.910] (-1079.615) -- 0:07:01
424000 -- (-1088.477) (-1081.818) (-1106.328) [-1075.408] * (-1096.202) (-1092.936) [-1076.740] (-1083.682) -- 0:07:01
425000 -- [-1085.670] (-1079.672) (-1098.110) (-1084.807) * (-1086.196) (-1082.013) [-1075.635] (-1100.166) -- 0:06:59
Average standard deviation of split frequencies: 0.009742
426000 -- [-1088.585] (-1095.234) (-1097.710) (-1081.338) * (-1088.181) (-1101.182) [-1080.663] (-1087.429) -- 0:06:59
427000 -- (-1107.192) [-1086.055] (-1099.860) (-1083.312) * [-1084.496] (-1086.806) (-1092.268) (-1088.408) -- 0:06:58
428000 -- [-1087.292] (-1100.226) (-1081.876) (-1108.963) * (-1095.775) (-1101.884) [-1082.965] (-1083.403) -- 0:06:56
429000 -- (-1093.024) (-1100.957) [-1077.318] (-1103.594) * [-1098.848] (-1097.683) (-1091.087) (-1091.400) -- 0:06:56
430000 -- (-1086.962) (-1093.643) (-1087.447) [-1081.543] * (-1091.936) (-1074.833) [-1079.990] (-1104.828) -- 0:06:56
Average standard deviation of split frequencies: 0.010152
431000 -- (-1097.794) (-1086.630) [-1073.029] (-1099.510) * (-1091.104) [-1070.787] (-1097.829) (-1100.321) -- 0:06:55
432000 -- [-1078.104] (-1097.299) (-1079.406) (-1088.067) * (-1097.252) [-1080.000] (-1091.458) (-1099.643) -- 0:06:54
433000 -- (-1073.367) [-1081.685] (-1096.373) (-1095.592) * (-1086.753) (-1075.729) [-1075.526] (-1095.102) -- 0:06:53
434000 -- [-1086.923] (-1086.564) (-1089.354) (-1073.633) * [-1085.015] (-1088.503) (-1089.956) (-1076.157) -- 0:06:53
435000 -- [-1088.164] (-1089.221) (-1087.689) (-1074.099) * (-1088.642) (-1109.450) (-1108.054) [-1081.606] -- 0:06:53
Average standard deviation of split frequencies: 0.010261
436000 -- [-1084.102] (-1077.446) (-1081.386) (-1100.553) * (-1107.645) (-1109.541) [-1096.709] (-1085.634) -- 0:06:51
437000 -- (-1095.629) [-1078.220] (-1088.022) (-1096.317) * (-1096.446) (-1090.822) [-1073.495] (-1078.518) -- 0:06:50
438000 -- (-1087.727) [-1078.063] (-1083.438) (-1097.063) * (-1109.964) (-1095.876) [-1079.167] (-1093.673) -- 0:06:50
439000 -- (-1103.869) (-1088.588) [-1086.664] (-1105.942) * (-1102.703) (-1081.973) [-1085.464] (-1076.339) -- 0:06:50
440000 -- (-1103.815) [-1081.818] (-1090.086) (-1095.731) * (-1097.911) (-1085.444) [-1081.224] (-1085.205) -- 0:06:48
Average standard deviation of split frequencies: 0.010089
441000 -- (-1089.153) (-1080.165) [-1082.456] (-1100.555) * (-1107.344) [-1079.500] (-1094.350) (-1088.039) -- 0:06:48
442000 -- (-1092.454) (-1089.008) (-1088.004) [-1076.103] * [-1096.941] (-1080.837) (-1087.811) (-1091.524) -- 0:06:47
443000 -- (-1102.822) (-1088.407) [-1084.875] (-1099.766) * (-1102.490) (-1084.697) (-1087.530) [-1085.169] -- 0:06:47
444000 -- (-1093.354) [-1087.595] (-1082.961) (-1096.924) * (-1103.789) (-1080.027) [-1086.989] (-1083.842) -- 0:06:45
445000 -- (-1087.804) [-1086.870] (-1077.223) (-1089.261) * (-1095.872) [-1084.322] (-1084.088) (-1092.910) -- 0:06:45
Average standard deviation of split frequencies: 0.010217
446000 -- [-1090.265] (-1092.607) (-1078.625) (-1088.384) * (-1094.988) (-1095.958) (-1078.332) [-1082.710] -- 0:06:44
447000 -- (-1081.705) (-1089.930) [-1068.424] (-1085.655) * [-1086.693] (-1093.998) (-1093.131) (-1088.319) -- 0:06:44
448000 -- (-1112.355) [-1088.290] (-1089.275) (-1082.790) * (-1089.913) (-1091.060) [-1098.030] (-1093.167) -- 0:06:42
449000 -- (-1078.837) (-1101.574) (-1101.801) [-1078.710] * (-1089.508) (-1092.840) [-1087.534] (-1073.594) -- 0:06:42
450000 -- (-1082.312) (-1094.267) (-1087.893) [-1091.666] * (-1083.643) (-1085.463) (-1102.689) [-1076.358] -- 0:06:42
Average standard deviation of split frequencies: 0.010317
451000 -- (-1086.838) (-1097.152) (-1093.504) [-1076.980] * (-1080.125) (-1088.681) (-1114.342) [-1072.810] -- 0:06:40
452000 -- (-1074.056) (-1101.616) (-1096.564) [-1083.166] * (-1082.328) (-1096.657) (-1091.278) [-1088.379] -- 0:06:40
453000 -- [-1073.615] (-1090.463) (-1095.887) (-1087.704) * (-1076.060) [-1081.486] (-1108.609) (-1088.680) -- 0:06:39
454000 -- (-1077.654) [-1079.712] (-1091.814) (-1088.204) * (-1098.188) [-1074.983] (-1115.162) (-1084.204) -- 0:06:39
455000 -- [-1074.314] (-1085.391) (-1080.945) (-1085.148) * (-1079.816) [-1087.151] (-1085.514) (-1092.657) -- 0:06:37
Average standard deviation of split frequencies: 0.010520
456000 -- [-1086.749] (-1099.489) (-1088.777) (-1091.910) * (-1080.503) (-1087.771) [-1077.184] (-1104.628) -- 0:06:37
457000 -- [-1074.906] (-1081.216) (-1089.462) (-1098.955) * [-1074.444] (-1096.225) (-1104.801) (-1089.994) -- 0:06:36
458000 -- [-1066.202] (-1086.667) (-1098.452) (-1104.551) * [-1073.485] (-1097.275) (-1099.720) (-1084.772) -- 0:06:36
459000 -- [-1078.730] (-1091.539) (-1098.376) (-1104.843) * (-1106.360) (-1095.695) (-1105.347) [-1082.296] -- 0:06:34
460000 -- [-1073.260] (-1111.544) (-1089.130) (-1091.504) * (-1092.438) [-1082.192] (-1111.780) (-1086.405) -- 0:06:34
Average standard deviation of split frequencies: 0.010795
461000 -- (-1083.258) (-1105.263) (-1100.250) [-1085.298] * (-1083.768) (-1090.810) (-1098.862) [-1085.988] -- 0:06:34
462000 -- (-1083.231) (-1075.543) [-1083.839] (-1104.366) * (-1093.233) (-1073.669) [-1080.059] (-1091.276) -- 0:06:33
463000 -- (-1084.164) (-1077.721) (-1090.331) [-1090.094] * (-1089.991) (-1088.880) [-1081.521] (-1080.989) -- 0:06:32
464000 -- (-1083.007) (-1088.153) [-1081.008] (-1090.173) * (-1094.293) (-1102.425) [-1084.270] (-1100.271) -- 0:06:31
465000 -- [-1083.680] (-1076.347) (-1087.156) (-1076.420) * (-1111.132) (-1078.147) [-1087.022] (-1081.703) -- 0:06:31
Average standard deviation of split frequencies: 0.010255
466000 -- (-1081.909) [-1089.974] (-1082.411) (-1086.397) * (-1103.525) (-1082.204) [-1076.377] (-1092.251) -- 0:06:29
467000 -- (-1116.749) (-1087.442) [-1077.874] (-1093.186) * (-1090.711) [-1075.744] (-1081.898) (-1092.899) -- 0:06:29
468000 -- (-1087.264) (-1106.597) [-1078.002] (-1088.958) * (-1092.222) (-1089.660) [-1084.663] (-1075.869) -- 0:06:28
469000 -- (-1091.072) [-1092.988] (-1093.194) (-1092.428) * (-1094.607) (-1089.439) (-1085.228) [-1079.534] -- 0:06:28
470000 -- (-1108.860) (-1086.866) (-1089.934) [-1088.369] * (-1086.604) (-1084.908) [-1093.996] (-1093.485) -- 0:06:26
Average standard deviation of split frequencies: 0.010310
471000 -- [-1092.609] (-1095.170) (-1097.816) (-1091.070) * (-1079.634) [-1079.164] (-1096.943) (-1096.159) -- 0:06:26
472000 -- (-1088.058) [-1092.393] (-1093.450) (-1087.567) * (-1099.630) (-1094.929) (-1103.711) [-1074.348] -- 0:06:25
473000 -- [-1084.460] (-1086.468) (-1101.020) (-1080.547) * [-1083.142] (-1102.632) (-1094.889) (-1083.697) -- 0:06:25
474000 -- [-1077.583] (-1076.917) (-1088.433) (-1086.359) * (-1097.097) (-1109.713) (-1086.436) [-1085.936] -- 0:06:23
475000 -- [-1082.625] (-1092.277) (-1095.495) (-1088.317) * (-1091.814) (-1080.334) [-1086.572] (-1089.398) -- 0:06:23
Average standard deviation of split frequencies: 0.010039
476000 -- (-1097.553) [-1084.722] (-1093.811) (-1084.775) * (-1089.954) (-1093.527) [-1084.412] (-1089.109) -- 0:06:23
477000 -- [-1082.357] (-1083.314) (-1102.518) (-1116.850) * (-1090.988) [-1091.415] (-1108.622) (-1090.674) -- 0:06:21
478000 -- (-1089.407) [-1075.489] (-1091.633) (-1100.929) * (-1077.674) (-1084.580) (-1090.724) [-1081.000] -- 0:06:21
479000 -- (-1082.436) (-1089.008) [-1088.014] (-1093.294) * [-1086.503] (-1083.105) (-1091.697) (-1080.642) -- 0:06:20
480000 -- (-1079.706) [-1070.150] (-1081.368) (-1095.879) * (-1079.148) (-1085.528) [-1091.098] (-1101.623) -- 0:06:20
Average standard deviation of split frequencies: 0.010057
481000 -- (-1091.987) (-1097.173) [-1075.504] (-1087.389) * (-1094.816) (-1088.392) [-1088.376] (-1099.144) -- 0:06:18
482000 -- (-1089.953) (-1081.803) [-1075.013] (-1088.463) * (-1091.264) [-1079.600] (-1086.349) (-1096.382) -- 0:06:18
483000 -- (-1081.200) [-1081.220] (-1100.464) (-1086.672) * (-1093.168) (-1079.602) [-1090.265] (-1095.739) -- 0:06:17
484000 -- (-1095.758) [-1080.562] (-1089.095) (-1099.261) * (-1098.039) (-1073.407) (-1078.393) [-1080.124] -- 0:06:17
485000 -- (-1085.127) [-1081.250] (-1079.826) (-1101.794) * (-1101.943) [-1074.149] (-1100.091) (-1077.727) -- 0:06:15
Average standard deviation of split frequencies: 0.010061
486000 -- (-1096.436) [-1079.712] (-1097.804) (-1095.658) * [-1080.421] (-1083.900) (-1093.912) (-1097.454) -- 0:06:15
487000 -- (-1084.967) (-1084.085) (-1096.758) [-1089.572] * [-1080.993] (-1089.000) (-1103.302) (-1091.033) -- 0:06:15
488000 -- (-1079.805) (-1087.511) [-1084.765] (-1099.842) * (-1091.473) (-1093.650) [-1083.400] (-1084.891) -- 0:06:13
489000 -- (-1087.043) [-1082.273] (-1106.686) (-1090.542) * (-1097.157) (-1088.467) (-1089.551) [-1097.978] -- 0:06:13
490000 -- (-1103.532) (-1089.602) (-1093.204) [-1074.203] * (-1100.802) [-1091.003] (-1106.846) (-1093.379) -- 0:06:12
Average standard deviation of split frequencies: 0.009664
491000 -- (-1102.668) [-1076.355] (-1096.640) (-1084.394) * (-1093.185) (-1083.577) (-1106.425) [-1085.668] -- 0:06:12
492000 -- (-1080.004) [-1078.214] (-1108.097) (-1083.920) * (-1090.446) [-1073.250] (-1091.739) (-1077.156) -- 0:06:10
493000 -- (-1087.491) (-1094.940) (-1107.216) [-1078.230] * (-1101.862) (-1088.329) (-1097.854) [-1075.660] -- 0:06:10
494000 -- (-1098.076) (-1093.549) [-1081.127] (-1082.239) * (-1088.376) (-1091.758) (-1096.499) [-1070.725] -- 0:06:09
495000 -- (-1105.336) (-1097.243) [-1083.173] (-1102.478) * (-1095.638) (-1089.416) (-1092.544) [-1081.443] -- 0:06:08
Average standard deviation of split frequencies: 0.010100
496000 -- (-1096.717) (-1085.251) [-1074.577] (-1108.075) * (-1112.954) [-1080.821] (-1087.258) (-1091.203) -- 0:06:07
497000 -- (-1077.240) (-1110.368) (-1098.128) [-1083.167] * (-1107.777) [-1073.977] (-1087.265) (-1101.384) -- 0:06:07
498000 -- [-1079.703] (-1089.385) (-1103.130) (-1083.327) * (-1097.192) [-1074.594] (-1091.025) (-1082.360) -- 0:06:06
499000 -- [-1078.103] (-1095.970) (-1099.193) (-1081.284) * (-1089.000) (-1101.708) (-1081.101) [-1078.927] -- 0:06:05
500000 -- (-1086.608) (-1101.450) (-1094.800) [-1083.640] * [-1078.825] (-1084.905) (-1075.393) (-1085.250) -- 0:06:05
Average standard deviation of split frequencies: 0.010209
501000 -- (-1098.776) (-1086.968) (-1086.458) [-1085.493] * (-1091.282) (-1088.076) [-1085.962] (-1095.709) -- 0:06:04
502000 -- (-1097.925) (-1081.903) (-1093.359) [-1091.893] * (-1079.057) (-1079.122) (-1108.082) [-1082.057] -- 0:06:04
503000 -- (-1092.265) (-1087.677) (-1103.310) [-1092.100] * (-1084.373) (-1093.671) [-1093.372] (-1081.781) -- 0:06:02
504000 -- (-1075.790) [-1081.899] (-1093.401) (-1086.766) * [-1084.796] (-1084.356) (-1088.991) (-1091.992) -- 0:06:02
505000 -- (-1072.400) (-1096.979) (-1085.713) [-1076.483] * (-1096.910) (-1099.414) (-1086.338) [-1077.604] -- 0:06:01
Average standard deviation of split frequencies: 0.010193
506000 -- (-1078.308) (-1091.956) [-1086.806] (-1092.388) * (-1086.003) [-1081.043] (-1084.661) (-1084.289) -- 0:06:00
507000 -- (-1075.381) (-1097.681) (-1107.101) [-1095.718] * (-1097.748) (-1113.833) [-1083.909] (-1082.890) -- 0:05:59
508000 -- (-1099.507) (-1077.526) [-1075.857] (-1086.203) * (-1092.766) (-1100.597) (-1090.283) [-1086.483] -- 0:05:59
509000 -- (-1071.870) (-1112.834) (-1075.349) [-1074.675] * [-1084.130] (-1096.840) (-1095.836) (-1091.483) -- 0:05:58
510000 -- (-1090.077) [-1084.519] (-1085.061) (-1113.715) * [-1080.920] (-1083.401) (-1086.650) (-1089.746) -- 0:05:57
Average standard deviation of split frequencies: 0.010082
511000 -- (-1108.116) [-1081.585] (-1096.720) (-1104.383) * (-1093.202) [-1076.615] (-1108.553) (-1082.130) -- 0:05:56
512000 -- (-1102.977) (-1091.184) (-1093.672) [-1084.209] * (-1089.475) [-1079.185] (-1089.551) (-1092.045) -- 0:05:56
513000 -- (-1088.041) (-1086.008) (-1077.970) [-1082.092] * (-1088.514) (-1096.385) (-1087.016) [-1076.433] -- 0:05:55
514000 -- [-1083.056] (-1093.250) (-1082.093) (-1090.652) * (-1093.248) (-1092.337) (-1099.030) [-1085.494] -- 0:05:54
515000 -- (-1096.802) (-1101.805) [-1084.266] (-1089.572) * (-1096.796) (-1088.363) (-1081.360) [-1078.853] -- 0:05:54
Average standard deviation of split frequencies: 0.010264
516000 -- (-1097.998) [-1088.928] (-1103.317) (-1073.247) * (-1083.305) (-1093.583) (-1094.824) [-1080.693] -- 0:05:53
517000 -- (-1096.395) (-1098.283) (-1085.523) [-1079.954] * (-1084.041) (-1094.868) (-1082.348) [-1074.815] -- 0:05:52
518000 -- (-1098.825) (-1084.861) (-1091.197) [-1076.147] * (-1083.532) (-1098.854) [-1080.358] (-1083.268) -- 0:05:51
519000 -- (-1104.796) (-1089.191) (-1084.952) [-1081.089] * (-1088.957) (-1087.402) [-1071.109] (-1110.881) -- 0:05:51
520000 -- (-1080.975) (-1090.894) [-1081.648] (-1085.075) * [-1080.979] (-1096.693) (-1082.395) (-1108.354) -- 0:05:50
Average standard deviation of split frequencies: 0.010439
521000 -- (-1098.321) (-1080.205) (-1087.814) [-1077.856] * [-1087.385] (-1121.341) (-1099.936) (-1088.221) -- 0:05:49
522000 -- [-1074.899] (-1078.597) (-1090.113) (-1079.541) * (-1087.835) (-1092.341) [-1085.110] (-1094.826) -- 0:05:48
523000 -- (-1084.094) [-1090.742] (-1084.903) (-1096.155) * (-1090.822) (-1081.495) [-1073.199] (-1095.511) -- 0:05:48
524000 -- (-1088.278) [-1093.824] (-1075.988) (-1113.765) * (-1084.582) [-1094.330] (-1089.386) (-1103.606) -- 0:05:47
525000 -- (-1088.177) [-1081.899] (-1096.479) (-1092.478) * [-1078.951] (-1088.753) (-1087.943) (-1090.586) -- 0:05:46
Average standard deviation of split frequencies: 0.010087
526000 -- [-1078.068] (-1088.092) (-1101.317) (-1088.876) * (-1100.920) (-1084.921) (-1104.488) [-1092.443] -- 0:05:46
527000 -- [-1086.318] (-1095.026) (-1103.074) (-1081.238) * (-1090.618) (-1092.208) (-1085.209) [-1090.459] -- 0:05:45
528000 -- (-1093.861) (-1102.340) (-1101.326) [-1090.520] * (-1092.946) (-1095.977) [-1080.920] (-1082.877) -- 0:05:45
529000 -- [-1075.707] (-1092.177) (-1095.636) (-1096.075) * (-1105.555) [-1071.261] (-1083.502) (-1079.910) -- 0:05:43
530000 -- (-1082.215) (-1090.863) (-1108.240) [-1080.733] * (-1102.408) (-1081.058) (-1078.710) [-1073.438] -- 0:05:43
Average standard deviation of split frequencies: 0.009789
531000 -- [-1098.520] (-1085.166) (-1100.383) (-1089.451) * (-1104.194) (-1088.469) [-1083.269] (-1088.844) -- 0:05:42
532000 -- [-1076.957] (-1078.786) (-1089.338) (-1077.571) * (-1093.455) (-1087.271) (-1087.634) [-1085.119] -- 0:05:42
533000 -- [-1078.945] (-1080.205) (-1109.094) (-1083.783) * (-1080.823) (-1096.907) [-1082.181] (-1092.497) -- 0:05:40
534000 -- (-1081.074) [-1088.224] (-1098.487) (-1079.910) * (-1092.089) (-1114.440) (-1103.485) [-1083.019] -- 0:05:40
535000 -- (-1083.508) (-1082.863) (-1107.791) [-1080.794] * (-1085.025) (-1095.423) [-1074.546] (-1090.897) -- 0:05:39
Average standard deviation of split frequencies: 0.009692
536000 -- [-1076.820] (-1076.830) (-1104.639) (-1086.650) * (-1082.973) (-1085.010) [-1076.782] (-1087.660) -- 0:05:39
537000 -- (-1079.593) [-1068.695] (-1093.838) (-1106.707) * (-1088.404) (-1086.200) (-1076.580) [-1076.641] -- 0:05:37
538000 -- (-1091.249) [-1075.680] (-1095.108) (-1097.563) * (-1096.722) (-1099.631) (-1086.534) [-1085.251] -- 0:05:37
539000 -- [-1080.856] (-1083.382) (-1087.622) (-1087.502) * (-1089.818) (-1089.873) (-1078.957) [-1086.121] -- 0:05:36
540000 -- (-1088.685) (-1084.890) [-1083.665] (-1096.006) * (-1094.206) [-1073.166] (-1097.559) (-1080.041) -- 0:05:36
Average standard deviation of split frequencies: 0.009625
541000 -- [-1087.293] (-1094.622) (-1080.241) (-1091.671) * (-1103.128) [-1078.989] (-1087.463) (-1074.893) -- 0:05:35
542000 -- (-1094.279) (-1072.161) [-1070.413] (-1098.969) * (-1105.265) (-1076.653) [-1085.488] (-1092.270) -- 0:05:34
543000 -- (-1090.142) (-1087.936) [-1077.126] (-1092.943) * (-1087.504) [-1077.408] (-1087.862) (-1082.945) -- 0:05:34
544000 -- (-1083.462) (-1096.312) [-1071.206] (-1095.852) * (-1087.646) [-1081.842] (-1094.360) (-1090.320) -- 0:05:32
545000 -- [-1080.319] (-1089.143) (-1093.127) (-1106.351) * (-1081.675) (-1097.121) (-1073.141) [-1088.401] -- 0:05:32
Average standard deviation of split frequencies: 0.009345
546000 -- (-1085.979) (-1082.526) [-1087.688] (-1079.504) * [-1079.121] (-1099.091) (-1088.859) (-1072.379) -- 0:05:31
547000 -- [-1077.628] (-1083.422) (-1089.692) (-1108.528) * (-1091.614) (-1096.748) (-1090.747) [-1075.968] -- 0:05:31
548000 -- (-1100.876) [-1079.270] (-1096.762) (-1081.482) * [-1080.655] (-1081.808) (-1084.872) (-1087.751) -- 0:05:29
549000 -- (-1090.222) [-1074.045] (-1077.739) (-1098.184) * (-1084.873) [-1075.639] (-1091.248) (-1097.402) -- 0:05:29
550000 -- [-1080.107] (-1087.907) (-1089.136) (-1100.319) * (-1080.268) (-1081.220) (-1092.706) [-1075.406] -- 0:05:28
Average standard deviation of split frequencies: 0.009333
551000 -- [-1070.694] (-1095.117) (-1088.473) (-1078.443) * [-1078.952] (-1096.540) (-1093.676) (-1118.595) -- 0:05:28
552000 -- (-1085.678) (-1091.961) (-1092.805) [-1068.546] * [-1083.648] (-1094.706) (-1107.449) (-1094.410) -- 0:05:27
553000 -- (-1085.977) (-1097.522) [-1083.148] (-1090.835) * [-1082.538] (-1090.819) (-1099.704) (-1102.386) -- 0:05:26
554000 -- (-1088.389) [-1072.290] (-1095.572) (-1098.181) * [-1070.855] (-1085.811) (-1092.508) (-1090.084) -- 0:05:26
555000 -- (-1082.061) [-1083.665] (-1090.569) (-1085.750) * [-1079.569] (-1083.569) (-1097.377) (-1094.295) -- 0:05:25
Average standard deviation of split frequencies: 0.009276
556000 -- (-1083.873) (-1105.482) [-1079.812] (-1098.459) * (-1088.712) (-1094.409) [-1093.004] (-1089.034) -- 0:05:24
557000 -- [-1076.620] (-1103.536) (-1078.940) (-1102.602) * (-1081.174) (-1091.775) (-1088.577) [-1074.498] -- 0:05:23
558000 -- [-1082.285] (-1092.897) (-1084.127) (-1110.793) * (-1088.142) (-1078.115) (-1101.538) [-1081.405] -- 0:05:23
559000 -- (-1089.377) [-1099.166] (-1097.050) (-1077.154) * (-1098.862) (-1105.766) (-1082.258) [-1077.428] -- 0:05:22
560000 -- (-1101.897) (-1087.662) (-1077.231) [-1086.263] * (-1084.722) (-1102.573) (-1087.129) [-1084.076] -- 0:05:21
Average standard deviation of split frequencies: 0.009595
561000 -- [-1091.919] (-1100.681) (-1090.229) (-1093.861) * (-1086.575) (-1105.327) (-1083.985) [-1080.567] -- 0:05:20
562000 -- (-1088.233) (-1111.441) [-1072.139] (-1083.628) * (-1092.832) (-1102.835) (-1096.797) [-1087.363] -- 0:05:20
563000 -- [-1086.694] (-1084.835) (-1111.555) (-1085.052) * (-1089.737) [-1092.230] (-1098.102) (-1092.524) -- 0:05:19
564000 -- [-1086.451] (-1081.647) (-1083.681) (-1099.113) * [-1078.799] (-1092.391) (-1094.323) (-1083.583) -- 0:05:18
565000 -- [-1083.252] (-1105.733) (-1085.308) (-1088.943) * (-1085.341) [-1087.876] (-1101.746) (-1108.837) -- 0:05:17
Average standard deviation of split frequencies: 0.009243
566000 -- (-1090.240) (-1088.651) [-1076.914] (-1094.638) * (-1083.343) [-1083.884] (-1093.589) (-1102.221) -- 0:05:17
567000 -- (-1094.155) (-1094.634) (-1085.097) [-1081.167] * [-1074.088] (-1087.216) (-1096.613) (-1108.775) -- 0:05:16
568000 -- (-1089.831) [-1083.549] (-1096.761) (-1088.932) * [-1087.032] (-1090.732) (-1084.887) (-1095.943) -- 0:05:15
569000 -- (-1084.111) (-1075.589) (-1099.529) [-1079.862] * (-1084.650) [-1082.601] (-1082.600) (-1115.522) -- 0:05:15
570000 -- (-1090.454) (-1073.388) (-1083.809) [-1089.996] * [-1081.682] (-1091.289) (-1075.238) (-1102.782) -- 0:05:14
Average standard deviation of split frequencies: 0.009313
571000 -- (-1079.242) (-1095.759) (-1113.768) [-1078.470] * (-1079.667) [-1081.200] (-1102.399) (-1111.508) -- 0:05:13
572000 -- (-1069.571) (-1092.517) [-1085.340] (-1087.613) * (-1082.033) [-1082.784] (-1108.164) (-1097.361) -- 0:05:12
573000 -- [-1070.631] (-1093.772) (-1096.331) (-1098.851) * [-1082.522] (-1079.962) (-1093.063) (-1106.972) -- 0:05:12
574000 -- (-1084.743) (-1087.109) (-1102.944) [-1082.138] * (-1084.592) [-1080.548] (-1089.378) (-1081.399) -- 0:05:11
575000 -- (-1106.100) [-1088.200] (-1098.148) (-1071.941) * [-1078.460] (-1089.979) (-1078.510) (-1085.680) -- 0:05:10
Average standard deviation of split frequencies: 0.009195
576000 -- (-1082.842) [-1085.417] (-1103.711) (-1100.761) * [-1075.344] (-1087.810) (-1086.301) (-1073.258) -- 0:05:09
577000 -- (-1088.319) (-1090.749) (-1094.909) [-1079.337] * (-1074.371) (-1088.551) (-1097.305) [-1081.325] -- 0:05:09
578000 -- [-1089.814] (-1092.383) (-1095.476) (-1092.909) * [-1078.776] (-1113.802) (-1095.302) (-1078.162) -- 0:05:08
579000 -- [-1080.807] (-1082.054) (-1098.974) (-1092.580) * [-1075.547] (-1092.838) (-1091.720) (-1110.455) -- 0:05:07
580000 -- (-1087.243) (-1087.772) [-1090.966] (-1096.127) * [-1070.005] (-1078.969) (-1089.163) (-1087.627) -- 0:05:07
Average standard deviation of split frequencies: 0.009264
581000 -- (-1081.877) (-1089.678) (-1081.507) [-1076.229] * (-1075.324) (-1078.854) [-1091.097] (-1088.253) -- 0:05:06
582000 -- (-1081.364) (-1114.724) (-1095.591) [-1072.092] * (-1097.901) (-1088.348) (-1088.990) [-1088.745] -- 0:05:05
583000 -- (-1084.330) (-1093.965) (-1099.680) [-1084.404] * (-1088.421) (-1078.754) [-1088.116] (-1100.705) -- 0:05:04
584000 -- [-1084.483] (-1107.179) (-1118.456) (-1109.631) * [-1089.944] (-1093.211) (-1088.861) (-1091.097) -- 0:05:04
585000 -- (-1124.376) [-1098.069] (-1101.102) (-1089.632) * (-1078.942) (-1095.970) (-1091.763) [-1077.417] -- 0:05:03
Average standard deviation of split frequencies: 0.009227
586000 -- (-1084.421) (-1088.756) (-1102.442) [-1071.286] * (-1082.438) (-1104.225) [-1082.441] (-1084.486) -- 0:05:02
587000 -- [-1073.432] (-1091.873) (-1103.122) (-1077.956) * (-1074.696) (-1093.727) (-1092.575) [-1081.864] -- 0:05:01
588000 -- [-1076.214] (-1091.733) (-1104.544) (-1098.813) * (-1077.801) (-1082.065) [-1078.970] (-1090.723) -- 0:05:01
589000 -- [-1094.452] (-1075.576) (-1102.149) (-1102.078) * (-1097.783) [-1084.427] (-1082.886) (-1075.125) -- 0:05:00
590000 -- (-1089.069) (-1071.802) (-1084.452) [-1075.837] * (-1092.696) (-1090.651) (-1093.665) [-1095.505] -- 0:04:59
Average standard deviation of split frequencies: 0.009452
591000 -- (-1091.614) (-1086.685) (-1097.148) [-1073.813] * (-1077.496) (-1083.111) [-1075.709] (-1115.232) -- 0:04:58
592000 -- (-1096.783) (-1081.951) [-1081.354] (-1074.979) * [-1078.261] (-1089.619) (-1086.457) (-1099.421) -- 0:04:58
593000 -- (-1097.991) (-1089.984) [-1084.149] (-1084.324) * (-1088.579) (-1092.584) [-1077.110] (-1085.409) -- 0:04:57
594000 -- (-1111.042) (-1090.766) (-1089.298) [-1075.833] * (-1091.873) (-1105.551) [-1080.937] (-1100.562) -- 0:04:56
595000 -- [-1084.542] (-1087.520) (-1105.668) (-1079.975) * (-1081.967) (-1106.929) (-1085.427) [-1091.312] -- 0:04:56
Average standard deviation of split frequencies: 0.009662
596000 -- (-1081.241) (-1072.137) (-1096.679) [-1073.058] * [-1072.016] (-1101.465) (-1081.547) (-1081.708) -- 0:04:55
597000 -- (-1107.751) (-1106.520) [-1091.449] (-1079.014) * (-1096.751) (-1095.027) [-1082.980] (-1106.330) -- 0:04:54
598000 -- [-1084.892] (-1095.029) (-1083.432) (-1115.538) * (-1097.118) (-1081.054) [-1079.538] (-1100.717) -- 0:04:53
599000 -- [-1080.529] (-1076.212) (-1106.850) (-1103.715) * (-1111.312) [-1080.800] (-1088.011) (-1087.989) -- 0:04:53
600000 -- [-1074.606] (-1080.967) (-1096.204) (-1102.630) * [-1085.987] (-1073.381) (-1090.694) (-1084.326) -- 0:04:52
Average standard deviation of split frequencies: 0.009633
601000 -- (-1097.809) [-1083.770] (-1095.539) (-1095.410) * (-1086.463) [-1086.848] (-1091.850) (-1088.152) -- 0:04:51
602000 -- (-1083.772) [-1085.153] (-1105.452) (-1106.419) * (-1075.287) (-1091.460) [-1100.652] (-1088.461) -- 0:04:50
603000 -- (-1099.113) [-1083.551] (-1095.115) (-1093.728) * [-1085.551] (-1085.407) (-1091.897) (-1086.770) -- 0:04:50
604000 -- [-1085.870] (-1087.914) (-1095.675) (-1090.831) * [-1091.167] (-1093.824) (-1112.403) (-1083.896) -- 0:04:49
605000 -- (-1072.545) [-1082.853] (-1084.793) (-1086.153) * [-1085.614] (-1087.114) (-1084.449) (-1078.771) -- 0:04:48
Average standard deviation of split frequencies: 0.009945
606000 -- (-1090.570) (-1076.266) (-1108.303) [-1092.750] * (-1095.082) (-1115.076) (-1084.512) [-1076.839] -- 0:04:48
607000 -- (-1086.691) (-1094.026) (-1100.029) [-1087.198] * [-1086.313] (-1097.782) (-1089.274) (-1097.904) -- 0:04:47
608000 -- [-1075.225] (-1099.029) (-1076.863) (-1090.998) * (-1096.389) (-1091.551) [-1070.946] (-1089.499) -- 0:04:46
609000 -- (-1107.785) (-1092.909) [-1080.471] (-1088.859) * [-1080.377] (-1085.930) (-1092.346) (-1080.010) -- 0:04:45
610000 -- [-1074.670] (-1106.564) (-1077.594) (-1099.739) * (-1088.387) (-1088.664) [-1088.444] (-1090.187) -- 0:04:45
Average standard deviation of split frequencies: 0.009627
611000 -- (-1082.335) (-1104.062) [-1076.518] (-1092.412) * (-1095.892) (-1094.378) (-1100.128) [-1077.458] -- 0:04:43
612000 -- [-1076.735] (-1078.733) (-1086.180) (-1093.433) * (-1092.642) (-1095.177) (-1107.250) [-1070.505] -- 0:04:43
613000 -- [-1079.827] (-1087.841) (-1103.376) (-1087.647) * [-1080.525] (-1097.901) (-1093.520) (-1089.836) -- 0:04:42
614000 -- [-1073.301] (-1093.054) (-1083.717) (-1092.809) * [-1080.871] (-1085.520) (-1096.909) (-1086.698) -- 0:04:42
615000 -- [-1072.627] (-1089.209) (-1105.946) (-1090.873) * (-1106.467) (-1095.990) [-1082.527] (-1105.094) -- 0:04:41
Average standard deviation of split frequencies: 0.009468
616000 -- [-1075.382] (-1087.233) (-1102.600) (-1085.518) * [-1091.035] (-1101.602) (-1099.812) (-1103.876) -- 0:04:40
617000 -- (-1083.929) (-1083.117) (-1100.478) [-1086.349] * (-1102.077) [-1095.743] (-1080.433) (-1108.903) -- 0:04:39
618000 -- (-1086.490) (-1088.402) (-1102.795) [-1073.861] * [-1088.476] (-1092.856) (-1096.691) (-1099.450) -- 0:04:38
619000 -- (-1089.639) [-1083.344] (-1102.324) (-1077.230) * (-1113.377) [-1083.712] (-1099.305) (-1101.402) -- 0:04:38
620000 -- (-1087.815) [-1084.099] (-1099.874) (-1075.027) * (-1084.080) (-1086.797) [-1082.003] (-1083.739) -- 0:04:37
Average standard deviation of split frequencies: 0.009859
621000 -- (-1079.783) (-1101.194) [-1082.767] (-1078.222) * [-1081.319] (-1088.160) (-1084.923) (-1084.292) -- 0:04:37
622000 -- (-1097.763) [-1095.563] (-1083.037) (-1086.797) * [-1083.199] (-1113.071) (-1083.082) (-1084.501) -- 0:04:35
623000 -- (-1106.910) (-1098.874) [-1095.443] (-1084.374) * (-1083.163) (-1098.168) (-1099.225) [-1074.249] -- 0:04:35
624000 -- (-1089.511) (-1118.022) (-1089.989) [-1082.455] * (-1078.607) (-1089.238) (-1099.646) [-1091.862] -- 0:04:34
625000 -- (-1081.902) (-1096.581) [-1080.545] (-1086.343) * (-1082.291) (-1084.461) (-1081.660) [-1095.641] -- 0:04:34
Average standard deviation of split frequencies: 0.010055
626000 -- (-1085.544) (-1115.082) [-1071.789] (-1084.250) * [-1082.563] (-1096.723) (-1084.063) (-1099.995) -- 0:04:33
627000 -- (-1084.131) (-1104.640) [-1074.769] (-1095.685) * (-1082.029) (-1084.959) (-1084.061) [-1078.247] -- 0:04:32
628000 -- (-1097.442) (-1093.900) (-1081.852) [-1080.886] * (-1099.635) (-1083.958) (-1081.490) [-1077.493] -- 0:04:31
629000 -- [-1074.955] (-1078.934) (-1086.668) (-1097.264) * (-1107.149) (-1092.684) [-1072.229] (-1075.160) -- 0:04:30
630000 -- (-1080.327) (-1083.666) [-1080.798] (-1087.957) * (-1101.599) [-1075.972] (-1101.765) (-1089.514) -- 0:04:30
Average standard deviation of split frequencies: 0.009996
631000 -- (-1092.250) (-1093.485) (-1085.631) [-1083.250] * (-1101.280) (-1081.811) [-1074.307] (-1097.509) -- 0:04:29
632000 -- [-1076.288] (-1083.671) (-1089.756) (-1082.238) * (-1092.488) [-1081.478] (-1074.516) (-1095.051) -- 0:04:29
633000 -- (-1089.111) (-1091.742) (-1091.491) [-1081.580] * (-1084.173) [-1080.684] (-1085.180) (-1098.367) -- 0:04:27
634000 -- (-1096.451) (-1095.326) [-1084.807] (-1076.830) * [-1076.605] (-1079.371) (-1105.224) (-1100.451) -- 0:04:27
635000 -- (-1104.084) (-1076.411) [-1081.895] (-1081.556) * (-1095.599) (-1078.832) (-1103.863) [-1085.642] -- 0:04:26
Average standard deviation of split frequencies: 0.010043
636000 -- [-1088.861] (-1074.019) (-1088.604) (-1078.321) * (-1086.923) [-1077.090] (-1109.956) (-1101.041) -- 0:04:26
637000 -- (-1097.142) (-1079.941) [-1078.302] (-1079.696) * (-1090.893) (-1091.690) [-1090.423] (-1096.296) -- 0:04:24
638000 -- (-1094.686) (-1087.515) [-1074.981] (-1075.177) * (-1094.997) [-1088.064] (-1083.730) (-1099.551) -- 0:04:24
639000 -- (-1105.538) (-1098.076) [-1077.413] (-1073.920) * (-1090.835) [-1082.258] (-1100.819) (-1088.843) -- 0:04:23
640000 -- (-1082.112) (-1099.132) [-1079.050] (-1085.961) * (-1097.087) (-1086.238) [-1086.577] (-1092.579) -- 0:04:23
Average standard deviation of split frequencies: 0.009825
641000 -- (-1091.500) (-1081.877) (-1099.234) [-1075.086] * (-1105.685) (-1108.508) [-1083.743] (-1087.801) -- 0:04:22
642000 -- (-1092.442) [-1101.880] (-1111.698) (-1088.928) * [-1094.040] (-1094.051) (-1085.991) (-1089.995) -- 0:04:21
643000 -- (-1088.973) [-1085.320] (-1083.037) (-1080.969) * (-1093.928) (-1081.529) [-1077.814] (-1088.425) -- 0:04:20
644000 -- (-1098.807) (-1075.813) [-1065.629] (-1087.045) * (-1099.300) (-1097.761) (-1073.493) [-1096.253] -- 0:04:19
645000 -- (-1101.732) [-1086.117] (-1092.166) (-1093.997) * [-1084.356] (-1085.398) (-1103.937) (-1088.979) -- 0:04:19
Average standard deviation of split frequencies: 0.009329
646000 -- (-1088.074) (-1096.662) (-1074.184) [-1092.578] * (-1080.096) [-1091.026] (-1090.390) (-1099.892) -- 0:04:18
647000 -- (-1097.484) (-1081.112) [-1081.354] (-1093.804) * [-1088.509] (-1094.585) (-1085.797) (-1090.818) -- 0:04:18
648000 -- (-1089.010) (-1086.873) (-1086.220) [-1087.700] * [-1083.745] (-1099.046) (-1097.921) (-1088.349) -- 0:04:16
649000 -- [-1089.741] (-1073.465) (-1093.091) (-1085.957) * (-1079.169) (-1105.885) (-1078.448) [-1094.092] -- 0:04:16
650000 -- (-1087.950) [-1084.265] (-1080.495) (-1093.054) * [-1078.966] (-1096.113) (-1082.455) (-1088.646) -- 0:04:15
Average standard deviation of split frequencies: 0.009504
651000 -- (-1086.272) (-1102.686) [-1090.307] (-1091.870) * [-1077.889] (-1102.540) (-1092.603) (-1110.716) -- 0:04:15
652000 -- [-1085.998] (-1103.179) (-1083.975) (-1077.022) * [-1083.050] (-1087.122) (-1089.011) (-1090.712) -- 0:04:14
653000 -- (-1113.608) (-1091.960) [-1076.944] (-1089.923) * (-1085.864) [-1088.361] (-1094.753) (-1105.223) -- 0:04:13
654000 -- (-1112.988) (-1091.864) (-1077.450) [-1087.923] * (-1099.413) [-1078.708] (-1089.288) (-1088.889) -- 0:04:12
655000 -- (-1099.367) (-1089.510) (-1096.272) [-1080.062] * (-1095.614) (-1094.325) (-1090.022) [-1075.503] -- 0:04:12
Average standard deviation of split frequencies: 0.009159
656000 -- (-1087.266) [-1082.012] (-1094.847) (-1115.411) * (-1104.204) (-1094.753) (-1079.132) [-1079.293] -- 0:04:11
657000 -- [-1077.460] (-1091.075) (-1095.798) (-1088.423) * (-1093.484) (-1091.386) (-1090.903) [-1085.976] -- 0:04:10
658000 -- (-1081.394) (-1104.171) [-1082.411] (-1079.924) * (-1087.112) (-1086.449) (-1082.243) [-1087.706] -- 0:04:10
659000 -- (-1084.872) (-1100.741) (-1092.094) [-1073.186] * [-1090.471] (-1092.599) (-1087.587) (-1076.486) -- 0:04:09
660000 -- [-1084.383] (-1074.148) (-1098.036) (-1099.326) * [-1087.215] (-1084.354) (-1080.291) (-1087.764) -- 0:04:08
Average standard deviation of split frequencies: 0.009388
661000 -- (-1095.126) [-1080.314] (-1102.243) (-1088.463) * (-1090.628) (-1078.088) [-1086.361] (-1097.045) -- 0:04:07
662000 -- (-1096.425) (-1081.736) (-1095.240) [-1088.289] * (-1087.141) [-1075.466] (-1097.894) (-1100.188) -- 0:04:07
663000 -- (-1090.121) (-1080.221) (-1106.645) [-1075.645] * (-1083.004) (-1090.795) [-1088.465] (-1083.128) -- 0:04:06
664000 -- (-1089.545) (-1100.548) (-1092.758) [-1082.955] * (-1081.776) (-1082.567) (-1072.470) [-1076.661] -- 0:04:05
665000 -- (-1099.552) (-1087.337) [-1074.573] (-1088.946) * (-1087.017) (-1081.695) [-1077.426] (-1086.270) -- 0:04:04
Average standard deviation of split frequencies: 0.009160
666000 -- (-1100.054) [-1083.888] (-1077.566) (-1094.437) * (-1091.116) (-1088.893) [-1075.594] (-1080.686) -- 0:04:04
667000 -- (-1115.812) [-1081.539] (-1081.409) (-1084.528) * (-1099.835) (-1091.450) (-1095.306) [-1085.715] -- 0:04:03
668000 -- (-1103.760) (-1090.151) (-1089.504) [-1077.068] * (-1091.997) [-1072.994] (-1094.681) (-1083.941) -- 0:04:02
669000 -- (-1106.240) (-1088.751) (-1081.994) [-1066.508] * (-1088.582) [-1085.011] (-1098.384) (-1081.467) -- 0:04:01
670000 -- (-1092.722) [-1086.314] (-1093.853) (-1092.256) * (-1086.607) (-1084.864) (-1095.198) [-1078.004] -- 0:04:01
Average standard deviation of split frequencies: 0.009510
671000 -- (-1088.249) (-1117.492) [-1073.381] (-1065.398) * (-1082.787) [-1086.958] (-1092.799) (-1105.689) -- 0:04:00
672000 -- (-1088.008) (-1082.826) [-1096.259] (-1080.110) * (-1094.030) (-1095.491) [-1086.399] (-1105.436) -- 0:03:59
673000 -- (-1093.831) (-1090.935) [-1085.037] (-1094.391) * (-1093.143) [-1087.293] (-1097.543) (-1087.564) -- 0:03:59
674000 -- (-1092.044) [-1077.354] (-1109.547) (-1103.677) * (-1113.810) [-1083.217] (-1085.165) (-1086.516) -- 0:03:58
675000 -- (-1086.893) [-1086.391] (-1105.397) (-1092.261) * (-1086.980) (-1096.143) (-1102.279) [-1074.067] -- 0:03:57
Average standard deviation of split frequencies: 0.009681
676000 -- [-1073.328] (-1098.156) (-1113.902) (-1081.491) * [-1077.510] (-1095.935) (-1092.911) (-1094.277) -- 0:03:56
677000 -- (-1092.664) [-1085.854] (-1105.339) (-1080.777) * (-1099.972) (-1094.328) [-1082.846] (-1089.661) -- 0:03:56
678000 -- (-1084.299) (-1109.006) (-1100.826) [-1065.634] * (-1096.557) (-1103.551) (-1090.859) [-1078.773] -- 0:03:55
679000 -- (-1098.079) (-1095.573) (-1086.784) [-1077.386] * (-1087.891) (-1093.488) (-1090.149) [-1081.981] -- 0:03:54
680000 -- (-1094.627) (-1087.855) (-1080.713) [-1086.099] * [-1089.982] (-1102.927) (-1091.868) (-1072.036) -- 0:03:53
Average standard deviation of split frequencies: 0.009793
681000 -- (-1078.209) (-1099.811) [-1084.975] (-1088.556) * (-1093.286) (-1081.568) (-1078.629) [-1079.837] -- 0:03:53
682000 -- (-1079.677) [-1078.481] (-1086.275) (-1101.199) * (-1112.294) (-1096.475) (-1073.572) [-1074.818] -- 0:03:52
683000 -- (-1079.833) [-1082.197] (-1100.362) (-1094.929) * (-1092.262) (-1088.945) (-1092.320) [-1093.622] -- 0:03:51
684000 -- [-1074.835] (-1077.506) (-1105.160) (-1101.884) * (-1105.040) (-1075.600) (-1092.815) [-1095.866] -- 0:03:50
685000 -- (-1092.878) (-1087.269) (-1070.136) [-1074.081] * (-1090.290) [-1084.093] (-1074.833) (-1099.579) -- 0:03:50
Average standard deviation of split frequencies: 0.009607
686000 -- (-1108.022) [-1082.957] (-1079.213) (-1085.801) * (-1095.754) [-1075.687] (-1094.570) (-1083.470) -- 0:03:49
687000 -- (-1109.521) (-1098.315) (-1070.156) [-1083.903] * (-1091.562) [-1083.841] (-1090.677) (-1075.540) -- 0:03:48
688000 -- (-1090.440) (-1090.027) [-1074.379] (-1080.209) * [-1089.696] (-1097.426) (-1090.425) (-1078.179) -- 0:03:48
689000 -- [-1084.137] (-1081.635) (-1083.624) (-1093.068) * (-1081.138) [-1075.700] (-1089.472) (-1088.517) -- 0:03:47
690000 -- [-1090.496] (-1091.177) (-1085.256) (-1087.300) * (-1077.265) (-1089.675) [-1080.887] (-1089.455) -- 0:03:46
Average standard deviation of split frequencies: 0.010074
691000 -- [-1087.902] (-1080.653) (-1088.178) (-1095.999) * (-1098.379) (-1089.884) [-1080.918] (-1104.570) -- 0:03:45
692000 -- [-1077.566] (-1077.673) (-1077.474) (-1089.457) * (-1074.796) [-1088.430] (-1088.661) (-1116.506) -- 0:03:45
693000 -- (-1094.570) (-1106.232) [-1089.743] (-1090.959) * (-1079.432) (-1098.942) [-1074.802] (-1093.892) -- 0:03:44
694000 -- (-1095.944) (-1104.431) (-1088.926) [-1081.436] * (-1084.319) (-1089.599) (-1090.517) [-1093.537] -- 0:03:43
695000 -- (-1100.535) (-1085.327) (-1099.360) [-1099.965] * [-1063.212] (-1091.079) (-1087.263) (-1115.242) -- 0:03:42
Average standard deviation of split frequencies: 0.010309
696000 -- (-1089.121) (-1069.478) [-1087.491] (-1093.898) * (-1086.049) (-1099.464) [-1073.655] (-1089.634) -- 0:03:42
697000 -- (-1087.982) (-1091.474) (-1085.018) [-1084.303] * (-1084.853) (-1101.759) [-1072.566] (-1085.144) -- 0:03:41
698000 -- (-1079.328) [-1084.852] (-1084.401) (-1084.629) * (-1085.884) (-1084.687) [-1077.629] (-1091.475) -- 0:03:40
699000 -- [-1086.077] (-1085.244) (-1090.327) (-1077.916) * (-1086.924) (-1104.018) [-1073.368] (-1076.706) -- 0:03:40
700000 -- (-1086.473) (-1090.722) (-1099.469) [-1080.466] * [-1090.904] (-1100.245) (-1092.377) (-1097.139) -- 0:03:39
Average standard deviation of split frequencies: 0.010321
701000 -- [-1084.065] (-1099.995) (-1076.473) (-1111.586) * (-1095.061) (-1095.979) [-1083.876] (-1106.470) -- 0:03:38
702000 -- (-1076.405) (-1114.987) (-1092.272) [-1081.381] * (-1100.070) (-1092.014) [-1072.423] (-1091.595) -- 0:03:37
703000 -- (-1068.342) (-1092.374) (-1088.850) [-1075.237] * (-1086.491) (-1090.752) [-1077.543] (-1090.909) -- 0:03:37
704000 -- (-1104.350) (-1097.394) (-1089.659) [-1083.117] * (-1093.357) (-1089.118) (-1086.395) [-1085.662] -- 0:03:36
705000 -- (-1115.717) (-1091.198) (-1104.869) [-1077.741] * (-1072.613) (-1097.934) [-1084.608] (-1091.848) -- 0:03:35
Average standard deviation of split frequencies: 0.010376
706000 -- (-1092.630) [-1071.249] (-1083.956) (-1087.934) * (-1085.035) (-1104.606) [-1077.459] (-1085.429) -- 0:03:34
707000 -- (-1088.980) [-1076.132] (-1083.053) (-1078.068) * (-1076.561) (-1086.718) [-1087.889] (-1089.797) -- 0:03:34
708000 -- [-1092.466] (-1079.914) (-1092.858) (-1091.205) * [-1087.916] (-1084.059) (-1095.147) (-1098.820) -- 0:03:33
709000 -- (-1096.463) [-1074.379] (-1111.274) (-1079.181) * (-1087.996) [-1081.269] (-1102.070) (-1089.815) -- 0:03:32
710000 -- (-1098.689) [-1077.076] (-1093.689) (-1094.448) * [-1085.874] (-1091.343) (-1094.357) (-1087.364) -- 0:03:31
Average standard deviation of split frequencies: 0.010719
711000 -- (-1106.676) (-1077.683) (-1092.344) [-1086.238] * (-1098.749) (-1086.869) (-1102.416) [-1088.833] -- 0:03:31
712000 -- (-1097.744) (-1085.620) [-1077.718] (-1097.105) * (-1088.817) [-1084.620] (-1097.563) (-1098.400) -- 0:03:30
713000 -- (-1081.857) (-1096.203) [-1074.579] (-1092.058) * (-1090.412) (-1084.944) (-1091.999) [-1081.177] -- 0:03:29
714000 -- (-1089.974) [-1082.977] (-1080.211) (-1107.819) * (-1107.853) (-1098.531) (-1080.867) [-1079.875] -- 0:03:29
715000 -- [-1083.970] (-1096.402) (-1091.241) (-1085.579) * (-1095.145) (-1086.736) [-1074.609] (-1088.615) -- 0:03:28
Average standard deviation of split frequencies: 0.010403
716000 -- (-1101.784) (-1082.046) [-1070.343] (-1071.091) * (-1083.008) (-1107.514) [-1079.670] (-1092.555) -- 0:03:27
717000 -- (-1090.769) (-1075.171) (-1083.791) [-1091.140] * (-1116.414) (-1091.240) (-1082.267) [-1077.849] -- 0:03:26
718000 -- (-1088.373) (-1094.394) (-1088.170) [-1081.824] * (-1090.140) [-1090.495] (-1085.736) (-1084.512) -- 0:03:26
719000 -- [-1080.541] (-1103.066) (-1087.437) (-1088.251) * (-1096.997) (-1081.252) [-1087.392] (-1106.665) -- 0:03:25
720000 -- [-1071.821] (-1098.934) (-1084.127) (-1099.226) * [-1081.313] (-1080.838) (-1084.267) (-1096.718) -- 0:03:24
Average standard deviation of split frequencies: 0.010244
721000 -- (-1088.673) (-1084.763) (-1095.308) [-1083.506] * (-1079.678) [-1080.921] (-1088.224) (-1099.299) -- 0:03:23
722000 -- (-1097.048) [-1077.663] (-1091.712) (-1084.091) * (-1092.450) (-1089.236) [-1085.747] (-1100.336) -- 0:03:22
723000 -- (-1099.803) (-1086.944) (-1083.008) [-1083.264] * (-1086.601) [-1083.049] (-1088.536) (-1112.140) -- 0:03:22
724000 -- (-1087.717) [-1084.504] (-1099.636) (-1084.601) * [-1068.745] (-1079.399) (-1093.277) (-1096.253) -- 0:03:21
725000 -- (-1085.131) (-1094.853) [-1079.386] (-1089.175) * (-1073.215) [-1077.990] (-1078.192) (-1082.593) -- 0:03:21
Average standard deviation of split frequencies: 0.010389
726000 -- (-1090.068) [-1084.121] (-1090.119) (-1084.676) * (-1095.760) (-1096.478) (-1076.430) [-1083.672] -- 0:03:20
727000 -- (-1098.718) (-1087.673) [-1084.876] (-1087.832) * [-1077.939] (-1096.636) (-1079.922) (-1101.996) -- 0:03:19
728000 -- [-1081.739] (-1075.831) (-1085.987) (-1094.451) * (-1078.838) (-1097.391) (-1089.469) [-1085.007] -- 0:03:18
729000 -- (-1084.294) [-1079.987] (-1094.759) (-1091.835) * [-1076.163] (-1101.086) (-1076.901) (-1092.389) -- 0:03:17
730000 -- (-1093.137) [-1081.322] (-1103.188) (-1082.641) * [-1078.486] (-1093.632) (-1085.065) (-1093.079) -- 0:03:17
Average standard deviation of split frequencies: 0.010078
731000 -- (-1099.316) [-1077.676] (-1096.573) (-1084.437) * (-1077.010) (-1105.792) (-1088.611) [-1075.724] -- 0:03:16
732000 -- (-1087.687) (-1083.208) (-1091.280) [-1087.047] * (-1096.245) (-1093.165) (-1104.179) [-1084.034] -- 0:03:15
733000 -- [-1084.024] (-1086.770) (-1089.098) (-1098.488) * (-1082.523) [-1087.277] (-1100.549) (-1081.911) -- 0:03:14
734000 -- (-1082.956) (-1108.838) [-1078.240] (-1090.744) * (-1091.434) (-1086.870) (-1074.725) [-1083.977] -- 0:03:14
735000 -- (-1090.468) (-1082.821) [-1077.317] (-1096.513) * (-1091.723) (-1082.759) (-1065.138) [-1074.968] -- 0:03:13
Average standard deviation of split frequencies: 0.010171
736000 -- (-1086.448) (-1095.570) [-1078.361] (-1093.022) * [-1080.420] (-1106.671) (-1077.905) (-1083.875) -- 0:03:12
737000 -- [-1084.109] (-1096.518) (-1095.552) (-1093.812) * (-1090.916) (-1089.064) (-1089.884) [-1088.038] -- 0:03:11
738000 -- (-1085.089) [-1084.230] (-1103.140) (-1093.643) * (-1080.948) (-1092.802) [-1083.057] (-1087.424) -- 0:03:11
739000 -- (-1080.165) [-1089.274] (-1100.038) (-1099.093) * (-1080.204) [-1078.505] (-1078.729) (-1108.499) -- 0:03:10
740000 -- (-1084.953) [-1081.743] (-1102.038) (-1097.027) * (-1081.986) (-1096.349) (-1082.788) [-1083.589] -- 0:03:10
Average standard deviation of split frequencies: 0.010183
741000 -- [-1075.259] (-1091.230) (-1087.533) (-1099.906) * (-1086.101) [-1075.868] (-1070.676) (-1080.063) -- 0:03:09
742000 -- (-1083.381) (-1097.316) (-1086.357) [-1076.470] * (-1084.488) (-1092.012) [-1084.432] (-1114.506) -- 0:03:08
743000 -- [-1069.358] (-1098.430) (-1071.797) (-1091.793) * (-1088.365) (-1106.785) (-1091.082) [-1078.924] -- 0:03:07
744000 -- [-1081.659] (-1081.719) (-1100.786) (-1079.984) * (-1079.658) (-1101.965) [-1088.546] (-1087.982) -- 0:03:07
745000 -- (-1081.624) (-1092.359) (-1104.051) [-1070.987] * (-1068.490) (-1100.538) (-1071.119) [-1084.335] -- 0:03:06
Average standard deviation of split frequencies: 0.009757
746000 -- (-1095.404) (-1084.774) [-1081.834] (-1093.883) * (-1079.919) (-1081.991) (-1092.815) [-1088.069] -- 0:03:05
747000 -- (-1106.226) [-1099.671] (-1069.670) (-1090.093) * (-1087.675) (-1105.211) [-1085.922] (-1102.177) -- 0:03:04
748000 -- (-1101.081) [-1085.924] (-1087.199) (-1072.635) * [-1077.965] (-1065.167) (-1089.480) (-1098.010) -- 0:03:03
749000 -- (-1097.775) (-1080.732) [-1077.334] (-1087.820) * [-1083.306] (-1105.642) (-1093.059) (-1094.511) -- 0:03:03
750000 -- (-1080.424) (-1079.510) [-1086.137] (-1086.774) * (-1082.401) (-1090.261) [-1079.336] (-1112.789) -- 0:03:02
Average standard deviation of split frequencies: 0.010161
751000 -- [-1091.283] (-1093.288) (-1084.651) (-1077.022) * [-1087.580] (-1098.694) (-1085.473) (-1088.117) -- 0:03:02
752000 -- (-1095.019) (-1103.622) [-1088.465] (-1086.927) * [-1092.712] (-1094.508) (-1100.235) (-1099.880) -- 0:03:01
753000 -- (-1107.484) (-1087.284) [-1073.593] (-1087.177) * (-1116.354) [-1081.912] (-1088.917) (-1082.090) -- 0:03:00
754000 -- (-1083.245) (-1087.034) [-1087.201] (-1097.780) * (-1108.042) [-1081.258] (-1079.230) (-1096.618) -- 0:02:59
755000 -- (-1096.009) [-1087.759] (-1089.864) (-1081.050) * (-1094.978) (-1080.378) [-1079.171] (-1096.494) -- 0:02:59
Average standard deviation of split frequencies: 0.010139
756000 -- [-1078.530] (-1088.670) (-1092.122) (-1096.949) * (-1099.988) [-1087.576] (-1089.859) (-1092.701) -- 0:02:58
757000 -- [-1077.723] (-1094.328) (-1083.234) (-1092.359) * (-1088.497) (-1088.477) (-1113.302) [-1083.054] -- 0:02:57
758000 -- (-1106.199) [-1078.786] (-1102.664) (-1099.607) * (-1102.407) [-1086.391] (-1101.463) (-1084.534) -- 0:02:56
759000 -- (-1101.218) (-1086.653) (-1092.694) [-1072.836] * (-1090.536) [-1090.189] (-1103.950) (-1112.231) -- 0:02:56
760000 -- [-1088.184] (-1083.113) (-1093.592) (-1082.867) * (-1082.226) (-1089.265) [-1076.962] (-1075.223) -- 0:02:55
Average standard deviation of split frequencies: 0.009854
761000 -- [-1098.167] (-1095.675) (-1073.071) (-1075.163) * (-1097.337) (-1086.415) (-1083.544) [-1086.209] -- 0:02:54
762000 -- (-1097.638) (-1109.417) [-1079.881] (-1082.788) * (-1082.110) (-1083.561) (-1096.497) [-1081.578] -- 0:02:53
763000 -- (-1091.526) (-1096.429) [-1080.531] (-1075.610) * [-1070.363] (-1087.726) (-1086.981) (-1090.391) -- 0:02:53
764000 -- (-1087.420) (-1095.787) (-1092.083) [-1077.771] * [-1080.793] (-1079.955) (-1095.854) (-1093.925) -- 0:02:52
765000 -- [-1075.544] (-1087.987) (-1095.130) (-1093.129) * (-1077.271) [-1079.647] (-1090.295) (-1094.771) -- 0:02:51
Average standard deviation of split frequencies: 0.009760
766000 -- (-1080.116) (-1086.364) [-1076.845] (-1101.358) * [-1075.033] (-1093.720) (-1093.116) (-1091.681) -- 0:02:51
767000 -- [-1078.653] (-1078.086) (-1077.461) (-1107.456) * (-1074.373) (-1092.993) [-1067.740] (-1094.247) -- 0:02:50
768000 -- (-1077.447) [-1076.244] (-1100.844) (-1104.533) * (-1084.567) [-1091.463] (-1093.197) (-1095.195) -- 0:02:49
769000 -- (-1073.041) (-1091.175) [-1080.287] (-1101.934) * [-1076.819] (-1096.746) (-1086.310) (-1083.819) -- 0:02:48
770000 -- [-1078.478] (-1098.671) (-1084.091) (-1090.910) * (-1093.772) [-1080.982] (-1110.205) (-1085.970) -- 0:02:48
Average standard deviation of split frequencies: 0.009420
771000 -- [-1068.987] (-1095.414) (-1087.777) (-1089.786) * (-1107.426) (-1092.203) [-1084.658] (-1073.360) -- 0:02:47
772000 -- (-1079.437) (-1090.545) (-1086.113) [-1083.817] * (-1090.115) (-1091.974) [-1078.070] (-1087.339) -- 0:02:46
773000 -- (-1092.285) [-1083.001] (-1082.082) (-1105.513) * (-1083.323) [-1079.109] (-1089.083) (-1097.024) -- 0:02:45
774000 -- [-1096.775] (-1091.280) (-1084.681) (-1098.119) * [-1092.594] (-1081.085) (-1078.358) (-1086.057) -- 0:02:45
775000 -- (-1102.672) (-1107.189) [-1080.484] (-1081.621) * (-1098.007) [-1073.091] (-1088.771) (-1090.801) -- 0:02:44
Average standard deviation of split frequencies: 0.008906
776000 -- [-1089.123] (-1118.172) (-1095.377) (-1094.861) * (-1110.233) [-1076.969] (-1095.116) (-1090.113) -- 0:02:43
777000 -- (-1091.602) (-1095.254) (-1093.369) [-1086.295] * (-1086.482) (-1074.098) [-1080.429] (-1102.462) -- 0:02:43
778000 -- (-1092.810) [-1083.775] (-1100.411) (-1094.402) * [-1089.695] (-1083.631) (-1093.015) (-1101.752) -- 0:02:42
779000 -- (-1092.153) (-1075.999) (-1086.253) [-1078.042] * (-1082.744) [-1103.498] (-1083.037) (-1093.429) -- 0:02:41
780000 -- (-1090.506) [-1096.612] (-1087.881) (-1090.346) * (-1076.410) [-1081.491] (-1086.665) (-1092.784) -- 0:02:40
Average standard deviation of split frequencies: 0.008732
781000 -- (-1096.386) (-1089.907) (-1102.217) [-1079.459] * [-1085.279] (-1085.612) (-1091.161) (-1077.310) -- 0:02:40
782000 -- (-1103.839) [-1080.845] (-1111.491) (-1076.627) * [-1081.782] (-1103.385) (-1092.649) (-1087.702) -- 0:02:39
783000 -- (-1095.556) (-1090.693) (-1095.133) [-1086.192] * [-1077.373] (-1091.050) (-1102.079) (-1086.903) -- 0:02:38
784000 -- (-1085.754) (-1078.647) [-1085.901] (-1089.405) * (-1099.610) [-1075.756] (-1092.265) (-1086.604) -- 0:02:37
785000 -- (-1078.049) (-1096.268) (-1102.880) [-1074.993] * (-1094.820) (-1093.646) [-1086.476] (-1088.335) -- 0:02:37
Average standard deviation of split frequencies: 0.008804
786000 -- [-1082.739] (-1091.728) (-1097.217) (-1076.102) * (-1104.523) (-1084.518) [-1083.935] (-1088.481) -- 0:02:36
787000 -- (-1087.594) [-1096.571] (-1089.351) (-1078.997) * [-1080.366] (-1090.985) (-1110.670) (-1098.770) -- 0:02:35
788000 -- [-1082.315] (-1086.602) (-1094.520) (-1085.377) * (-1095.547) (-1095.293) (-1107.337) [-1079.545] -- 0:02:34
789000 -- (-1111.673) (-1096.757) (-1081.392) [-1080.880] * (-1100.290) [-1087.666] (-1096.638) (-1085.115) -- 0:02:34
790000 -- (-1098.786) (-1091.997) (-1078.585) [-1074.911] * [-1097.726] (-1084.218) (-1105.829) (-1102.134) -- 0:02:33
Average standard deviation of split frequencies: 0.008538
791000 -- (-1098.829) (-1094.414) [-1083.617] (-1076.418) * (-1093.585) [-1069.200] (-1083.004) (-1088.791) -- 0:02:32
792000 -- (-1091.120) [-1073.880] (-1092.820) (-1098.911) * (-1096.547) [-1066.504] (-1092.364) (-1089.845) -- 0:02:32
793000 -- (-1089.548) [-1068.176] (-1087.978) (-1079.128) * (-1099.038) (-1080.464) [-1087.895] (-1082.667) -- 0:02:31
794000 -- (-1097.005) (-1111.830) (-1092.520) [-1079.526] * (-1095.149) [-1071.178] (-1087.949) (-1097.443) -- 0:02:30
795000 -- (-1086.306) (-1093.491) (-1092.803) [-1092.557] * (-1097.802) (-1092.924) [-1088.214] (-1095.221) -- 0:02:29
Average standard deviation of split frequencies: 0.008575
796000 -- (-1085.914) [-1068.840] (-1086.423) (-1089.732) * (-1085.666) (-1085.064) (-1083.916) [-1090.149] -- 0:02:29
797000 -- (-1085.398) (-1079.585) (-1087.273) [-1082.979] * (-1082.313) (-1077.620) (-1093.910) [-1077.338] -- 0:02:28
798000 -- [-1072.226] (-1078.358) (-1094.958) (-1115.475) * (-1092.958) (-1093.303) [-1077.300] (-1083.129) -- 0:02:27
799000 -- (-1087.653) [-1083.167] (-1090.150) (-1087.121) * (-1106.171) (-1079.918) (-1093.839) [-1071.299] -- 0:02:26
800000 -- (-1077.184) [-1071.293] (-1078.465) (-1092.968) * (-1103.280) (-1076.154) (-1098.002) [-1077.917] -- 0:02:26
Average standard deviation of split frequencies: 0.008725
801000 -- [-1069.369] (-1091.981) (-1097.525) (-1076.972) * [-1087.147] (-1092.955) (-1092.723) (-1079.707) -- 0:02:25
802000 -- [-1083.687] (-1113.475) (-1094.344) (-1102.552) * (-1083.744) (-1100.310) (-1099.293) [-1088.102] -- 0:02:24
803000 -- [-1073.709] (-1093.982) (-1091.486) (-1106.757) * [-1073.755] (-1098.515) (-1086.649) (-1085.020) -- 0:02:24
804000 -- [-1082.459] (-1081.438) (-1090.257) (-1104.263) * [-1083.323] (-1100.169) (-1087.558) (-1085.557) -- 0:02:23
805000 -- (-1076.570) (-1080.263) [-1080.395] (-1097.487) * [-1079.357] (-1091.953) (-1088.085) (-1089.567) -- 0:02:22
Average standard deviation of split frequencies: 0.008410
806000 -- (-1075.681) (-1092.070) [-1076.474] (-1104.318) * [-1081.172] (-1091.839) (-1079.593) (-1094.099) -- 0:02:21
807000 -- (-1088.691) (-1085.592) [-1077.374] (-1097.709) * (-1083.079) [-1077.256] (-1093.054) (-1093.908) -- 0:02:21
808000 -- [-1079.398] (-1098.640) (-1092.956) (-1117.881) * (-1093.053) (-1092.347) [-1086.065] (-1099.156) -- 0:02:20
809000 -- [-1074.244] (-1091.615) (-1090.747) (-1088.649) * [-1091.594] (-1081.072) (-1100.381) (-1094.091) -- 0:02:19
810000 -- (-1079.902) [-1078.604] (-1104.321) (-1084.082) * (-1103.939) [-1076.454] (-1082.721) (-1104.515) -- 0:02:18
Average standard deviation of split frequencies: 0.008502
811000 -- (-1085.823) (-1091.773) (-1082.366) [-1076.869] * (-1114.258) [-1088.916] (-1082.636) (-1104.439) -- 0:02:18
812000 -- [-1075.299] (-1086.909) (-1087.827) (-1092.561) * (-1086.575) (-1083.970) [-1083.806] (-1099.402) -- 0:02:17
813000 -- [-1073.783] (-1090.662) (-1100.523) (-1087.764) * (-1087.737) [-1081.020] (-1093.541) (-1093.642) -- 0:02:16
814000 -- [-1077.233] (-1084.776) (-1096.752) (-1089.854) * (-1084.322) (-1077.868) [-1088.750] (-1100.688) -- 0:02:15
815000 -- [-1082.747] (-1086.222) (-1078.603) (-1111.575) * [-1073.439] (-1087.225) (-1101.863) (-1103.384) -- 0:02:15
Average standard deviation of split frequencies: 0.008428
816000 -- (-1079.065) (-1080.060) [-1072.859] (-1115.820) * (-1101.694) (-1078.906) [-1092.195] (-1092.589) -- 0:02:14
817000 -- (-1092.788) [-1077.269] (-1106.428) (-1106.076) * (-1107.467) (-1086.572) [-1072.104] (-1108.574) -- 0:02:13
818000 -- (-1092.957) (-1086.659) [-1092.550] (-1091.159) * (-1083.927) (-1093.296) [-1082.602] (-1110.503) -- 0:02:13
819000 -- (-1094.686) (-1100.394) (-1098.464) [-1077.546] * (-1118.343) (-1079.901) (-1086.813) [-1078.334] -- 0:02:12
820000 -- (-1088.516) (-1108.812) (-1077.743) [-1072.710] * (-1093.381) (-1090.228) (-1098.550) [-1082.328] -- 0:02:11
Average standard deviation of split frequencies: 0.008444
821000 -- (-1088.975) (-1087.649) (-1086.335) [-1077.978] * (-1087.166) [-1089.961] (-1083.793) (-1085.083) -- 0:02:10
822000 -- [-1076.710] (-1094.811) (-1082.350) (-1090.214) * (-1082.308) (-1092.573) [-1082.194] (-1085.084) -- 0:02:10
823000 -- (-1088.551) [-1065.388] (-1089.570) (-1085.031) * (-1098.201) (-1099.627) (-1085.323) [-1076.453] -- 0:02:09
824000 -- (-1100.680) (-1076.226) (-1114.389) [-1091.723] * [-1077.647] (-1097.487) (-1102.867) (-1085.037) -- 0:02:08
825000 -- (-1080.333) [-1073.907] (-1118.107) (-1084.140) * (-1094.032) [-1081.448] (-1087.755) (-1093.701) -- 0:02:07
Average standard deviation of split frequencies: 0.008378
826000 -- (-1091.853) (-1084.300) (-1075.645) [-1083.818] * (-1091.274) (-1080.303) [-1093.613] (-1103.224) -- 0:02:07
827000 -- (-1085.369) (-1080.512) [-1079.828] (-1100.271) * (-1090.425) [-1080.572] (-1090.830) (-1083.361) -- 0:02:06
828000 -- [-1080.137] (-1078.118) (-1079.840) (-1086.863) * (-1087.020) (-1095.969) (-1090.675) [-1090.611] -- 0:02:05
829000 -- (-1092.316) (-1096.670) (-1093.398) [-1079.373] * (-1097.418) (-1088.794) (-1107.172) [-1087.099] -- 0:02:05
830000 -- (-1096.112) (-1110.206) [-1084.194] (-1080.916) * (-1113.942) (-1093.741) [-1085.440] (-1092.508) -- 0:02:04
Average standard deviation of split frequencies: 0.008637
831000 -- [-1078.805] (-1100.908) (-1082.025) (-1083.082) * (-1095.806) (-1082.945) [-1091.616] (-1090.822) -- 0:02:03
832000 -- (-1101.080) (-1112.363) (-1082.553) [-1087.889] * (-1077.746) (-1089.488) (-1092.260) [-1075.447] -- 0:02:02
833000 -- (-1110.476) [-1092.400] (-1082.239) (-1096.291) * [-1078.725] (-1089.999) (-1095.338) (-1088.113) -- 0:02:02
834000 -- (-1093.293) (-1090.015) [-1071.753] (-1109.494) * (-1086.563) (-1096.055) [-1084.357] (-1099.969) -- 0:02:01
835000 -- (-1097.641) (-1102.603) (-1082.622) [-1087.586] * (-1103.272) [-1089.676] (-1106.401) (-1096.742) -- 0:02:00
Average standard deviation of split frequencies: 0.008695
836000 -- (-1108.458) (-1094.032) [-1089.660] (-1090.311) * (-1080.444) (-1084.126) (-1113.743) [-1083.829] -- 0:01:59
837000 -- (-1087.077) (-1094.848) (-1096.664) [-1084.146] * [-1073.499] (-1085.564) (-1117.419) (-1082.778) -- 0:01:59
838000 -- [-1078.927] (-1093.273) (-1089.374) (-1095.387) * (-1079.487) [-1084.488] (-1105.753) (-1072.185) -- 0:01:58
839000 -- [-1074.767] (-1083.799) (-1094.909) (-1097.999) * (-1085.479) (-1085.726) [-1078.031] (-1099.196) -- 0:01:57
840000 -- (-1087.648) [-1080.404] (-1091.420) (-1088.882) * (-1083.456) (-1089.919) (-1092.847) [-1081.715] -- 0:01:56
Average standard deviation of split frequencies: 0.008938
841000 -- [-1073.346] (-1119.713) (-1082.606) (-1095.296) * (-1089.826) (-1094.658) (-1092.943) [-1083.537] -- 0:01:56
842000 -- [-1079.989] (-1097.052) (-1092.835) (-1093.666) * [-1084.572] (-1099.087) (-1072.109) (-1105.959) -- 0:01:55
843000 -- [-1081.201] (-1090.628) (-1109.817) (-1085.337) * (-1086.688) (-1088.775) [-1073.006] (-1097.724) -- 0:01:54
844000 -- [-1081.413] (-1085.168) (-1089.325) (-1087.478) * (-1075.260) (-1098.066) [-1071.158] (-1086.089) -- 0:01:54
845000 -- (-1085.469) (-1090.318) [-1075.431] (-1083.045) * [-1089.169] (-1085.383) (-1078.884) (-1083.291) -- 0:01:53
Average standard deviation of split frequencies: 0.008704
846000 -- (-1096.860) (-1099.305) (-1085.843) [-1085.435] * [-1081.611] (-1120.433) (-1087.109) (-1085.525) -- 0:01:52
847000 -- [-1082.633] (-1096.266) (-1082.482) (-1098.888) * (-1090.771) (-1088.529) (-1083.018) [-1080.001] -- 0:01:51
848000 -- (-1080.120) (-1089.285) [-1086.606] (-1087.349) * (-1082.922) (-1075.966) [-1081.004] (-1087.874) -- 0:01:51
849000 -- (-1100.328) [-1077.727] (-1085.106) (-1097.730) * (-1084.536) (-1089.962) [-1084.079] (-1118.614) -- 0:01:50
850000 -- [-1072.593] (-1112.754) (-1096.000) (-1079.414) * (-1095.897) [-1078.030] (-1078.147) (-1107.203) -- 0:01:49
Average standard deviation of split frequencies: 0.008678
851000 -- (-1091.639) (-1098.700) [-1074.184] (-1091.764) * (-1094.718) (-1089.894) (-1088.056) [-1090.461] -- 0:01:48
852000 -- (-1088.550) (-1084.008) (-1083.883) [-1082.575] * (-1076.340) (-1085.224) (-1082.867) [-1068.143] -- 0:01:48
853000 -- [-1088.553] (-1092.408) (-1085.858) (-1104.694) * [-1069.890] (-1083.519) (-1097.403) (-1074.886) -- 0:01:47
854000 -- (-1081.530) (-1074.934) [-1074.595] (-1081.823) * (-1093.659) [-1098.427] (-1097.538) (-1079.828) -- 0:01:46
855000 -- (-1078.397) (-1090.752) [-1087.394] (-1086.457) * (-1099.855) (-1082.079) (-1087.696) [-1083.945] -- 0:01:45
Average standard deviation of split frequencies: 0.008602
856000 -- (-1076.329) (-1074.578) [-1084.296] (-1108.765) * (-1116.483) (-1091.310) (-1086.224) [-1080.041] -- 0:01:45
857000 -- (-1080.641) (-1082.105) [-1084.587] (-1077.669) * (-1097.076) (-1100.823) (-1102.298) [-1096.887] -- 0:01:44
858000 -- (-1081.336) (-1088.378) [-1088.688] (-1088.379) * [-1094.891] (-1095.460) (-1084.997) (-1092.716) -- 0:01:43
859000 -- (-1079.668) [-1089.659] (-1092.198) (-1087.911) * (-1093.692) [-1078.534] (-1104.496) (-1101.893) -- 0:01:43
860000 -- (-1105.774) [-1082.646] (-1103.702) (-1081.286) * (-1085.864) [-1080.638] (-1111.103) (-1073.985) -- 0:01:42
Average standard deviation of split frequencies: 0.008369
861000 -- (-1081.869) [-1082.449] (-1092.331) (-1090.172) * (-1102.306) (-1102.634) (-1106.608) [-1080.091] -- 0:01:41
862000 -- (-1097.207) [-1077.942] (-1083.583) (-1083.220) * (-1088.580) [-1081.868] (-1098.489) (-1094.769) -- 0:01:40
863000 -- (-1111.205) (-1081.365) (-1112.452) [-1069.787] * (-1078.394) (-1088.193) [-1090.684] (-1094.390) -- 0:01:40
864000 -- (-1099.041) (-1101.617) (-1079.506) [-1080.700] * (-1074.967) (-1095.755) (-1082.163) [-1082.206] -- 0:01:39
865000 -- (-1108.933) [-1078.461] (-1090.035) (-1082.643) * [-1083.171] (-1088.404) (-1097.589) (-1086.678) -- 0:01:38
Average standard deviation of split frequencies: 0.007937
866000 -- (-1090.514) [-1083.534] (-1098.257) (-1089.494) * [-1083.236] (-1083.364) (-1094.213) (-1082.729) -- 0:01:37
867000 -- (-1090.937) [-1070.653] (-1086.410) (-1081.441) * (-1078.156) [-1077.888] (-1099.886) (-1095.126) -- 0:01:37
868000 -- (-1099.239) [-1075.622] (-1094.432) (-1078.409) * (-1082.021) [-1069.977] (-1088.998) (-1084.710) -- 0:01:36
869000 -- (-1077.383) (-1097.896) [-1078.809] (-1088.315) * (-1086.928) (-1080.235) (-1084.528) [-1081.957] -- 0:01:35
870000 -- (-1074.628) [-1079.238] (-1092.932) (-1071.166) * (-1096.961) (-1095.094) [-1080.332] (-1101.594) -- 0:01:35
Average standard deviation of split frequencies: 0.007894
871000 -- (-1100.831) (-1094.623) (-1080.106) [-1075.812] * [-1072.254] (-1079.792) (-1097.010) (-1111.810) -- 0:01:34
872000 -- (-1106.947) (-1082.248) (-1088.162) [-1090.521] * [-1084.262] (-1079.707) (-1098.412) (-1090.638) -- 0:01:33
873000 -- (-1098.627) (-1077.554) [-1088.094] (-1094.261) * (-1086.151) [-1072.906] (-1109.529) (-1089.592) -- 0:01:32
874000 -- (-1086.872) (-1095.440) (-1080.315) [-1084.364] * (-1095.566) [-1080.551] (-1108.334) (-1086.513) -- 0:01:32
875000 -- (-1098.960) (-1083.687) (-1085.035) [-1079.180] * (-1097.799) (-1071.561) [-1095.705] (-1097.399) -- 0:01:31
Average standard deviation of split frequencies: 0.007437
876000 -- (-1095.142) [-1097.883] (-1090.155) (-1082.991) * [-1067.477] (-1088.493) (-1099.490) (-1096.668) -- 0:01:30
877000 -- [-1078.396] (-1089.067) (-1096.620) (-1097.887) * (-1088.254) (-1093.238) (-1094.572) [-1082.732] -- 0:01:29
878000 -- [-1076.639] (-1102.288) (-1080.187) (-1090.443) * (-1110.100) (-1101.241) (-1082.997) [-1086.738] -- 0:01:29
879000 -- [-1074.279] (-1088.727) (-1085.707) (-1091.037) * (-1100.344) (-1090.767) [-1076.823] (-1080.443) -- 0:01:28
880000 -- (-1096.388) (-1089.938) [-1092.857] (-1085.238) * (-1106.763) (-1078.582) (-1076.715) [-1087.231] -- 0:01:27
Average standard deviation of split frequencies: 0.007398
881000 -- (-1076.278) (-1091.144) (-1095.659) [-1078.544] * (-1087.953) [-1075.824] (-1093.886) (-1081.894) -- 0:01:26
882000 -- (-1084.206) (-1112.555) [-1100.114] (-1078.827) * [-1080.941] (-1091.084) (-1082.886) (-1091.569) -- 0:01:26
883000 -- (-1074.184) (-1111.319) [-1079.371] (-1082.031) * (-1104.638) [-1073.262] (-1085.387) (-1083.393) -- 0:01:25
884000 -- (-1082.669) (-1098.434) (-1107.140) [-1075.908] * (-1092.726) (-1087.439) (-1083.094) [-1083.730] -- 0:01:24
885000 -- [-1081.146] (-1093.504) (-1096.941) (-1091.029) * (-1090.419) (-1084.025) (-1091.380) [-1080.394] -- 0:01:24
Average standard deviation of split frequencies: 0.007172
886000 -- (-1089.077) (-1110.994) (-1087.440) [-1088.938] * (-1078.697) [-1082.184] (-1091.756) (-1088.913) -- 0:01:23
887000 -- (-1091.580) (-1092.863) [-1084.433] (-1089.310) * (-1081.050) (-1089.719) [-1076.762] (-1092.089) -- 0:01:22
888000 -- [-1087.942] (-1081.917) (-1097.224) (-1082.866) * (-1110.239) (-1076.388) (-1091.469) [-1080.380] -- 0:01:21
889000 -- (-1091.531) [-1089.427] (-1075.901) (-1080.309) * (-1083.121) (-1079.492) [-1075.053] (-1086.738) -- 0:01:21
890000 -- (-1097.855) (-1097.011) [-1087.569] (-1087.865) * (-1094.044) (-1084.303) (-1093.900) [-1075.571] -- 0:01:20
Average standard deviation of split frequencies: 0.006891
891000 -- (-1105.145) (-1094.135) [-1077.865] (-1093.872) * (-1104.220) (-1081.502) (-1086.453) [-1086.602] -- 0:01:19
892000 -- [-1090.366] (-1071.968) (-1099.164) (-1090.197) * (-1119.661) [-1083.584] (-1084.172) (-1092.396) -- 0:01:18
893000 -- [-1088.416] (-1072.454) (-1096.263) (-1097.395) * (-1118.353) [-1091.517] (-1091.390) (-1093.218) -- 0:01:18
894000 -- (-1091.611) [-1084.756] (-1098.155) (-1089.565) * (-1103.731) (-1097.804) (-1077.728) [-1076.909] -- 0:01:17
895000 -- [-1086.294] (-1095.999) (-1090.694) (-1096.828) * [-1080.631] (-1112.215) (-1080.229) (-1082.239) -- 0:01:16
Average standard deviation of split frequencies: 0.006924
896000 -- (-1088.393) (-1079.165) (-1070.814) [-1077.461] * (-1085.145) (-1103.694) (-1094.235) [-1090.272] -- 0:01:16
897000 -- (-1100.824) [-1089.024] (-1085.352) (-1083.115) * [-1076.346] (-1096.038) (-1087.295) (-1082.907) -- 0:01:15
898000 -- (-1091.544) [-1096.152] (-1091.177) (-1077.613) * (-1078.234) (-1083.906) (-1089.502) [-1085.299] -- 0:01:14
899000 -- (-1095.672) (-1082.241) [-1089.839] (-1087.574) * (-1092.247) (-1087.390) [-1081.540] (-1089.678) -- 0:01:13
900000 -- [-1083.346] (-1088.312) (-1092.993) (-1099.188) * (-1088.482) [-1092.721] (-1093.283) (-1099.011) -- 0:01:13
Average standard deviation of split frequencies: 0.007097
901000 -- (-1088.393) (-1090.020) (-1091.531) [-1074.792] * (-1079.536) [-1071.103] (-1089.275) (-1092.244) -- 0:01:12
902000 -- (-1095.800) (-1085.344) (-1095.398) [-1072.127] * [-1076.019] (-1072.459) (-1103.710) (-1098.246) -- 0:01:11
903000 -- (-1101.830) [-1070.580] (-1106.949) (-1084.247) * [-1078.413] (-1088.559) (-1109.212) (-1101.116) -- 0:01:10
904000 -- (-1082.170) [-1094.091] (-1098.146) (-1082.274) * (-1080.090) (-1089.012) [-1080.213] (-1105.371) -- 0:01:10
905000 -- [-1081.802] (-1088.313) (-1086.714) (-1092.088) * (-1082.667) [-1093.286] (-1090.180) (-1109.657) -- 0:01:09
Average standard deviation of split frequencies: 0.006681
906000 -- (-1093.008) (-1095.212) (-1095.619) [-1086.421] * (-1080.205) [-1077.555] (-1104.557) (-1087.766) -- 0:01:08
907000 -- (-1093.073) (-1093.522) (-1087.456) [-1079.942] * (-1092.190) (-1098.758) [-1087.952] (-1079.715) -- 0:01:07
908000 -- (-1090.376) (-1109.342) (-1084.880) [-1071.780] * (-1105.225) (-1093.779) (-1073.225) [-1073.202] -- 0:01:07
909000 -- (-1092.147) [-1089.187] (-1101.152) (-1083.953) * (-1093.812) [-1093.071] (-1086.961) (-1084.880) -- 0:01:06
910000 -- (-1082.092) (-1089.468) (-1086.121) [-1082.961] * (-1088.294) (-1083.556) (-1108.690) [-1092.527] -- 0:01:05
Average standard deviation of split frequencies: 0.006429
911000 -- (-1110.327) [-1077.267] (-1100.422) (-1076.535) * [-1077.491] (-1086.983) (-1102.529) (-1089.686) -- 0:01:05
912000 -- (-1106.857) [-1078.077] (-1085.906) (-1099.746) * (-1091.625) [-1083.554] (-1092.182) (-1070.143) -- 0:01:04
913000 -- (-1097.812) (-1091.367) (-1078.263) [-1085.565] * [-1084.614] (-1082.757) (-1102.468) (-1081.730) -- 0:01:03
914000 -- (-1073.145) [-1085.711] (-1089.644) (-1093.933) * [-1079.594] (-1091.049) (-1093.240) (-1084.785) -- 0:01:02
915000 -- (-1094.736) [-1087.172] (-1090.108) (-1092.606) * (-1090.174) [-1073.602] (-1083.333) (-1102.646) -- 0:01:02
Average standard deviation of split frequencies: 0.006505
916000 -- (-1109.829) [-1085.674] (-1078.466) (-1094.357) * (-1087.295) [-1086.735] (-1090.522) (-1086.051) -- 0:01:01
917000 -- (-1091.099) [-1082.909] (-1090.637) (-1102.233) * (-1099.668) (-1108.961) [-1083.294] (-1091.319) -- 0:01:00
918000 -- (-1107.663) (-1085.658) (-1079.858) [-1093.670] * (-1086.189) (-1094.295) [-1078.798] (-1099.039) -- 0:00:59
919000 -- (-1088.255) (-1093.590) [-1074.071] (-1087.996) * [-1079.832] (-1096.314) (-1075.154) (-1087.148) -- 0:00:59
920000 -- (-1086.032) (-1109.825) (-1091.726) [-1079.608] * (-1085.944) (-1108.019) (-1086.848) [-1081.764] -- 0:00:58
Average standard deviation of split frequencies: 0.006708
921000 -- (-1073.578) (-1076.481) [-1089.912] (-1101.031) * (-1095.994) [-1071.062] (-1083.436) (-1096.858) -- 0:00:57
922000 -- [-1078.407] (-1075.892) (-1095.137) (-1085.292) * (-1097.597) [-1078.059] (-1072.683) (-1082.112) -- 0:00:57
923000 -- [-1093.961] (-1096.273) (-1106.410) (-1097.329) * (-1101.422) (-1096.226) [-1073.750] (-1094.724) -- 0:00:56
924000 -- (-1100.593) (-1078.080) (-1087.427) [-1078.658] * (-1117.907) (-1091.698) [-1085.002] (-1091.046) -- 0:00:55
925000 -- (-1092.446) (-1095.077) [-1077.505] (-1073.428) * (-1096.597) [-1087.336] (-1086.814) (-1089.808) -- 0:00:54
Average standard deviation of split frequencies: 0.006710
926000 -- [-1077.773] (-1084.810) (-1092.641) (-1103.687) * (-1095.886) [-1095.349] (-1097.998) (-1084.837) -- 0:00:54
927000 -- (-1084.314) [-1091.972] (-1097.675) (-1105.682) * (-1093.980) (-1114.473) [-1081.221] (-1084.274) -- 0:00:53
928000 -- (-1088.103) (-1114.579) (-1099.551) [-1095.953] * [-1092.056] (-1099.421) (-1091.249) (-1091.252) -- 0:00:52
929000 -- [-1089.821] (-1086.955) (-1095.273) (-1090.620) * (-1090.427) (-1104.932) [-1089.582] (-1098.727) -- 0:00:51
930000 -- (-1093.171) (-1102.082) (-1088.842) [-1072.687] * (-1097.686) (-1098.549) [-1080.927] (-1085.773) -- 0:00:51
Average standard deviation of split frequencies: 0.006696
931000 -- [-1083.117] (-1095.838) (-1091.927) (-1097.785) * (-1081.314) [-1086.081] (-1102.202) (-1105.038) -- 0:00:50
932000 -- (-1075.377) [-1077.936] (-1098.865) (-1085.326) * [-1092.865] (-1098.050) (-1092.951) (-1084.961) -- 0:00:49
933000 -- (-1101.668) (-1082.443) (-1092.740) [-1078.817] * (-1103.561) (-1098.981) [-1087.331] (-1092.876) -- 0:00:48
934000 -- (-1077.032) (-1084.248) [-1086.621] (-1092.963) * (-1114.526) [-1085.108] (-1103.045) (-1100.295) -- 0:00:48
935000 -- (-1078.666) [-1078.377] (-1090.546) (-1099.022) * [-1072.515] (-1076.315) (-1107.279) (-1088.372) -- 0:00:47
Average standard deviation of split frequencies: 0.006719
936000 -- (-1072.169) (-1081.902) [-1077.134] (-1102.362) * (-1088.846) (-1099.718) (-1087.876) [-1072.223] -- 0:00:46
937000 -- (-1087.075) (-1090.087) [-1079.658] (-1110.951) * (-1098.705) (-1091.651) [-1080.656] (-1072.195) -- 0:00:46
938000 -- (-1090.484) [-1098.408] (-1071.396) (-1125.278) * [-1086.929] (-1100.415) (-1081.958) (-1087.129) -- 0:00:45
939000 -- (-1085.007) (-1105.717) [-1076.213] (-1084.957) * (-1105.134) (-1099.769) [-1086.782] (-1090.787) -- 0:00:44
940000 -- (-1081.589) (-1093.113) (-1082.725) [-1080.364] * (-1094.862) [-1076.702] (-1107.523) (-1086.520) -- 0:00:43
Average standard deviation of split frequencies: 0.006755
941000 -- (-1088.484) (-1095.157) [-1081.467] (-1072.764) * (-1094.024) (-1087.304) (-1090.308) [-1077.085] -- 0:00:43
942000 -- (-1092.791) (-1096.026) (-1083.003) [-1083.150] * [-1096.497] (-1089.665) (-1078.530) (-1116.805) -- 0:00:42
943000 -- [-1097.570] (-1091.021) (-1080.161) (-1087.906) * (-1108.017) (-1092.840) [-1078.687] (-1092.730) -- 0:00:41
944000 -- (-1091.546) (-1084.718) [-1089.952] (-1093.738) * (-1093.645) [-1077.348] (-1102.960) (-1095.209) -- 0:00:40
945000 -- (-1099.829) (-1074.241) [-1084.738] (-1086.102) * [-1089.396] (-1096.238) (-1095.960) (-1093.001) -- 0:00:40
Average standard deviation of split frequencies: 0.006398
946000 -- [-1093.726] (-1076.736) (-1091.236) (-1110.649) * (-1100.703) (-1094.438) [-1081.291] (-1080.768) -- 0:00:39
947000 -- (-1082.411) [-1084.128] (-1078.843) (-1106.658) * (-1079.755) [-1079.222] (-1100.682) (-1101.135) -- 0:00:38
948000 -- (-1076.628) [-1075.465] (-1080.462) (-1086.465) * [-1092.639] (-1081.203) (-1091.447) (-1087.978) -- 0:00:38
949000 -- (-1078.953) (-1101.966) (-1090.285) [-1074.739] * (-1116.783) (-1076.973) [-1078.813] (-1086.807) -- 0:00:37
950000 -- [-1070.096] (-1079.065) (-1100.165) (-1089.767) * (-1094.890) (-1073.820) [-1077.265] (-1082.355) -- 0:00:36
Average standard deviation of split frequencies: 0.006621
951000 -- (-1082.809) [-1078.864] (-1082.425) (-1077.912) * [-1094.864] (-1091.363) (-1109.368) (-1078.861) -- 0:00:35
952000 -- (-1078.986) [-1077.115] (-1083.810) (-1102.795) * [-1076.418] (-1092.476) (-1093.381) (-1076.356) -- 0:00:35
953000 -- (-1086.368) [-1077.926] (-1104.311) (-1089.025) * (-1087.258) [-1082.517] (-1091.967) (-1091.457) -- 0:00:34
954000 -- (-1082.113) (-1087.093) (-1076.154) [-1083.699] * (-1093.390) (-1085.748) (-1097.768) [-1083.697] -- 0:00:33
955000 -- (-1090.799) [-1077.526] (-1092.110) (-1093.898) * (-1090.368) [-1073.252] (-1095.026) (-1078.505) -- 0:00:32
Average standard deviation of split frequencies: 0.006696
956000 -- (-1093.929) [-1083.735] (-1093.488) (-1096.242) * (-1089.717) [-1075.178] (-1097.024) (-1079.699) -- 0:00:32
957000 -- (-1096.576) [-1069.058] (-1078.885) (-1092.289) * (-1088.765) (-1093.706) (-1093.896) [-1078.740] -- 0:00:31
958000 -- (-1089.544) [-1084.830] (-1075.547) (-1092.794) * (-1094.957) (-1105.951) (-1086.638) [-1082.846] -- 0:00:30
959000 -- (-1089.178) [-1086.233] (-1077.581) (-1100.144) * (-1087.806) (-1110.538) [-1079.808] (-1101.852) -- 0:00:29
960000 -- [-1071.075] (-1099.152) (-1087.593) (-1083.803) * [-1086.899] (-1106.793) (-1087.680) (-1085.628) -- 0:00:29
Average standard deviation of split frequencies: 0.006803
961000 -- (-1084.558) (-1101.664) [-1077.819] (-1094.130) * [-1091.924] (-1115.911) (-1098.451) (-1086.774) -- 0:00:28
962000 -- (-1096.836) (-1089.429) (-1080.755) [-1076.505] * (-1094.483) [-1085.125] (-1091.447) (-1092.467) -- 0:00:27
963000 -- (-1098.961) (-1088.324) (-1083.604) [-1087.224] * (-1100.926) (-1085.156) (-1095.429) [-1091.090] -- 0:00:27
964000 -- (-1098.794) [-1078.978] (-1081.400) (-1090.392) * (-1087.130) (-1077.289) (-1105.023) [-1081.535] -- 0:00:26
965000 -- (-1099.522) (-1091.843) (-1097.171) [-1088.841] * (-1083.117) (-1081.575) (-1083.333) [-1069.133] -- 0:00:25
Average standard deviation of split frequencies: 0.007109
966000 -- [-1091.293] (-1085.224) (-1098.935) (-1083.639) * (-1105.941) [-1082.935] (-1089.251) (-1086.880) -- 0:00:24
967000 -- [-1082.540] (-1088.456) (-1113.053) (-1083.195) * (-1084.565) (-1103.549) (-1097.946) [-1083.418] -- 0:00:24
968000 -- [-1083.480] (-1093.902) (-1097.493) (-1084.189) * (-1081.702) (-1090.270) (-1098.138) [-1084.747] -- 0:00:23
969000 -- (-1090.509) (-1090.803) [-1083.367] (-1094.478) * (-1081.130) (-1096.348) [-1076.721] (-1085.591) -- 0:00:22
970000 -- (-1095.206) (-1082.367) [-1076.941] (-1106.661) * [-1078.845] (-1090.744) (-1099.582) (-1086.804) -- 0:00:21
Average standard deviation of split frequencies: 0.007161
971000 -- (-1102.321) [-1087.316] (-1085.017) (-1095.312) * [-1075.469] (-1082.648) (-1104.351) (-1090.440) -- 0:00:21
972000 -- [-1081.327] (-1091.532) (-1085.662) (-1080.936) * (-1104.602) (-1080.810) [-1078.445] (-1091.204) -- 0:00:20
973000 -- [-1084.615] (-1080.221) (-1097.497) (-1082.995) * (-1106.497) [-1083.755] (-1095.315) (-1091.993) -- 0:00:19
974000 -- (-1074.266) (-1084.304) [-1078.067] (-1091.246) * (-1087.563) (-1098.415) (-1103.961) [-1087.424] -- 0:00:19
975000 -- [-1075.065] (-1080.738) (-1088.237) (-1078.578) * [-1089.308] (-1098.794) (-1099.764) (-1082.495) -- 0:00:18
Average standard deviation of split frequencies: 0.007122
976000 -- (-1085.802) [-1083.609] (-1093.393) (-1098.397) * (-1104.961) (-1084.621) (-1089.419) [-1085.485] -- 0:00:17
977000 -- [-1089.299] (-1075.031) (-1082.140) (-1105.575) * (-1068.198) (-1109.283) (-1087.163) [-1073.181] -- 0:00:16
978000 -- (-1088.995) (-1099.385) [-1076.644] (-1106.987) * (-1097.758) (-1095.671) (-1089.125) [-1081.847] -- 0:00:16
979000 -- (-1087.292) [-1088.213] (-1084.894) (-1084.493) * [-1086.716] (-1092.536) (-1092.550) (-1084.775) -- 0:00:15
980000 -- (-1080.829) (-1098.332) [-1070.897] (-1084.204) * [-1085.832] (-1093.301) (-1091.512) (-1101.760) -- 0:00:14
Average standard deviation of split frequencies: 0.007095
981000 -- (-1093.418) (-1084.929) [-1076.696] (-1093.374) * [-1075.013] (-1107.664) (-1101.259) (-1088.047) -- 0:00:13
982000 -- (-1079.483) (-1097.210) (-1092.698) [-1090.645] * (-1089.402) [-1084.528] (-1102.421) (-1085.995) -- 0:00:13
983000 -- (-1079.090) (-1089.992) [-1091.492] (-1099.782) * [-1080.272] (-1091.472) (-1096.999) (-1104.825) -- 0:00:12
984000 -- (-1092.109) (-1080.633) (-1099.606) [-1088.190] * (-1092.096) [-1083.245] (-1090.941) (-1099.066) -- 0:00:11
985000 -- (-1107.565) (-1086.090) (-1101.680) [-1088.117] * (-1076.739) [-1068.149] (-1098.695) (-1096.396) -- 0:00:10
Average standard deviation of split frequencies: 0.006971
986000 -- [-1087.385] (-1085.858) (-1100.327) (-1084.763) * (-1081.440) [-1083.094] (-1103.699) (-1101.773) -- 0:00:10
987000 -- (-1101.523) [-1072.080] (-1096.632) (-1093.350) * (-1101.253) [-1079.120] (-1108.978) (-1087.876) -- 0:00:09
988000 -- (-1104.830) [-1075.323] (-1088.601) (-1088.927) * (-1091.906) [-1078.257] (-1100.092) (-1080.979) -- 0:00:08
989000 -- [-1085.674] (-1092.369) (-1093.340) (-1093.433) * (-1099.633) [-1079.738] (-1099.788) (-1080.856) -- 0:00:08
990000 -- (-1090.318) (-1105.012) [-1086.672] (-1091.637) * (-1085.152) (-1086.766) (-1101.218) [-1088.564] -- 0:00:07
Average standard deviation of split frequencies: 0.007166
991000 -- (-1092.647) (-1072.281) (-1093.338) [-1076.354] * (-1089.191) (-1109.719) (-1094.464) [-1085.098] -- 0:00:06
992000 -- [-1085.454] (-1083.465) (-1101.906) (-1082.025) * [-1090.932] (-1088.744) (-1114.552) (-1092.282) -- 0:00:05
993000 -- [-1072.751] (-1099.288) (-1089.381) (-1086.844) * (-1084.557) (-1083.952) (-1089.455) [-1085.963] -- 0:00:05
994000 -- (-1090.920) [-1079.141] (-1096.116) (-1089.312) * (-1101.708) (-1089.838) (-1096.135) [-1083.246] -- 0:00:04
995000 -- (-1112.156) [-1077.121] (-1096.749) (-1090.160) * [-1086.929] (-1095.157) (-1094.296) (-1084.370) -- 0:00:03
Average standard deviation of split frequencies: 0.007267
996000 -- (-1091.308) (-1093.102) [-1072.786] (-1091.783) * (-1087.319) [-1086.005] (-1083.584) (-1080.459) -- 0:00:02
997000 -- (-1096.472) (-1092.202) [-1083.662] (-1094.972) * (-1099.297) (-1088.277) (-1075.794) [-1077.612] -- 0:00:02
998000 -- (-1091.005) (-1097.034) (-1089.665) [-1077.859] * (-1093.960) (-1085.685) [-1093.056] (-1087.194) -- 0:00:01
999000 -- (-1097.961) (-1095.117) (-1093.037) [-1077.636] * (-1082.843) (-1090.127) (-1099.224) [-1074.297] -- 0:00:00
1000000 -- (-1103.808) [-1075.896] (-1092.011) (-1080.796) * (-1093.368) [-1083.696] (-1085.755) (-1079.437) -- 0:00:00
Average standard deviation of split frequencies: 0.007066
Analysis completed in 12 mins 11 seconds
Analysis used 730.36 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1059.75
Likelihood of best state for "cold" chain of run 2 was -1060.26
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
54.7 % ( 39 %) Dirichlet(Revmat{all})
71.7 % ( 65 %) Slider(Revmat{all})
33.2 % ( 28 %) Dirichlet(Pi{all})
34.9 % ( 24 %) Slider(Pi{all})
57.5 % ( 35 %) Multiplier(Alpha{1,2})
60.8 % ( 23 %) Multiplier(Alpha{3})
78.7 % ( 53 %) Slider(Pinvar{all})
48.3 % ( 39 %) ExtSPR(Tau{all},V{all})
37.4 % ( 30 %) ExtTBR(Tau{all},V{all})
55.2 % ( 50 %) NNI(Tau{all},V{all})
34.6 % ( 38 %) ParsSPR(Tau{all},V{all})
27.3 % ( 23 %) Multiplier(V{all})
67.3 % ( 64 %) Nodeslider(V{all})
25.6 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
54.0 % ( 54 %) Dirichlet(Revmat{all})
71.9 % ( 60 %) Slider(Revmat{all})
33.8 % ( 26 %) Dirichlet(Pi{all})
35.2 % ( 36 %) Slider(Pi{all})
57.1 % ( 31 %) Multiplier(Alpha{1,2})
60.6 % ( 32 %) Multiplier(Alpha{3})
79.1 % ( 66 %) Slider(Pinvar{all})
48.6 % ( 41 %) ExtSPR(Tau{all},V{all})
37.4 % ( 40 %) ExtTBR(Tau{all},V{all})
55.0 % ( 50 %) NNI(Tau{all},V{all})
34.4 % ( 29 %) ParsSPR(Tau{all},V{all})
27.4 % ( 26 %) Multiplier(V{all})
67.5 % ( 68 %) Nodeslider(V{all})
25.5 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.51 0.20 0.06
2 | 167005 0.53 0.22
3 | 166991 167158 0.55
4 | 166225 166332 166289
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.51 0.20 0.06
2 | 167480 0.53 0.22
3 | 166524 166544 0.55
4 | 165981 166635 166836
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1077.67
| 2 2 |
| 1 1 |
| 1 1 1 2 |
| 2 2 1 1 1 |
| 122 12 22 2 1 1 |
| 1 1 1 11 1 22 21 2 1|
| 21 2 1* 12 2 11 2 2 211 1 |
| 21 1 2 2 22 2 1 1 2 2 2 2|
| 1 2 1 22 1 1 1 2 2 * 22 |
|1 1 2 1 22 2 1 2 2 1 |
| * 2 1 1 1 2 2 1 122 * |
| 11 12 1 1 |
| 11* 1 |
| 2 |
|2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1085.73
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1067.96 -1097.64
2 -1069.66 -1103.07
--------------------------------------
TOTAL -1068.48 -1102.38
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.423846 0.002804 0.326037 0.530339 0.420690 1366.55 1383.56 1.000
r(A<->C){all} 0.091389 0.001129 0.032276 0.160658 0.088500 534.99 545.09 1.000
r(A<->G){all} 0.172207 0.001669 0.100152 0.254588 0.168477 611.76 675.21 1.000
r(A<->T){all} 0.081730 0.000488 0.042295 0.127442 0.080033 692.83 758.04 1.000
r(C<->G){all} 0.032199 0.000610 0.000045 0.080253 0.026518 556.68 585.80 1.000
r(C<->T){all} 0.531572 0.003082 0.420104 0.635364 0.533030 640.46 647.85 1.000
r(G<->T){all} 0.090903 0.000741 0.044897 0.147332 0.088133 713.18 761.25 1.000
pi(A){all} 0.296715 0.000557 0.250362 0.341705 0.296233 892.08 950.26 1.000
pi(C){all} 0.145053 0.000298 0.112492 0.178976 0.144243 762.10 790.27 1.000
pi(G){all} 0.193555 0.000393 0.156533 0.234158 0.193303 1099.28 1162.24 1.000
pi(T){all} 0.364676 0.000578 0.316428 0.409807 0.364229 804.08 955.16 1.000
alpha{1,2} 0.729988 0.265502 0.138972 1.663839 0.586726 1066.68 1125.87 1.000
alpha{3} 1.608187 0.861166 0.370928 3.505420 1.389508 1296.55 1350.82 1.000
pinvar{all} 0.205208 0.015207 0.000006 0.421413 0.200471 790.90 912.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C224
2 -- C21
3 -- C71
4 -- C161
5 -- C251
6 -- C290
7 -- C39
8 -- C19
9 -- C22
10 -- C174
11 -- C114
12 -- C236
13 -- C104
14 -- C101
15 -- C124
16 -- C129
17 -- C10
18 -- C133
19 -- C137
20 -- C14
21 -- C165
22 -- C175
23 -- C190
24 -- C193
25 -- C36
26 -- C205
27 -- C208
28 -- C25
29 -- C231
30 -- C233
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
------------------------------------
1 -- .*****************************
2 -- .*............................
3 -- ..*...........................
4 -- ...*..........................
5 -- ....*.........................
6 -- .....*........................
7 -- ......*.......................
8 -- .......*......................
9 -- ........*.....................
10 -- .........*....................
11 -- ..........*...................
12 -- ...........*..................
13 -- ............*.................
14 -- .............*................
15 -- ..............*...............
16 -- ...............*..............
17 -- ................*.............
18 -- .................*............
19 -- ..................*...........
20 -- ...................*..........
21 -- ....................*.........
22 -- .....................*........
23 -- ......................*.......
24 -- .......................*......
25 -- ........................*.....
26 -- .........................*....
27 -- ..........................*...
28 -- ...........................*..
29 -- ............................*.
30 -- .............................*
31 -- .*.*..****..**..*..*********..
32 -- ............................**
33 -- .***************************..
34 -- ..*.**....**..**.**...........
35 -- ...............*.**...........
36 -- .*.....*......................
37 -- ............*......*......*...
38 -- ............*......*..**..*...
39 -- ....**....*...**.**...........
40 -- ...*..*.**...*..*...**..**.*..
41 -- .*.*..****...*..*...**..**.*..
42 -- ...*.........*................
43 -- ........*.......*.............
44 -- ...*....*....*................
45 -- .*.....*....*......*..**..*...
46 -- ...............*.*............
47 -- ...................*......*...
48 -- ............*......*..........
49 -- ...............*..*...........
50 -- .................**...........
51 -- ..*.**....*...**.**...........
52 -- ..*........*..................
53 -- ......................**......
54 -- ............*.............*...
55 -- ............*......*..*...*...
56 -- ....**....**..**.**...........
57 -- ............*......*...*..*...
58 -- ....**........**.**...........
59 -- ...*..*.**...*..*...**..*..*..
60 -- ...*....*.....................
61 -- ....*..........*.**...........
62 -- .....*........*...............
63 -- ..............**.**...........
64 -- ........*....*................
65 -- ....*.........*...............
66 -- .....*.........*.**...........
67 -- ....**........................
68 -- ....*.....*...................
69 -- ....**....*...*...............
70 -- ..........*...*...............
71 -- .*.*..****...*..*...**..*..*..
72 -- ....*.....*...**.**...........
73 -- .....*....*...................
74 -- ..*.......*...................
75 -- ....*.........**.**...........
76 -- .....*....*...**.**...........
77 -- .....*........**.**...........
78 -- ..........*....*.**...........
79 -- ....**.........*.**...........
80 -- ....**........*...............
------------------------------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
31 3002 1.000000 0.000000 1.000000 1.000000 2
32 3002 1.000000 0.000000 1.000000 1.000000 2
33 3001 0.999667 0.000471 0.999334 1.000000 2
34 3000 0.999334 0.000942 0.998668 1.000000 2
35 2999 0.999001 0.000471 0.998668 0.999334 2
36 2930 0.976016 0.001884 0.974684 0.977348 2
37 2789 0.929047 0.015546 0.918055 0.940040 2
38 2525 0.841106 0.003298 0.838774 0.843438 2
39 2507 0.835110 0.002355 0.833444 0.836775 2
40 1939 0.645903 0.012719 0.636909 0.654897 2
41 1907 0.635243 0.001413 0.634244 0.636243 2
42 1333 0.444037 0.009893 0.437042 0.451033 2
43 1148 0.382412 0.032034 0.359760 0.405063 2
44 1123 0.374084 0.040043 0.345769 0.402398 2
45 1049 0.349434 0.000471 0.349101 0.349767 2
46 1006 0.335110 0.008480 0.329114 0.341106 2
47 1005 0.334777 0.013662 0.325117 0.344437 2
48 1005 0.334777 0.016488 0.323118 0.346436 2
49 998 0.332445 0.002827 0.330446 0.334444 2
50 997 0.332112 0.010835 0.324450 0.339773 2
51 957 0.318787 0.013662 0.309127 0.328448 2
52 943 0.314124 0.002355 0.312458 0.315789 2
53 942 0.313791 0.004711 0.310460 0.317122 2
54 940 0.313125 0.001884 0.311792 0.314457 2
55 899 0.299467 0.005182 0.295803 0.303131 2
56 883 0.294137 0.009893 0.287142 0.301133 2
57 868 0.289141 0.004711 0.285809 0.292472 2
58 825 0.274817 0.013662 0.265157 0.284477 2
59 582 0.193871 0.002827 0.191872 0.195869 2
60 512 0.170553 0.005653 0.166556 0.174550 2
61 469 0.156229 0.007066 0.151233 0.161226 2
62 467 0.155563 0.004240 0.152565 0.158561 2
63 467 0.155563 0.002355 0.153897 0.157229 2
64 456 0.151899 0.006595 0.147235 0.156562 2
65 440 0.146569 0.004711 0.143238 0.149900 2
66 431 0.143571 0.010835 0.135909 0.151233 2
67 404 0.134577 0.002827 0.132578 0.136576 2
68 366 0.121919 0.003769 0.119254 0.124584 2
69 357 0.118921 0.006124 0.114590 0.123251 2
70 357 0.118921 0.004240 0.115923 0.121919 2
71 357 0.118921 0.008951 0.112592 0.125250 2
72 354 0.117921 0.004711 0.114590 0.121252 2
73 352 0.117255 0.009422 0.110593 0.123917 2
74 342 0.113924 0.003769 0.111259 0.116589 2
75 335 0.111592 0.004240 0.108594 0.114590 2
76 332 0.110593 0.004711 0.107262 0.113924 2
77 328 0.109260 0.005653 0.105263 0.113258 2
78 316 0.105263 0.000942 0.104597 0.105929 2
79 303 0.100933 0.010835 0.093271 0.108594 2
80 297 0.098934 0.008951 0.092605 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.061728 0.000240 0.034540 0.094065 0.060322 1.000 2
length{all}[2] 0.002233 0.000005 0.000001 0.006823 0.001539 1.000 2
length{all}[3] 0.015264 0.000042 0.004332 0.028007 0.014198 1.000 2
length{all}[4] 0.002524 0.000007 0.000002 0.007637 0.001755 1.000 2
length{all}[5] 0.004486 0.000010 0.000018 0.010643 0.003755 1.000 2
length{all}[6] 0.002201 0.000005 0.000001 0.006629 0.001514 1.000 2
length{all}[7] 0.002272 0.000005 0.000001 0.006621 0.001550 1.000 2
length{all}[8] 0.002192 0.000005 0.000001 0.006615 0.001516 1.000 2
length{all}[9] 0.004395 0.000011 0.000011 0.010699 0.003643 1.001 2
length{all}[10] 0.002285 0.000005 0.000000 0.006765 0.001549 1.000 2
length{all}[11] 0.010568 0.000027 0.002021 0.020796 0.009691 1.000 2
length{all}[12] 0.036123 0.000116 0.016887 0.057879 0.034925 1.000 2
length{all}[13] 0.002217 0.000005 0.000001 0.006525 0.001538 1.000 2
length{all}[14] 0.004611 0.000011 0.000078 0.010897 0.003827 1.000 2
length{all}[15] 0.002191 0.000005 0.000001 0.006569 0.001556 1.000 2
length{all}[16] 0.002217 0.000005 0.000001 0.006866 0.001503 1.000 2
length{all}[17] 0.005937 0.000015 0.000317 0.013379 0.005060 1.000 2
length{all}[18] 0.002195 0.000005 0.000002 0.006609 0.001532 1.000 2
length{all}[19] 0.002192 0.000005 0.000000 0.006571 0.001493 1.000 2
length{all}[20] 0.002251 0.000005 0.000000 0.006814 0.001579 1.000 2
length{all}[21] 0.004533 0.000011 0.000123 0.010759 0.003744 1.000 2
length{all}[22] 0.002288 0.000005 0.000000 0.006873 0.001587 1.000 2
length{all}[23] 0.002240 0.000005 0.000000 0.006830 0.001536 1.000 2
length{all}[24] 0.002199 0.000005 0.000000 0.006565 0.001511 1.000 2
length{all}[25] 0.002287 0.000006 0.000000 0.006835 0.001534 1.000 2
length{all}[26] 0.003824 0.000010 0.000001 0.010304 0.003017 1.000 2
length{all}[27] 0.002289 0.000005 0.000002 0.006827 0.001572 1.000 2
length{all}[28] 0.002209 0.000005 0.000000 0.006747 0.001535 1.000 2
length{all}[29] 0.024126 0.000087 0.008262 0.042529 0.022812 1.000 2
length{all}[30] 0.016770 0.000063 0.003056 0.032347 0.015806 1.000 2
length{all}[31] 0.018615 0.000060 0.005330 0.034482 0.017517 1.000 2
length{all}[32] 0.047944 0.000179 0.026019 0.077240 0.046444 1.000 2
length{all}[33] 0.027888 0.000113 0.008523 0.047637 0.026876 1.000 2
length{all}[34] 0.013751 0.000041 0.002907 0.025828 0.012892 1.000 2
length{all}[35] 0.006740 0.000016 0.000803 0.014533 0.005952 1.002 2
length{all}[36] 0.006324 0.000020 0.000185 0.014988 0.005330 1.000 2
length{all}[37] 0.004439 0.000010 0.000068 0.010526 0.003743 1.001 2
length{all}[38] 0.006619 0.000020 0.000144 0.015439 0.005731 1.000 2
length{all}[39] 0.006590 0.000017 0.000467 0.014468 0.005791 1.000 2
length{all}[40] 0.006226 0.000016 0.000343 0.013855 0.005463 1.000 2
length{all}[41] 0.007103 0.000020 0.000322 0.015842 0.006130 1.000 2
length{all}[42] 0.003696 0.000011 0.000001 0.010154 0.002917 0.999 2
length{all}[43] 0.004520 0.000013 0.000034 0.012088 0.003612 0.999 2
length{all}[44] 0.004376 0.000009 0.000074 0.010258 0.003715 1.000 2
length{all}[45] 0.005741 0.000016 0.000135 0.012840 0.004927 0.999 2
length{all}[46] 0.002204 0.000005 0.000001 0.006899 0.001494 0.999 2
length{all}[47] 0.002298 0.000005 0.000002 0.006857 0.001520 0.999 2
length{all}[48] 0.002378 0.000006 0.000002 0.007184 0.001580 1.000 2
length{all}[49] 0.002238 0.000005 0.000002 0.006526 0.001591 1.001 2
length{all}[50] 0.002325 0.000006 0.000001 0.007019 0.001574 0.999 2
length{all}[51] 0.003055 0.000009 0.000005 0.009639 0.002039 0.999 2
length{all}[52] 0.002981 0.000009 0.000003 0.008912 0.002060 1.000 2
length{all}[53] 0.002425 0.000006 0.000009 0.007329 0.001700 0.999 2
length{all}[54] 0.002504 0.000006 0.000007 0.007640 0.001790 0.999 2
length{all}[55] 0.002147 0.000004 0.000003 0.006433 0.001523 0.999 2
length{all}[56] 0.003272 0.000010 0.000005 0.009813 0.002345 1.001 2
length{all}[57] 0.002349 0.000006 0.000001 0.006812 0.001636 0.999 2
length{all}[58] 0.003986 0.000012 0.000007 0.011241 0.002995 0.999 2
length{all}[59] 0.004188 0.000012 0.000020 0.010925 0.003375 0.998 2
length{all}[60] 0.002681 0.000006 0.000014 0.007985 0.002002 0.999 2
length{all}[61] 0.002369 0.000006 0.000001 0.007046 0.001539 1.000 2
length{all}[62] 0.002347 0.000005 0.000001 0.006660 0.001666 1.000 2
length{all}[63] 0.002178 0.000005 0.000002 0.006784 0.001522 0.998 2
length{all}[64] 0.002631 0.000007 0.000003 0.007621 0.001847 0.999 2
length{all}[65] 0.002286 0.000007 0.000004 0.007420 0.001399 0.998 2
length{all}[66] 0.002167 0.000005 0.000015 0.006570 0.001381 1.002 2
length{all}[67] 0.002086 0.000005 0.000005 0.006177 0.001434 0.998 2
length{all}[68] 0.002260 0.000005 0.000000 0.007078 0.001520 0.998 2
length{all}[69] 0.002289 0.000006 0.000001 0.006444 0.001475 0.997 2
length{all}[70] 0.002400 0.000006 0.000005 0.007681 0.001626 1.005 2
length{all}[71] 0.004579 0.000012 0.000218 0.011356 0.003783 0.997 2
length{all}[72] 0.002255 0.000005 0.000008 0.006420 0.001587 0.997 2
length{all}[73] 0.002217 0.000005 0.000005 0.006525 0.001533 0.999 2
length{all}[74] 0.006622 0.000019 0.000153 0.013970 0.005600 1.003 2
length{all}[75] 0.002127 0.000004 0.000003 0.006267 0.001473 0.997 2
length{all}[76] 0.002252 0.000005 0.000001 0.006318 0.001623 0.997 2
length{all}[77] 0.002260 0.000006 0.000003 0.007105 0.001550 0.998 2
length{all}[78] 0.002252 0.000004 0.000000 0.006328 0.001579 0.997 2
length{all}[79] 0.002505 0.000006 0.000002 0.007314 0.001655 0.998 2
length{all}[80] 0.002248 0.000005 0.000013 0.006955 0.001468 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007066
Maximum standard deviation of split frequencies = 0.040043
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/--------------------------------------------------------------------- C224 (1)
|
| /-------------- C231 (29)
|--------------------------100-------------------------+
| \-------------- C233 (30)
|
| /-------------- C21 (2)
| /------98-----+
| | \-------------- C19 (8)
| |
| | /-------------- C161 (4)
| | |
| | |-------------- C39 (7)
| | |
| /-----64-----+ |-------------- C22 (9)
| | | |
| | | |-------------- C174 (10)
| | | |
| | | |-------------- C101 (14)
+ | | |
| | \------65-----+-------------- C10 (17)
| | |
| | |-------------- C165 (21)
| | |
| | |-------------- C175 (22)
| | |
| /-----100-----+ |-------------- C36 (25)
| | | |
| | | |-------------- C205 (26)
| | | |
| | | \-------------- C25 (28)
| | |
| | | /-------------- C104 (13)
| | | |
| | | /------93-----+-------------- C14 (20)
| | | | |
| | | | \-------------- C208 (27)
| | \-----84-----+
\-----100-----+ |---------------------------- C190 (23)
| |
| \---------------------------- C193 (24)
|
| /----------------------------------------- C71 (3)
| |
| | /---------------------------- C251 (5)
| | |
| | |---------------------------- C290 (6)
| | |
| | |---------------------------- C114 (11)
| |-----84-----+
\-----100-----+ |---------------------------- C124 (15)
| |
| | /-------------- C129 (16)
| | |
| \-----100-----+-------------- C133 (18)
| |
| \-------------- C137 (19)
|
\----------------------------------------- C236 (12)
Phylogram (based on average branch lengths):
/-------------------------------------------------------- C224 (1)
|
| /--------------------- C231 (29)
|------------------------------------------+
| \--------------- C233 (30)
|
| /- C21 (2)
| /----+
| | \- C19 (8)
| |
| | /- C161 (4)
| | |
| | |- C39 (7)
| | |
| /-----+ |--- C22 (9)
| | | |
| | | |- C174 (10)
| | | |
| | | |--- C101 (14)
+ | | |
| | \----+---- C10 (17)
| | |
| | |--- C165 (21)
| | |
| | |- C175 (22)
| | |
| /---------------+ |- C36 (25)
| | | |
| | | |--- C205 (26)
| | | |
| | | \- C25 (28)
| | |
| | | /- C104 (13)
| | | |
| | | /---+- C14 (20)
| | | | |
| | | | \- C208 (27)
| | \----+
\------------------------+ |-- C190 (23)
| |
| \-- C193 (24)
|
| /------------- C71 (3)
| |
| | /---- C251 (5)
| | |
| | |- C290 (6)
| | |
| | |--------- C114 (11)
| |----+
\-----------+ |-- C124 (15)
| |
| | /- C129 (16)
| | |
| \-----+- C133 (18)
| |
| \- C137 (19)
|
\-------------------------------- C236 (12)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3002 trees sampled):
50 % credible set contains 1501 trees
90 % credible set contains 2702 trees
95 % credible set contains 2852 trees
99 % credible set contains 2972 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Fri Nov 18 14:39:27 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/DcCoV_HKU23_camel_Morocco_CAC2586_2016_NA_QEY10634_1_2016_03_05_Morocco_Camel_Betacoronavirus_1.result--
-- Starting log on Sat Nov 19 06:58:36 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/DcCoV_HKU23_camel_Morocco_CAC2586_2016_NA_QEY10634_1_2016_03_05_Morocco_Camel_Betacoronavirus_1.result/original_alignment/codeml,DcCoV_HKU23_camel_Morocco_CAC2586_2016_NA_QEY10634_1_2016_03_05_Morocco_Camel_Betacoronavirus_1.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C101 327 sites
reading seq# 2 C129 327 sites
reading seq# 3 C124 327 sites
reading seq# 4 C114 327 sites
reading seq# 5 C133 327 sites
reading seq# 6 C10 327 sites
reading seq# 7 C137 327 sites
reading seq# 8 C104 327 sites
reading seq# 9 C25 327 sites
reading seq#10 C14 327 sites
reading seq#11 C21 327 sites
reading seq#12 C224 327 sites
reading seq#13 C71 327 sites
reading seq#14 C165 327 sites
reading seq#15 C175 327 sites
reading seq#16 C251 327 sites
reading seq#17 C161 327 sites
reading seq#18 C290 327 sites
reading seq#19 C193 327 sites
reading seq#20 C190 327 sites
reading seq#21 C19 327 sites
reading seq#22 C39 327 sites
reading seq#23 C205 327 sites
reading seq#24 C208 327 sites
reading seq#25 C36 327 sites
reading seq#26 C174 327 sites
reading seq#27 C22 327 sites
reading seq#28 C233 327 sites
reading seq#29 C231 327 sites
reading seq#30 C236 327 sitesns = 30 ls = 327
Reading sequences, sequential format..
Reading seq # 1: C101
Reading seq # 2: C129
Reading seq # 3: C124
Reading seq # 4: C114
Reading seq # 5: C133
Reading seq # 6: C10
Reading seq # 7: C137
Reading seq # 8: C104
Reading seq # 9: C25
Reading seq #10: C14
Reading seq #11: C21
Reading seq #12: C224
Reading seq #13: C71
Reading seq #14: C165
Reading seq #15: C175
Reading seq #16: C251
Reading seq #17: C161
Reading seq #18: C290
Reading seq #19: C193
Reading seq #20: C190
Reading seq #21: C19
Reading seq #22: C39
Reading seq #23: C205
Reading seq #24: C208
Reading seq #25: C36
Reading seq #26: C174
Reading seq #27: C22
Reading seq #28: C233
Reading seq #29: C231
Reading seq #30: C236
Sites with gaps or missing data are removed.
66 ambiguity characters in seq. 30
22 sites are removed. 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109
Sequences read..
Counting site patterns.. 0:00
Compressing, 73 patterns at 87 / 87 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 73 patterns at 87 / 87 sites (100.0%), 0:00
Counting codons..
3480 bytes for distance
71248 bytes for conP
6424 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(12, (29, 28), ((((11, 21), (17, 22, 27, 26, 1, 6, 14, 15, 25, 23, 9)), ((8, 10, 24), 20, 19)), (13, (16, 18, 4, 3, (2, 5, 7)), 30))); MP score: 84
427488 bytes for conP, adjusted
1 node(s) used for scaling (Yang 2000 J Mol Evol 51:423-432):
34
0.057185 0.017812 0.081421 0.098791 0.105755 0.027336 0.022904 0.082214 0.040845 0.022299 0.074176 0.055349 0.047471 0.074096 0.041081 0.062618 0.059355 0.100877 0.081219 0.066269 0.082281 0.091903 0.064751 0.085736 0.015403 0.086496 0.101125 0.025162 0.025188 0.018514 0.073915 0.037559 0.101685 0.012295 0.100940 0.049020 0.101806 0.090996 0.011875 0.041426 0.059305 0.300000 0.593124 0.102617
ntime & nrate & np: 41 2 44
Bounds (np=44):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.692046
np = 44
lnL0 = -1004.548455
Iterating by ming2
Initial: fx= 1004.548455
x= 0.05718 0.01781 0.08142 0.09879 0.10576 0.02734 0.02290 0.08221 0.04084 0.02230 0.07418 0.05535 0.04747 0.07410 0.04108 0.06262 0.05935 0.10088 0.08122 0.06627 0.08228 0.09190 0.06475 0.08574 0.01540 0.08650 0.10113 0.02516 0.02519 0.01851 0.07391 0.03756 0.10169 0.01229 0.10094 0.04902 0.10181 0.09100 0.01188 0.04143 0.05930 0.30000 0.59312 0.10262
1 h-m-p 0.0000 0.0002 761.3273 +++ 944.010039 m 0.0002 50 | 1/44
2 h-m-p 0.0000 0.0000 337.3080 ++ 943.601677 m 0.0000 97 | 2/44
3 h-m-p 0.0000 0.0000 2786.6801 ++ 939.468278 m 0.0000 144 | 3/44
4 h-m-p 0.0000 0.0000 1517.3853 ++ 928.639141 m 0.0000 191 | 4/44
5 h-m-p 0.0000 0.0001 233.5465 ++ 923.198109 m 0.0001 238 | 5/44
6 h-m-p 0.0000 0.0000 172.0487 ++ 923.155978 m 0.0000 285 | 6/44
7 h-m-p 0.0000 0.0001 1373.7409 ++ 906.851945 m 0.0001 332 | 7/44
8 h-m-p 0.0000 0.0000 1482.7130 ++ 900.355983 m 0.0000 379 | 8/44
9 h-m-p 0.0000 0.0000 492.5037 ++ 899.582988 m 0.0000 426 | 9/44
10 h-m-p 0.0000 0.0000 437.6000 ++ 899.446461 m 0.0000 473 | 10/44
11 h-m-p 0.0000 0.0000 1503.2157 ++ 891.707261 m 0.0000 520 | 11/44
12 h-m-p 0.0000 0.0000 59651.1967 ++ 883.061224 m 0.0000 567 | 12/44
13 h-m-p 0.0000 0.0000 2224.0239 ++ 873.771251 m 0.0000 614 | 13/44
14 h-m-p 0.0000 0.0000 2571.1244 ++ 869.115967 m 0.0000 661 | 14/44
15 h-m-p 0.0000 0.0000 1079.9359 ++ 865.892720 m 0.0000 708 | 15/44
16 h-m-p 0.0000 0.0000 1110.6533 ++ 864.546442 m 0.0000 755 | 16/44
17 h-m-p 0.0000 0.0000 855.7516 ++ 863.846358 m 0.0000 802 | 17/44
18 h-m-p 0.0000 0.0000 746.9851 ++ 861.741714 m 0.0000 849 | 18/44
19 h-m-p 0.0000 0.0000 315.1552 ++ 860.947845 m 0.0000 896 | 19/44
20 h-m-p 0.0001 0.0017 75.9766 ++CYYYCC 857.223351 5 0.0012 952 | 19/44
21 h-m-p 0.0001 0.0004 191.3093 +YCYCCC 855.900042 5 0.0003 1008 | 19/44
22 h-m-p 0.0000 0.0001 517.1923 ++ 854.463967 m 0.0001 1055 | 19/44
23 h-m-p 0.0000 0.0000 363.5419
h-m-p: 4.38684970e-21 2.19342485e-20 3.63541942e+02 854.463967
.. | 19/44
24 h-m-p 0.0000 0.0007 256.4133 ++YCCY 850.084735 3 0.0003 1153 | 19/44
25 h-m-p 0.0001 0.0006 154.3200 +YYYYCYCCC 843.573949 8 0.0005 1212 | 19/44
26 h-m-p 0.0003 0.0013 180.4716 YCCCC 840.609316 4 0.0005 1266 | 19/44
27 h-m-p 0.0003 0.0017 151.3337 CYCC 838.653070 3 0.0005 1318 | 19/44
28 h-m-p 0.0001 0.0007 101.7039 +YYCCCC 837.366975 5 0.0005 1374 | 19/44
29 h-m-p 0.0002 0.0010 194.5216 YCCC 836.218802 3 0.0004 1426 | 19/44
30 h-m-p 0.0005 0.0024 107.5384 +YYCCCC 832.935157 5 0.0017 1482 | 19/44
31 h-m-p 0.0003 0.0015 304.7707 YCCCC 830.692834 4 0.0005 1536 | 19/44
32 h-m-p 0.0001 0.0007 197.6879 +YYYCCC 828.945731 5 0.0005 1591 | 19/44
33 h-m-p 0.0002 0.0012 254.0885 CCCC 827.735406 3 0.0004 1644 | 19/44
34 h-m-p 0.0005 0.0026 132.7530 CCYC 826.980291 3 0.0005 1696 | 19/44
35 h-m-p 0.0002 0.0012 115.8450 YCYCCC 826.056863 5 0.0006 1751 | 19/44
36 h-m-p 0.0008 0.0058 95.2713 CCC 825.210834 2 0.0009 1802 | 19/44
37 h-m-p 0.0007 0.0036 28.9358 CCCC 825.033577 3 0.0008 1855 | 19/44
38 h-m-p 0.0009 0.0115 24.8993 CCC 824.845294 2 0.0014 1906 | 19/44
39 h-m-p 0.0012 0.0058 9.7204 YCC 824.816142 2 0.0009 1956 | 19/44
40 h-m-p 0.0011 0.0207 7.3835 YCC 824.776741 2 0.0020 2006 | 19/44
41 h-m-p 0.0026 0.0165 5.5536 YC 824.760560 1 0.0012 2054 | 19/44
42 h-m-p 0.0011 0.0212 5.7848 CCC 824.740052 2 0.0013 2105 | 19/44
43 h-m-p 0.0040 0.0548 1.9112 YCCC 824.629199 3 0.0089 2157 | 19/44
44 h-m-p 0.0009 0.0215 18.7463 +CYC 824.088844 2 0.0035 2208 | 19/44
45 h-m-p 0.0012 0.0064 55.0940 YCCCC 822.703688 4 0.0025 2262 | 19/44
46 h-m-p 0.0010 0.0052 57.8167 +YCYCCC 820.916661 5 0.0029 2318 | 19/44
47 h-m-p 0.0005 0.0027 29.0600 CCCCC 820.767889 4 0.0007 2373 | 19/44
48 h-m-p 0.0017 0.0108 10.8759 YCCC 820.717020 3 0.0011 2425 | 19/44
49 h-m-p 0.0216 0.8053 0.5541 ++YCCC 819.851792 3 0.2441 2479 | 19/44
50 h-m-p 0.0026 0.0130 19.1938 CCCC 819.363646 3 0.0040 2557 | 19/44
51 h-m-p 0.2410 1.9617 0.3210 YCCC 818.647003 3 0.5193 2609 | 19/44
52 h-m-p 0.6606 4.4187 0.2523 YYCC 818.152024 3 0.8997 2685 | 19/44
53 h-m-p 0.8450 4.3519 0.2687 CCCC 817.589672 3 1.3699 2763 | 19/44
54 h-m-p 0.8027 4.0134 0.2207 CC 817.402560 1 0.8027 2837 | 19/44
55 h-m-p 1.3910 6.9548 0.1024 YCC 817.329349 2 0.9753 2912 | 19/44
56 h-m-p 1.6000 8.0000 0.0532 YCC 817.315109 2 1.0004 2987 | 19/44
57 h-m-p 1.6000 8.0000 0.0269 YC 817.312910 1 0.8708 3060 | 19/44
58 h-m-p 1.6000 8.0000 0.0061 YC 817.312636 1 0.7576 3133 | 19/44
59 h-m-p 1.6000 8.0000 0.0010 YC 817.312571 1 0.9907 3206 | 19/44
60 h-m-p 1.5049 8.0000 0.0007 C 817.312564 0 1.3440 3278 | 19/44
61 h-m-p 1.6000 8.0000 0.0002 Y 817.312563 0 1.2733 3350 | 19/44
62 h-m-p 1.6000 8.0000 0.0000 C 817.312563 0 1.3016 3422 | 19/44
63 h-m-p 1.6000 8.0000 0.0000 Y 817.312563 0 1.2392 3494 | 19/44
64 h-m-p 1.6000 8.0000 0.0000 C 817.312563 0 1.6000 3566 | 19/44
65 h-m-p 1.6000 8.0000 0.0000 C 817.312563 0 1.6000 3638 | 19/44
66 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 19/44
67 h-m-p 0.0160 8.0000 0.0001 ------------- | 19/44
68 h-m-p 0.0160 8.0000 0.0001 -------------
Out..
lnL = -817.312563
3891 lfun, 11673 eigenQcodon, 319062 P(t)
end of tree file.
Time used: 1:35
Model 2: PositiveSelection
TREE # 1
(12, (29, 28), ((((11, 21), (17, 22, 27, 26, 1, 6, 14, 15, 25, 23, 9)), ((8, 10, 24), 20, 19)), (13, (16, 18, 4, 3, (2, 5, 7)), 30))); MP score: 84
1 node(s) used for scaling (Yang 2000 J Mol Evol 51:423-432):
34
0.067088 0.016140 0.089279 0.063945 0.043763 0.104920 0.041761 0.035632 0.053475 0.087102 0.073466 0.054908 0.043581 0.026644 0.076520 0.089753 0.103526 0.053791 0.014881 0.065230 0.065713 0.048691 0.025750 0.044698 0.053936 0.049513 0.020880 0.066020 0.077808 0.064776 0.023731 0.099928 0.046620 0.044554 0.053400 0.072744 0.051075 0.040264 0.041261 0.070648 0.036328 3.282541 1.277078 0.256337 0.130714 1.442408
ntime & nrate & np: 41 3 46
Bounds (np=46):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.673905
np = 46
lnL0 = -949.068966
Iterating by ming2
Initial: fx= 949.068966
x= 0.06709 0.01614 0.08928 0.06395 0.04376 0.10492 0.04176 0.03563 0.05348 0.08710 0.07347 0.05491 0.04358 0.02664 0.07652 0.08975 0.10353 0.05379 0.01488 0.06523 0.06571 0.04869 0.02575 0.04470 0.05394 0.04951 0.02088 0.06602 0.07781 0.06478 0.02373 0.09993 0.04662 0.04455 0.05340 0.07274 0.05108 0.04026 0.04126 0.07065 0.03633 3.28254 1.27708 0.25634 0.13071 1.44241
1 h-m-p 0.0000 0.0003 835.0189 +++ 885.999943 m 0.0003 98 | 1/46
2 h-m-p 0.0000 0.0001 312.0682 ++ 877.892997 m 0.0001 193 | 2/46
3 h-m-p 0.0000 0.0000 89865.5775 ++ 852.297008 m 0.0000 287 | 3/46
4 h-m-p 0.0000 0.0000 915.3240 ++ 850.898518 m 0.0000 380 | 4/46
5 h-m-p 0.0000 0.0000 273.1728 ++ 848.264259 m 0.0000 472 | 5/46
6 h-m-p 0.0000 0.0000 424.6479 ++ 847.354965 m 0.0000 563 | 6/46
7 h-m-p 0.0000 0.0000 1760.0777 ++ 845.245182 m 0.0000 653 | 7/46
8 h-m-p 0.0000 0.0000 28718.9823 ++ 842.801208 m 0.0000 742 | 8/46
9 h-m-p 0.0000 0.0000 11637.2457 ++ 842.407949 m 0.0000 830 | 9/46
10 h-m-p 0.0000 0.0000 6359.8789 ++ 838.828391 m 0.0000 917 | 10/46
11 h-m-p 0.0000 0.0000 2444.4181 ++ 837.960569 m 0.0000 1003 | 11/46
12 h-m-p 0.0000 0.0000 3212.8869 ++ 837.713207 m 0.0000 1088 | 12/46
13 h-m-p 0.0000 0.0000 2068.8339 ++ 831.619710 m 0.0000 1172 | 13/46
14 h-m-p 0.0000 0.0000 1915.9828 ++ 831.469688 m 0.0000 1255 | 14/46
15 h-m-p 0.0000 0.0000 1865.5102 ++ 829.469385 m 0.0000 1337 | 15/46
16 h-m-p 0.0000 0.0000 974.0875 ++ 829.107884 m 0.0000 1418 | 16/46
17 h-m-p 0.0000 0.0000 905.2297 ++ 827.785451 m 0.0000 1498 | 17/46
18 h-m-p 0.0000 0.0000 636.9411 ++ 827.662167 m 0.0000 1577 | 18/46
19 h-m-p 0.0000 0.0001 253.3069 ++ 826.447259 m 0.0001 1655 | 19/46
20 h-m-p 0.0002 0.0018 40.0451 +CYYYCYCCC 824.225664 8 0.0013 1745 | 19/46
21 h-m-p 0.0002 0.0011 61.8399 CCCCC 823.803271 4 0.0003 1829 | 19/46
22 h-m-p 0.0010 0.0081 18.8359 CCCC 823.497442 3 0.0016 1911 | 19/46
23 h-m-p 0.0011 0.0059 26.6670 CCC 823.245495 2 0.0013 1991 | 19/46
24 h-m-p 0.0008 0.0069 42.2513 YCCC 822.795923 3 0.0018 2072 | 19/46
25 h-m-p 0.0021 0.0154 36.7896 YCCC 822.132358 3 0.0035 2153 | 19/46
26 h-m-p 0.0007 0.0036 100.8025 YCCCC 821.301737 4 0.0016 2236 | 19/46
27 h-m-p 0.0009 0.0047 133.3834 +YC 819.776373 1 0.0024 2314 | 19/46
28 h-m-p 0.0019 0.0096 32.6068 YCCC 819.323191 3 0.0032 2395 | 19/46
29 h-m-p 0.0022 0.0112 19.4930 CCC 819.172751 2 0.0021 2475 | 19/46
30 h-m-p 0.0022 0.0110 14.9275 ++ 818.628127 m 0.0110 2551 | 20/46
31 h-m-p 0.0028 0.0142 31.3850 YCC 818.369476 2 0.0022 2630 | 20/46
32 h-m-p 0.0180 0.0902 3.5507 CCC 818.300617 2 0.0065 2709 | 20/46
33 h-m-p 0.0024 0.0220 9.7771 +YCCC 818.073633 3 0.0064 2790 | 20/46
34 h-m-p 0.0058 0.0288 6.3114 YYC 817.963811 2 0.0050 2867 | 20/46
35 h-m-p 0.0089 0.0447 2.2143 CCCC 817.867081 3 0.0115 2948 | 20/46
36 h-m-p 0.0680 0.3398 0.2746 YCC 817.822812 2 0.0403 3026 | 19/46
37 h-m-p 0.0193 0.2029 0.5740 YCCC 817.781001 3 0.0364 3106 | 19/46
38 h-m-p 0.0308 0.3693 0.6785 YCCC 817.728950 3 0.0733 3187 | 19/46
39 h-m-p 0.0771 0.3853 0.4290 YCC 817.711624 2 0.0482 3266 | 19/46
40 h-m-p 0.0595 2.8298 0.3479 +CYC 817.644042 2 0.2597 3346 | 19/46
41 h-m-p 0.1415 0.7872 0.6385 CYC 817.621775 2 0.0389 3425 | 19/46
42 h-m-p 0.1183 0.5915 0.1872 CC 817.612342 1 0.0986 3503 | 19/46
43 h-m-p 0.0297 0.1484 0.6201 ++ 817.575433 m 0.1484 3579 | 19/46
44 h-m-p 0.5669 8.0000 0.1624 YCCC 817.427577 3 1.2733 3660 | 19/46
45 h-m-p 1.6000 8.0000 0.1115 YCC 817.337678 2 1.1288 3739 | 19/46
46 h-m-p 0.4995 2.4973 0.0783 CCC 817.306898 2 0.6578 3819 | 19/46
47 h-m-p 1.0379 8.0000 0.0496 CC 817.300806 1 0.8380 3897 | 19/46
48 h-m-p 1.6000 8.0000 0.0071 YC 817.299922 1 0.7479 3974 | 19/46
49 h-m-p 0.8068 8.0000 0.0066 C 817.299835 0 0.8420 4050 | 19/46
50 h-m-p 1.2479 8.0000 0.0044 Y 817.299807 0 2.1362 4126 | 19/46
51 h-m-p 0.8980 8.0000 0.0106 ++ 817.299632 m 8.0000 4202 | 19/46
52 h-m-p 0.9162 8.0000 0.0923 +YC 817.299092 1 2.3335 4280 | 19/46
53 h-m-p 1.3766 8.0000 0.1565 YY 817.298504 1 1.3766 4357 | 19/46
54 h-m-p 1.6000 8.0000 0.0190 CC 817.298146 1 0.5767 4435 | 19/46
55 h-m-p 0.0745 8.0000 0.1470 ++CYC 817.297470 2 1.7187 4516 | 19/46
56 h-m-p 1.6000 8.0000 0.1185 C 817.296901 0 1.6474 4592 | 19/46
57 h-m-p 1.6000 8.0000 0.0816 CYC 817.296574 2 1.0234 4671 | 19/46
58 h-m-p 0.1403 8.0000 0.5951 +YYC 817.296052 2 0.4332 4750 | 19/46
59 h-m-p 1.6000 8.0000 0.1388 YYC 817.295857 2 1.1574 4828 | 19/46
60 h-m-p 1.6000 8.0000 0.0644 YC 817.295590 1 0.8446 4905 | 19/46
61 h-m-p 0.3652 8.0000 0.1489 +CCC 817.295261 2 1.7080 4986 | 19/46
62 h-m-p 1.6000 8.0000 0.1056 CC 817.294924 1 2.1264 5064 | 19/46
63 h-m-p 1.6000 8.0000 0.1377 YY 817.294698 1 1.6000 5141 | 19/46
64 h-m-p 1.6000 8.0000 0.1051 C 817.294545 0 0.4290 5217 | 19/46
65 h-m-p 0.2273 8.0000 0.1984 +CYC 817.294370 2 1.3388 5297 | 19/46
66 h-m-p 1.5504 8.0000 0.1713 C 817.294211 0 1.5504 5373 | 19/46
67 h-m-p 1.6000 8.0000 0.0454 YC 817.294118 1 0.6894 5450 | 19/46
68 h-m-p 0.1244 8.0000 0.2516 ++YC 817.293972 1 1.2979 5529 | 19/46
69 h-m-p 1.6000 8.0000 0.2019 Y 817.293881 0 1.2035 5605 | 19/46
70 h-m-p 1.6000 8.0000 0.1139 Y 817.293784 0 3.0484 5681 | 19/46
71 h-m-p 0.3311 8.0000 1.0484 C 817.293677 0 0.3311 5757 | 19/46
72 h-m-p 0.8957 8.0000 0.3876 Y 817.293652 0 0.5266 5833 | 19/46
73 h-m-p 1.6000 8.0000 0.0941 C 817.293628 0 1.6000 5909 | 19/46
74 h-m-p 0.9301 8.0000 0.1619 +C 817.293584 0 3.7204 5986 | 19/46
75 h-m-p 1.6000 8.0000 0.1107 YC 817.293556 1 0.9955 6063 | 19/46
76 h-m-p 0.3260 8.0000 0.3381 +C 817.293529 0 1.7909 6140 | 19/46
77 h-m-p 1.6000 8.0000 0.3419 Y 817.293513 0 2.7450 6216 | 19/46
78 h-m-p 1.6000 8.0000 0.1409 Y 817.293505 0 1.1266 6292 | 19/46
79 h-m-p 0.3946 8.0000 0.4023 +C 817.293500 0 1.5784 6369 | 19/46
80 h-m-p 1.6000 8.0000 0.3287 Y 817.293497 0 2.8011 6445 | 19/46
81 h-m-p 1.6000 8.0000 0.2936 C 817.293495 0 1.7798 6521 | 19/46
82 h-m-p 1.5023 8.0000 0.3479 Y 817.293494 0 2.4256 6597 | 19/46
83 h-m-p 1.6000 8.0000 0.3443 C 817.293494 0 2.2301 6673 | 19/46
84 h-m-p 1.6000 8.0000 0.3460 C 817.293493 0 2.4186 6749 | 19/46
85 h-m-p 1.6000 8.0000 0.3794 C 817.293493 0 2.4572 6825 | 19/46
86 h-m-p 1.6000 8.0000 0.3305 C 817.293493 0 2.0643 6901 | 19/46
87 h-m-p 1.6000 8.0000 0.3928 C 817.293493 0 2.4146 6977 | 19/46
88 h-m-p 1.6000 8.0000 0.2980 C 817.293493 0 1.6000 7053 | 19/46
89 h-m-p 1.6000 8.0000 0.2307 C 817.293493 0 2.4267 7129 | 19/46
90 h-m-p 0.2770 8.0000 2.0209 Y 817.293493 0 0.2128 7205 | 19/46
91 h-m-p 1.6000 8.0000 0.1929 Y 817.293493 0 2.9145 7281 | 19/46
92 h-m-p 1.0626 8.0000 0.5292 Y 817.293493 0 2.3601 7357 | 19/46
93 h-m-p 0.3342 8.0000 3.7372 Y 817.293493 0 0.5773 7433 | 19/46
94 h-m-p 0.0673 3.6931 32.0639 --------------.. | 19/46
95 h-m-p 0.0160 8.0000 0.0013 --C 817.293493 0 0.0003 7599 | 19/46
96 h-m-p 0.0160 8.0000 0.0006 --Y 817.293493 0 0.0005 7677 | 19/46
97 h-m-p 0.0160 8.0000 0.0003 -C 817.293493 0 0.0010 7754 | 19/46
98 h-m-p 0.0160 8.0000 0.0003 ----Y 817.293493 0 0.0000 7834
Out..
lnL = -817.293493
7835 lfun, 31340 eigenQcodon, 963705 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -825.208591 S = -767.984368 -71.662237
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 73 patterns 6:22
did 20 / 73 patterns 6:22
did 30 / 73 patterns 6:22
did 40 / 73 patterns 6:22
did 50 / 73 patterns 6:22
did 60 / 73 patterns 6:22
did 70 / 73 patterns 6:22
did 73 / 73 patterns 6:22end of tree file.
Time used: 6:22
Model 7: beta
TREE # 1
(12, (29, 28), ((((11, 21), (17, 22, 27, 26, 1, 6, 14, 15, 25, 23, 9)), ((8, 10, 24), 20, 19)), (13, (16, 18, 4, 3, (2, 5, 7)), 30))); MP score: 84
1 node(s) used for scaling (Yang 2000 J Mol Evol 51:423-432):
34
0.083068 0.069834 0.094640 0.042012 0.036543 0.086253 0.041130 0.054451 0.083296 0.099572 0.057848 0.041945 0.106430 0.062875 0.101391 0.103947 0.021650 0.090902 0.038715 0.012587 0.088317 0.011952 0.103451 0.081124 0.046577 0.039988 0.071268 0.011203 0.085248 0.027912 0.046459 0.017364 0.020163 0.037910 0.026955 0.102228 0.037639 0.039844 0.089935 0.030811 0.032785 3.305324 0.335923 1.052327
ntime & nrate & np: 41 1 44
Bounds (np=44):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.846831
np = 44
lnL0 = -949.636881
Iterating by ming2
Initial: fx= 949.636881
x= 0.08307 0.06983 0.09464 0.04201 0.03654 0.08625 0.04113 0.05445 0.08330 0.09957 0.05785 0.04194 0.10643 0.06287 0.10139 0.10395 0.02165 0.09090 0.03871 0.01259 0.08832 0.01195 0.10345 0.08112 0.04658 0.03999 0.07127 0.01120 0.08525 0.02791 0.04646 0.01736 0.02016 0.03791 0.02696 0.10223 0.03764 0.03984 0.08993 0.03081 0.03278 3.30532 0.33592 1.05233
1 h-m-p 0.0000 0.0002 513.4147 +++ 915.478102 m 0.0002 94 | 1/44
2 h-m-p 0.0000 0.0000 614.6926 ++ 913.901350 m 0.0000 185 | 2/44
3 h-m-p 0.0000 0.0000 103295.0909 ++ 912.886478 m 0.0000 275 | 3/44
4 h-m-p 0.0000 0.0000 3570.1486 ++ 901.362651 m 0.0000 364 | 4/44
5 h-m-p 0.0000 0.0000 4797.9984 ++ 885.500587 m 0.0000 452 | 5/44
6 h-m-p 0.0000 0.0000 4136.5271 ++ 876.253977 m 0.0000 539 | 6/44
7 h-m-p 0.0000 0.0000 11524.1218 ++ 874.157389 m 0.0000 625 | 7/44
8 h-m-p 0.0000 0.0000 29316.2982 ++ 873.601902 m 0.0000 710 | 8/44
9 h-m-p 0.0000 0.0000 3927.0244 ++ 870.807980 m 0.0000 794 | 9/44
10 h-m-p 0.0000 0.0000 2004.3635 ++ 867.504093 m 0.0000 877 | 10/44
11 h-m-p 0.0000 0.0000 4178.8957 ++ 859.938969 m 0.0000 959 | 11/44
12 h-m-p 0.0000 0.0000 40350.2393 ++ 848.130769 m 0.0000 1040 | 12/44
13 h-m-p 0.0000 0.0000 11941.8862 ++ 838.474714 m 0.0000 1120 | 13/44
14 h-m-p 0.0000 0.0000 2336.2869 ++ 838.305920 m 0.0000 1199 | 14/44
15 h-m-p 0.0000 0.0000 1560.0172 ++ 835.668439 m 0.0000 1277 | 15/44
16 h-m-p 0.0000 0.0000 1143.6864 ++ 831.351488 m 0.0000 1354 | 16/44
17 h-m-p 0.0000 0.0000 1114.8018 ++ 830.985171 m 0.0000 1430 | 17/44
18 h-m-p 0.0000 0.0000 712.6772 ++ 830.953612 m 0.0000 1505 | 18/44
19 h-m-p 0.0000 0.0000 310.8742 ++ 830.328556 m 0.0000 1579 | 19/44
20 h-m-p 0.0001 0.0015 52.4697 ++CYYCCC 826.581625 5 0.0011 1663 | 19/44
21 h-m-p 0.0002 0.0008 53.8053 YCYCCC 825.827668 5 0.0004 1743 | 19/44
22 h-m-p 0.0001 0.0006 68.0015 YCCCC 825.438246 4 0.0002 1822 | 19/44
23 h-m-p 0.0002 0.0009 29.5777 CCCC 825.295982 3 0.0003 1900 | 19/44
24 h-m-p 0.0002 0.0015 39.6991 YCCC 825.065792 3 0.0005 1977 | 19/44
25 h-m-p 0.0003 0.0014 29.3627 YCC 825.002420 2 0.0002 2052 | 19/44
26 h-m-p 0.0004 0.0064 15.3930 +YYC 824.793633 2 0.0014 2127 | 19/44
27 h-m-p 0.0001 0.0007 65.6343 CCCC 824.671187 3 0.0002 2205 | 19/44
28 h-m-p 0.0006 0.0028 14.9787 CCCC 824.575027 3 0.0007 2283 | 19/44
29 h-m-p 0.0004 0.0060 27.4607 CC 824.467342 1 0.0005 2357 | 19/44
30 h-m-p 0.0025 0.0147 5.5678 CCC 824.354405 2 0.0028 2433 | 19/44
31 h-m-p 0.0049 0.0296 3.2021 YCC 824.289620 2 0.0029 2508 | 19/44
32 h-m-p 0.0018 0.0211 5.2951 CCC 824.159966 2 0.0026 2584 | 19/44
33 h-m-p 0.0068 0.0715 2.0454 CCC 824.101753 2 0.0064 2660 | 19/44
34 h-m-p 0.0048 0.0604 2.7145 YCC 823.967498 2 0.0078 2735 | 19/44
35 h-m-p 0.0052 0.0634 4.0265 YCCC 823.665351 3 0.0114 2812 | 19/44
36 h-m-p 0.0181 0.1373 2.5367 YCY 823.078947 2 0.0364 2887 | 19/44
37 h-m-p 0.0241 0.1265 3.8387 CYC 822.505962 2 0.0280 2962 | 19/44
38 h-m-p 0.0259 0.5492 4.1448 YCCC 821.121219 3 0.0615 3039 | 19/44
39 h-m-p 0.0404 0.2019 1.6205 CCCC 820.601903 3 0.0566 3117 | 19/44
40 h-m-p 0.0853 0.4266 0.2555 CCCC 820.279840 3 0.1075 3195 | 19/44
41 h-m-p 0.1036 1.4990 0.2651 +CCCCC 819.316037 4 0.5255 3276 | 19/44
42 h-m-p 0.3665 4.1234 0.3801 YCCC 819.028843 3 0.7896 3353 | 19/44
43 h-m-p 1.6000 8.0000 0.0379 YCCC 818.916102 3 0.9735 3430 | 19/44
44 h-m-p 0.2806 8.0000 0.1316 +CCC 818.885011 2 1.0176 3507 | 19/44
45 h-m-p 1.6000 8.0000 0.0506 YC 818.878770 1 0.9598 3580 | 19/44
46 h-m-p 1.5680 8.0000 0.0310 YC 818.877925 1 0.8034 3653 | 19/44
47 h-m-p 1.6000 8.0000 0.0061 YC 818.877805 1 1.0228 3726 | 19/44
48 h-m-p 1.6000 8.0000 0.0011 Y 818.877795 0 1.1762 3798 | 19/44
49 h-m-p 1.6000 8.0000 0.0002 Y 818.877794 0 1.0426 3870 | 19/44
50 h-m-p 1.6000 8.0000 0.0001 C 818.877794 0 1.3603 3942 | 19/44
51 h-m-p 1.6000 8.0000 0.0000 Y 818.877794 0 1.1912 4014 | 19/44
52 h-m-p 1.6000 8.0000 0.0000 C 818.877794 0 1.6000 4086 | 19/44
53 h-m-p 1.6000 8.0000 0.0000 --Y 818.877794 0 0.0250 4160
Out..
lnL = -818.877794
4161 lfun, 45771 eigenQcodon, 1706010 P(t)
end of tree file.
Time used: 14:50
Model 8: beta&w>1
TREE # 1
(12, (29, 28), ((((11, 21), (17, 22, 27, 26, 1, 6, 14, 15, 25, 23, 9)), ((8, 10, 24), 20, 19)), (13, (16, 18, 4, 3, (2, 5, 7)), 30))); MP score: 84
1 node(s) used for scaling (Yang 2000 J Mol Evol 51:423-432):
34
0.027389 0.047303 0.086304 0.038728 0.093364 0.086508 0.030485 0.102897 0.019565 0.070219 0.083869 0.046729 0.041416 0.047234 0.026994 0.052174 0.060411 0.078061 0.089441 0.039333 0.030347 0.065600 0.050657 0.077555 0.081722 0.088466 0.056305 0.054648 0.032771 0.066626 0.036080 0.021380 0.010550 0.064062 0.083929 0.103457 0.080521 0.108115 0.036609 0.048176 0.058070 3.257020 0.900000 0.902378 1.515215 1.300000
ntime & nrate & np: 41 2 46
Bounds (np=46):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.261162
np = 46
lnL0 = -952.966718
Iterating by ming2
Initial: fx= 952.966718
x= 0.02739 0.04730 0.08630 0.03873 0.09336 0.08651 0.03049 0.10290 0.01957 0.07022 0.08387 0.04673 0.04142 0.04723 0.02699 0.05217 0.06041 0.07806 0.08944 0.03933 0.03035 0.06560 0.05066 0.07756 0.08172 0.08847 0.05631 0.05465 0.03277 0.06663 0.03608 0.02138 0.01055 0.06406 0.08393 0.10346 0.08052 0.10812 0.03661 0.04818 0.05807 3.25702 0.90000 0.90238 1.51521 1.30000
1 h-m-p 0.0000 0.0002 617.3297 +++ 911.933670 m 0.0002 98 | 1/46
2 h-m-p 0.0000 0.0001 419.3529 ++ 897.618886 m 0.0001 193 | 2/46
3 h-m-p 0.0000 0.0000 637930.1325 ++ 887.088543 m 0.0000 287 | 3/46
4 h-m-p 0.0000 0.0000 23994.1391 ++ 878.802336 m 0.0000 380 | 4/46
5 h-m-p 0.0000 0.0000 2593.7352 ++ 873.438744 m 0.0000 472 | 5/46
6 h-m-p 0.0000 0.0000 3011.7047 ++ 870.015896 m 0.0000 563 | 6/46
7 h-m-p 0.0000 0.0000 5917.1406 ++ 867.649157 m 0.0000 653 | 7/46
8 h-m-p 0.0000 0.0000 6005.7310 ++ 862.161288 m 0.0000 742 | 8/46
9 h-m-p 0.0000 0.0000 6884.5495 ++ 860.826175 m 0.0000 830 | 9/46
10 h-m-p 0.0000 0.0000 5066.3955 ++ 855.138000 m 0.0000 917 | 10/46
11 h-m-p 0.0000 0.0000 4025.7343 ++ 853.927497 m 0.0000 1003 | 11/46
12 h-m-p 0.0000 0.0000 2800.8948 ++ 848.674960 m 0.0000 1088 | 12/46
13 h-m-p 0.0000 0.0000 2599.7426 ++ 847.521929 m 0.0000 1172 | 13/46
14 h-m-p 0.0000 0.0000 2722.0815 ++ 844.911070 m 0.0000 1255 | 14/46
15 h-m-p 0.0000 0.0000 1159.9300 ++ 839.936654 m 0.0000 1337 | 15/46
16 h-m-p 0.0000 0.0000 1255.1936 ++ 837.493100 m 0.0000 1418 | 16/46
17 h-m-p 0.0000 0.0000 842.9284 ++ 837.167108 m 0.0000 1498 | 17/46
18 h-m-p 0.0000 0.0000 498.7125 ++ 834.600754 m 0.0000 1577 | 18/46
19 h-m-p 0.0000 0.0000 289.3316 ++ 833.982854 m 0.0000 1655 | 19/46
20 h-m-p 0.0000 0.0011 60.6612 ++YYCYCCC 831.417125 6 0.0008 1743 | 19/46
21 h-m-p 0.0005 0.0025 50.4570 YCCCC 830.337971 4 0.0010 1826 | 19/46
22 h-m-p 0.0003 0.0013 54.6013 +YCYCCC 829.514547 5 0.0008 1911 | 19/46
23 h-m-p 0.0002 0.0008 73.9454 +CYC 828.728783 2 0.0007 1991 | 19/46
24 h-m-p 0.0000 0.0001 71.4338 ++ 828.535710 m 0.0001 2067 | 19/46
25 h-m-p 0.0000 0.0000 53.7166
h-m-p: 0.00000000e+00 0.00000000e+00 5.37166393e+01 828.535710
.. | 19/46
26 h-m-p 0.0000 0.0010 132.3985 +++CCCCC 823.296078 4 0.0007 2227 | 19/46
27 h-m-p 0.0003 0.0017 231.4874 CYCCC 821.758638 4 0.0002 2311 | 19/46
28 h-m-p 0.0001 0.0006 75.3359 YCYCCC 821.188095 5 0.0002 2395 | 19/46
29 h-m-p 0.0008 0.0039 22.9170 CCC 821.037770 2 0.0007 2475 | 19/46
30 h-m-p 0.0003 0.0035 61.0448 YCCC 820.855776 3 0.0004 2556 | 19/46
31 h-m-p 0.0005 0.0035 46.6773 CCCC 820.656036 3 0.0006 2638 | 19/46
32 h-m-p 0.0005 0.0024 29.3529 YYC 820.582702 2 0.0004 2716 | 19/46
33 h-m-p 0.0003 0.0043 38.0954 YC 820.446361 1 0.0007 2793 | 19/46
34 h-m-p 0.0004 0.0040 71.7134 YC 820.210596 1 0.0007 2870 | 19/46
35 h-m-p 0.0004 0.0020 127.0732 CCCC 819.814179 3 0.0007 2952 | 19/46
36 h-m-p 0.0007 0.0050 128.9421 YCC 819.531123 2 0.0005 3031 | 19/46
37 h-m-p 0.0006 0.0028 97.2795 CCCCC 819.254153 4 0.0007 3115 | 19/46
38 h-m-p 0.0005 0.0025 63.8947 YCC 819.179762 2 0.0003 3194 | 19/46
39 h-m-p 0.0011 0.0057 14.3214 YC 819.156516 1 0.0006 3271 | 19/46
40 h-m-p 0.0008 0.0215 10.0665 CC 819.132595 1 0.0011 3349 | 19/46
41 h-m-p 0.0022 0.0313 4.7714 YC 819.123637 1 0.0012 3426 | 19/46
42 h-m-p 0.0010 0.0153 5.6971 YC 819.120386 1 0.0005 3503 | 19/46
43 h-m-p 0.0017 0.0707 1.6092 CC 819.117507 1 0.0021 3581 | 19/46
44 h-m-p 0.0004 0.0450 7.7366 +CC 819.101429 1 0.0025 3660 | 19/46
45 h-m-p 0.0007 0.0061 26.3395 YC 819.091189 1 0.0005 3737 | 19/46
46 h-m-p 0.0004 0.0787 29.5889 ++CCC 818.857463 2 0.0094 3819 | 19/46
47 h-m-p 0.0037 0.0186 62.3282 YC 818.760442 1 0.0019 3896 | 19/46
48 h-m-p 0.0113 0.0567 8.2877 YC 818.747049 1 0.0021 3973 | 19/46
49 h-m-p 0.0068 0.1298 2.5981 CC 818.743757 1 0.0021 4051 | 19/46
50 h-m-p 0.0102 0.8566 0.5343 CC 818.740320 1 0.0116 4129 | 19/46
51 h-m-p 0.0043 0.9112 1.4309 +++YCCCCC 818.382507 5 0.3336 4217 | 19/46
52 h-m-p 0.3696 1.8478 0.3653 YCCC 818.278483 3 0.8125 4298 | 19/46
53 h-m-p 1.1249 8.0000 0.2638 CCC 818.209487 2 1.2343 4378 | 19/46
54 h-m-p 1.0267 5.1336 0.2806 YC 818.145556 1 1.7560 4455 | 19/46
55 h-m-p 1.3451 8.0000 0.3664 YCC 818.055649 2 2.2706 4534 | 19/46
56 h-m-p 1.2068 6.0340 0.5436 +YCCC 817.908587 3 3.3670 4616 | 19/46
57 h-m-p 1.4098 7.5827 1.2982 CCC 817.793533 2 1.2519 4696 | 19/46
58 h-m-p 0.6522 3.2609 1.6649 YC 817.674341 1 1.5043 4773 | 19/46
59 h-m-p 1.6000 8.0000 1.5325 CC 817.598081 1 2.4077 4851 | 19/46
60 h-m-p 1.6000 8.0000 2.0900 CYC 817.526806 2 2.1267 4930 | 19/46
61 h-m-p 1.1751 8.0000 3.7825 YCCC 817.465374 3 1.8576 5011 | 19/46
62 h-m-p 1.6000 8.0000 3.9719 CY 817.431063 1 1.6751 5089 | 19/46
63 h-m-p 0.7822 3.9112 7.4119 YC 817.399776 1 1.4630 5166 | 19/46
64 h-m-p 1.4674 7.7134 7.3898 YCC 817.370996 2 2.3220 5245 | 19/46
65 h-m-p 0.8047 4.0236 9.9012 +YC 817.350408 1 2.4115 5323 | 19/46
66 h-m-p 0.2325 1.1624 13.7321 ++ 817.339534 m 1.1624 5399 | 20/46
67 h-m-p 0.2438 1.2188 1.1982 --------------C 817.339534 0 0.0000 5489 | 20/46
68 h-m-p 0.0160 8.0000 0.0612 +C 817.339362 0 0.0626 5565 | 20/46
69 h-m-p 0.3948 8.0000 0.0097 YC 817.338944 1 0.7992 5641 | 20/46
70 h-m-p 1.6000 8.0000 0.0020 Y 817.338935 0 1.0379 5716 | 20/46
71 h-m-p 1.6000 8.0000 0.0002 ++ 817.338922 m 8.0000 5791 | 20/46
72 h-m-p 1.0582 8.0000 0.0017 ++ 817.338731 m 8.0000 5866 | 20/46
73 h-m-p 0.0828 8.0000 0.1630 ++CC 817.336907 1 1.5876 5945 | 20/46
74 h-m-p 1.6000 8.0000 0.0580 YC 817.335507 1 3.0316 6021 | 20/46
75 h-m-p 1.6000 8.0000 0.0041 Y 817.335504 0 0.9885 6096 | 20/46
76 h-m-p 1.6000 8.0000 0.0001 Y 817.335504 0 0.9848 6171 | 20/46
77 h-m-p 1.6000 8.0000 0.0000 Y 817.335504 0 1.0298 6246 | 20/46
78 h-m-p 1.6000 8.0000 0.0000 C 817.335504 0 1.6000 6321 | 20/46
79 h-m-p 1.6000 8.0000 0.0000 C 817.335504 0 1.6000 6396 | 20/46
80 h-m-p 1.6000 8.0000 0.0000 Y 817.335504 0 0.4000 6471
Out..
lnL = -817.335504
6472 lfun, 77664 eigenQcodon, 2918872 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -824.498824 S = -767.988676 -76.783323
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 73 patterns 29:20
did 20 / 73 patterns 29:20
did 30 / 73 patterns 29:21
did 40 / 73 patterns 29:21
did 50 / 73 patterns 29:21
did 60 / 73 patterns 29:21
did 70 / 73 patterns 29:21
did 73 / 73 patterns 29:21end of tree file.
Time used: 29:22
The loglikelihoods for models M1, M2, M7 and M8 are -817.312563 -817.293493 -818.877794 -817.335504 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
HCoV_OC43_Seattle_USA_SC9430_2018_NA_QEG03795_1_2019_USA_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
IWT_19_NA_BBM61090_1_2016_12_Japan_Unknown_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSRAWCRNQGSFCATLTLY
IWT_13_NA_BBM61050_1_2015_06_Japan_Unknown_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLY
HKU23_362F_NS5_AHN64784_1_2013_05_15_United_Arab_Emirates_Camel_Betacoronavirus_1 MDIWTPEIKYLRYTNGFNVSELEDVCFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLY
IWT_22_NA_BBM61140_1_2016_12_Japan_Unknown_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSRAWCRNQGSFCATLTLY
1926_2006_NS5a_AIV41797_1_2006_03_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACSKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
IWT_26_NA_BBM61180_1_2017_02_Japan_Unknown_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSRAWCRNQGSFCATLTLY
HCoV_OC43_UK_London_2011_NS5a_AMK59678_1_2011_08_20_United_Kingdom_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
39A_2007_NS5a_AIV41803_1_2007_04_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
2007_09_12_9_kDa_ATP16768_1_2007_France_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
3194A_2012_NS5a_AIV41899_1_2012_03_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPRVGYCRVPSHAWCRNQGRFCATFTLY
Obihiro12_1_p12_7_BAS18857_1_2012_Japan_Horse_Betacoronavirus_1 MDIWRPERKFLRFTNGFNVPELEDVCFKFNYQLPKVGYCRVPNYAWCRNQGSFCATFTLY
DcCoV_HKU23_camel_Ethiopia_CAC1019_2015_NA_QEY10626_1_2015_02_21_Ethiopia_Camel_Betacoronavirus_1 MDIWRPEIKYLRYTNGFNVSELEDVCFKFNYKFPKVGYCRVPSYAWCRNQGSFCATLTLY
MY_U208_12_NS5a_AQN78665_1_2012_03_28_Malaysia_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFKVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
N07_1541B_433X_NA_ARE29992_1_2016_USA_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
TCG_14_NA_BBM61350_1_2009_03_Japan_Unknown_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLY
MY_U1057_12_NS5a_AQN78753_1_2012_08_27_Malaysia_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
UNKNOWN_FJ425186_NA_ACJ66967_1_1994_01_01_USA_Antelope_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLY
OC43_human_USA_873_19_1987_NS4_AGT51641_1_1987_03_17_USA_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
OC43_human_USA_872_5_1987_NS4_AGT51671_1_1987_02_10_USA_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
3074A_2012_NS5a_AIV41839_1_2012_02_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPRVGYCRVPSHAWCRNQGRFCATFTLY
5484_2007_NS5a_AIV41935_1_2007_06_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
OC43_human_USA_912_36_1991_NS4_AGT51751_1_1991_02_22_USA_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
OC43_human_USA_9211_43_1992_NS4_AGT51781_1_1992_11_30_USA_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
5445_2007_NS5a_AIV41923_1_2007_06_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
MY_U945_12_NS5a_AQN78737_1_2012_08_01_Malaysia_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
3269A_2012_NS5a_AIV41845_1_2012_06_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACSKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLY
PHEV_CoV_swine_USA_15TOSU1765_2015_NA_ARC95268_1_2015_08_01_USA_Swine_Betacoronavirus_1 MDIWCPEMKYLRYTNGFNVSELEYVCFKYNYQFPKVGYCRVPNHAWCRNQGSFCATFTLY
PHEV_CoV_swine_USA_15TOSU1655_2015_NA_ARC95244_1_2015_08_01_USA_Swine_Betacoronavirus_1 MDIWCPEKKYLRYTNGFNVSELEDVCFKYNYQFPKVGYCRVPNYAWCRNQGRFCVTFTLY
Quebec_NA_AAL40403_1_NA_NA_Unknown_Betacoronavirus_1 MDIWRPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHVWCRNQGSFCATLTLY
**** ** *:**: ***:*.*** .* *:**::*:*******. .****** **.*:***
HCoV_OC43_Seattle_USA_SC9430_2018_NA_QEG03795_1_2019_USA_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
IWT_19_NA_BBM61090_1_2016_12_Japan_Unknown_Betacoronavirus_1 GKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG
IWT_13_NA_BBM61050_1_2015_06_Japan_Unknown_Betacoronavirus_1 GKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG
HKU23_362F_NS5_AHN64784_1_2013_05_15_United_Arab_Emirates_Camel_Betacoronavirus_1 GKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG
IWT_22_NA_BBM61140_1_2016_12_Japan_Unknown_Betacoronavirus_1 GKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG
1926_2006_NS5a_AIV41797_1_2006_03_China_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
IWT_26_NA_BBM61180_1_2017_02_Japan_Unknown_Betacoronavirus_1 GKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG
HCoV_OC43_UK_London_2011_NS5a_AMK59678_1_2011_08_20_United_Kingdom_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTVFANTVEDAVNKLVFLAVDFITWRRQELNVYG
39A_2007_NS5a_AIV41803_1_2007_04_China_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
2007_09_12_9_kDa_ATP16768_1_2007_France_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTVFANTVEDAVNKLVFLAVDFITWRRQELNVYG
3194A_2012_NS5a_AIV41899_1_2012_03_China_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
Obihiro12_1_p12_7_BAS18857_1_2012_Japan_Horse_Betacoronavirus_1 GKSKHYDKYFRIITGFTAFANTIEEAVNKLVLEAVDFIIWRSQNLNAYG
DcCoV_HKU23_camel_Ethiopia_CAC1019_2015_NA_QEY10626_1_2015_02_21_Ethiopia_Camel_Betacoronavirus_1 GKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAIDFITWRRQELNVYG
MY_U208_12_NS5a_AQN78665_1_2012_03_28_Malaysia_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
N07_1541B_433X_NA_ARE29992_1_2016_USA_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
TCG_14_NA_BBM61350_1_2009_03_Japan_Unknown_Betacoronavirus_1 GKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG
MY_U1057_12_NS5a_AQN78753_1_2012_08_27_Malaysia_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
UNKNOWN_FJ425186_NA_ACJ66967_1_1994_01_01_USA_Antelope_Betacoronavirus_1 GKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG
OC43_human_USA_873_19_1987_NS4_AGT51641_1_1987_03_17_USA_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
OC43_human_USA_872_5_1987_NS4_AGT51671_1_1987_02_10_USA_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
3074A_2012_NS5a_AIV41839_1_2012_02_China_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
5484_2007_NS5a_AIV41935_1_2007_06_China_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
OC43_human_USA_912_36_1991_NS4_AGT51751_1_1991_02_22_USA_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
OC43_human_USA_9211_43_1992_NS4_AGT51781_1_1992_11_30_USA_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTVFANTVEDAVNKLVFLAVDFITWRRQELNVYG
5445_2007_NS5a_AIV41923_1_2007_06_China_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
MY_U945_12_NS5a_AQN78737_1_2012_08_01_Malaysia_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
3269A_2012_NS5a_AIV41845_1_2012_06_China_Human_Betacoronavirus_1 GKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG
PHEV_CoV_swine_USA_15TOSU1765_2015_NA_ARC95268_1_2015_08_01_USA_Swine_Betacoronavirus_1 GKSKHYDNYFGIITGFTAFSNSLEEAVNKLVLLAVDFITWRSQSLNVYG
PHEV_CoV_swine_USA_15TOSU1655_2015_NA_ARC95244_1_2015_08_01_USA_Swine_Betacoronavirus_1 GKSKHYDNYFGIITGFTVFSNSLEEAVNKLVFLAVDFITWRSQCLNVYG
Quebec_NA_AAL40403_1_NA_NA_Unknown_Betacoronavirus_1 GKSKHYDKYFGVITGFTAFANTARGGC----------------------
*******:** :*.***.*:*: . .
>HCoV_OC43_Seattle_USA_SC9430_2018_NA_QEG03795_1_2019_USA_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATTTCTCCGTTACATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >IWT_19_NA_BBM61090_1_2016_12_Japan_Unknown_Betacoronavirus_1 ATGGACATCTGGAAACCTGAGATTAAATATCTCCGTTATACTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATAAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCGTGCTTGGTGCCGTAATCAAGGTAGCTTTTGTGCTACACTCACTCTTTATGGCAAATCCAAACATTATGATAAATATTTTGGAGTAATAACTGGTTTTACAGCATTCGCTAATACTGTAGAGGAGGCTGTCAACAAACTGGTTTTCTTAGCTGTTGATTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >IWT_13_NA_BBM61050_1_2015_06_Japan_Unknown_Betacoronavirus_1 ATGGACATCTGGAAACCTGAGATTAAATATCTCCGTTATACTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATAAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGCTTTTGTGCTACACTCACTCTTTATGGCAAATCCAAACATTATGATAAATATTTTGGAGTAATAACTGGTTTTACAGCATTCGCTAATACTGTAGAGGAGGCTGTCAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >HKU23_362F_NS5_AHN64784_1_2013_05_15_United_Arab_Emirates_Camel_Betacoronavirus_1 ATGGACATCTGGACACCTGAGATTAAATATCTCCGTTATACTAACGGTTTTAATGTCTCAGAATTAGAAGATGTTTGTTTTAAATTTAACTATAAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGCTTTTGTGCTACACTTACTCTTTATGGCAAATCCAAACATTATGATAAATATTTTGGAGTAATAACTGGTTTTACAGCATTCGCTAATACTGTAGAGGAGGCTGTCAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGGAGACAGGAGTTAAATGTTTATGGC >IWT_22_NA_BBM61140_1_2016_12_Japan_Unknown_Betacoronavirus_1 ATGGACATCTGGAAACCTGAGATTAAATATCTCCGTTATACTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATAAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCGTGCTTGGTGCCGTAATCAAGGTAGCTTTTGTGCTACACTCACTCTTTATGGCAAATCCAAACATTATGATAAATATTTTGGAGTAATAACTGGTTTTACAGCATTCGCTAATACTGTAGAGGAGGCTGTCAACAAACTGGTTTTCTTAGCTGTTGATTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >1926_2006_NS5a_AIV41797_1_2006_03_China_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTCTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTTACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGCAGACAGGAGTTAAATGTTTATGGC >IWT_26_NA_BBM61180_1_2017_02_Japan_Unknown_Betacoronavirus_1 ATGGACATCTGGAAACCTGAGATTAAATATCTCCGTTATACTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATAAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCGTGCTTGGTGCCGTAATCAAGGTAGCTTTTGTGCTACACTCACTCTTTATGGCAAATCCAAACATTATGATAAATATTTTGGAGTAATAACTGGTTTTACAGCATTCGCTAATACTGTAGAGGAGGCTGTCAACAAACTGGTTTTCTTAGCTGTTGATTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >HCoV_OC43_UK_London_2011_NS5a_AMK59678_1_2011_08_20_United_Kingdom_Human_Betacoronavirus_1 ATGGACATCTGGCGACCTGAGAAGAAATATCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGACAAATATTTTGGAGTAATAAATGGTTTCACAGTATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >39A_2007_NS5a_AIV41803_1_2007_04_China_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGCAGACAGGAGTTAAATGTTTATGGC >2007_09_12_9_kDa_ATP16768_1_2007_France_Human_Betacoronavirus_1 ATGGACATCTGGCGACCTGAGAAGAAATATCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGACAAATATTTTGGAGTAATAAATGGTTTCACAGTATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >3194A_2012_NS5a_AIV41899_1_2012_03_China_Human_Betacoronavirus_1 ATGGACATCTGGCGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAGAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGCAGACAGGAGTTAAATGTTTATGGC >Obihiro12_1_p12_7_BAS18857_1_2012_Japan_Horse_Betacoronavirus_1 ATGGACATCTGGAGACCTGAGAGGAAATTTCTCCGTTTTACTAACGGATTTAACGTCCCAGAATTAGAAGATGTCTGTTTTAAATTTAATTACCAATTGCCTAAAGTAGGATATTGTAGAGTTCCTAATTATGCTTGGTGTCGTAATCAAGGTAGCTTTTGTGCTACATTTACCCTTTACGGCAAATCCAAACATTATGATAAATATTTTAGAATAATAACTGGTTTCACAGCGTTCGCCAATACTATAGAGGAGGCTGTTAATAAACTGGTTTTAGAGGCTGTTGATTTTATTATCTGGCGTAGCCAGAATTTAAATGCTTATGGC >DcCoV_HKU23_camel_Ethiopia_CAC1019_2015_NA_QEY10626_1_2015_02_21_Ethiopia_Camel_Betacoronavirus_1 ATGGACATCTGGAGACCTGAGATTAAATATCTCCGTTATACTAATGGTTTTAATGTCTCAGAATTAGAAGATGTTTGTTTTAAATTTAACTATAAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTTATGCTTGGTGCCGTAATCAAGGTAGCTTTTGTGCTACACTTACTCTTTATGGCAAATCCAAACATTATGATAAATATTTCGGAGTAATAACTGGTTTTACAGCATTCGCTAATACTGTAGAGGAGGCTGTTAACAAACTGGTTTTCTTAGCTATTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >MY_U208_12_NS5a_AQN78665_1_2012_03_28_Malaysia_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAAAGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGCAGACAGGAGTTAAATGTTTATGGC >N07_1541B_433X_NA_ARE29992_1_2016_USA_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGCAGACAGGAGTTAAATGTTTATGGC >TCG_14_NA_BBM61350_1_2009_03_Japan_Unknown_Betacoronavirus_1 ATGGACATCTGGAAACCTGAGATTAAATATCTCCGTTATACTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATAAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGCTTTTGTGCTACACTCACTCTTTATGGCAAATCCAAACATTATGATAAATATTTTGGAGTAATAACTGGTTTTACAGCATTCGCTAATACTGTAGAGGAGGCTGTCAACAAACTGGTTTTTTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >MY_U1057_12_NS5a_AQN78753_1_2012_08_27_Malaysia_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >UNKNOWN_FJ425186_NA_ACJ66967_1_1994_01_01_USA_Antelope_Betacoronavirus_1 ATGGACATCTGGAAACCTGAGATTAAATATCTCCGTTATACTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATAAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGCTTTTGTGCTACACTCACTCTTTATGGCAAATCCAAACATTATGATAAATATTTTGGAGTAATAACTGGTTTTACAGCATTCGCTAATACTGTAGAGGAGGCTGTCAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >OC43_human_USA_873_19_1987_NS4_AGT51641_1_1987_03_17_USA_Human_Betacoronavirus_1 ATGGACATCTGGCGACCTGAGAAGAAATATCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGACAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >OC43_human_USA_872_5_1987_NS4_AGT51671_1_1987_02_10_USA_Human_Betacoronavirus_1 ATGGACATCTGGCGACCTGAGAAGAAATATCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGACAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >3074A_2012_NS5a_AIV41839_1_2012_02_China_Human_Betacoronavirus_1 ATGGACATCTGGCGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAGAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGCAGACAGGAGTTAAATGTTTATGGC >5484_2007_NS5a_AIV41935_1_2007_06_China_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGCAGACAGGAGTTAAATGTTTATGGC >OC43_human_USA_912_36_1991_NS4_AGT51751_1_1991_02_22_USA_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATATCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGCAGACAGGAGTTAAATGTTTATGGC >OC43_human_USA_9211_43_1992_NS4_AGT51781_1_1992_11_30_USA_Human_Betacoronavirus_1 ATGGACATCTGGCGACCTGAGAAGAAATATCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGACAAATATTTTGGAGTAATAAATGGTTTCACAGTATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >5445_2007_NS5a_AIV41923_1_2007_06_China_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGCAGACAGGAGTTAAATGTTTATGGC >MY_U945_12_NS5a_AQN78737_1_2012_08_01_Malaysia_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGCAGACAGGAGTTAAATGTTTATGGC >3269A_2012_NS5a_AIV41845_1_2012_06_China_Human_Betacoronavirus_1 ATGGACATTTGGAGACCTGAGAAGAAATTTCTCCGTTATATTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTCTAAATTTAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGCTTGGTGCCGTAATCAAGGTAGATTTTGTGCTACATTCACTCTTTATGGTAAATCCAAACATTATGATAAATATTTTGGAGTAATAAATGGTTTCACAGCATTCGCTAATACTGTAGAGGATGCTGTTAACAAACTGGTTTTCTTAGCTGTTGACTTTATTACCTGGCGTAGACAGGAGTTAAATGTTTATGGC >PHEV_CoV_swine_USA_15TOSU1765_2015_NA_ARC95268_1_2015_08_01_USA_Swine_Betacoronavirus_1 ATGGACATCTGGTGCCCTGAAATGAAATATCTCCGTTATACTAACGGATTTAATGTCTCAGAACTAGAATATGTTTGTTTTAAATATAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAATCATGCTTGGTGCCGAAACCAAGGTAGTTTTTGTGCTACATTTACTTTGTATGGCAAATCCAAACATTATGATAATTATTTTGGAATAATAACTGGTTTCACAGCATTCTCTAATTCTTTAGAAGAAGCTGTTAATAAACTGGTTCTTTTAGCTGTTGACTTTATTACCTGGCGAAGCCAGAGTTTAAATGTTTATGGC >PHEV_CoV_swine_USA_15TOSU1655_2015_NA_ARC95244_1_2015_08_01_USA_Swine_Betacoronavirus_1 ATGGACATCTGGTGTCCTGAAAAGAAATATCTCCGTTATACTAACGGATTTAATGTTTCAGAACTAGAAGATGTCTGTTTTAAATATAACTATCAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAATTATGCTTGGTGCCGTAATCAAGGTAGGTTTTGTGTTACATTTACTTTGTACGGCAAATCCAAACATTATGATAATTATTTTGGAATAATAACTGGTTTCACAGTATTCTCTAATTCTTTAGAAGAAGCTGTTAATAAACTGGTTTTTCTAGCTGTTGACTTTATTACCTGGCGAAGCCAGTGTTTAAATGTTTATGGC >Quebec_NA_AAL40403_1_NA_NA_Unknown_Betacoronavirus_1 ATGGACATCTGGAGACCTGAGATTAAATATCTCCGTTATACTAACGGTTTTAATGTCTCAGAATTAGAAGATGCTTGTTTTAAATTTAACTATAAATTTCCTAAAGTAGGATATTGTAGAGTTCCTAGTCATGTTTGGTGCCGTAATCAAGGTAGCTTTTGTGCTACACTCACTCTTTATGGCAAATCCAAACATTATGATAAATATTTTGGAGTAATAACTGGTTTTACAGCATTCGCTAATACTGCTAGAGGAGGCTGT------------------------------------------------------------------
>HCoV_OC43_Seattle_USA_SC9430_2018_NA_QEG03795_1_2019_USA_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >IWT_19_NA_BBM61090_1_2016_12_Japan_Unknown_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSRAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG >IWT_13_NA_BBM61050_1_2015_06_Japan_Unknown_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG >HKU23_362F_NS5_AHN64784_1_2013_05_15_United_Arab_Emirates_Camel_Betacoronavirus_1 MDIWTPEIKYLRYTNGFNVSELEDVCFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG >IWT_22_NA_BBM61140_1_2016_12_Japan_Unknown_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSRAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG >1926_2006_NS5a_AIV41797_1_2006_03_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACSKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >IWT_26_NA_BBM61180_1_2017_02_Japan_Unknown_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSRAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG >HCoV_OC43_UK_London_2011_NS5a_AMK59678_1_2011_08_20_United_Kingdom_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTVFANTVEDAVNKLVFLAVDFITWRRQELNVYG >39A_2007_NS5a_AIV41803_1_2007_04_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >2007_09_12_9_kDa_ATP16768_1_2007_France_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTVFANTVEDAVNKLVFLAVDFITWRRQELNVYG >3194A_2012_NS5a_AIV41899_1_2012_03_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPRVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >Obihiro12_1_p12_7_BAS18857_1_2012_Japan_Horse_Betacoronavirus_1 MDIWRPERKFLRFTNGFNVPELEDVCFKFNYQLPKVGYCRVPNYAWCRNQGSFCATFTLYGKSKHYDKYFRIITGFTAFANTIEEAVNKLVLEAVDFIIWRSQNLNAYG >DcCoV_HKU23_camel_Ethiopia_CAC1019_2015_NA_QEY10626_1_2015_02_21_Ethiopia_Camel_Betacoronavirus_1 MDIWRPEIKYLRYTNGFNVSELEDVCFKFNYKFPKVGYCRVPSYAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAIDFITWRRQELNVYG >MY_U208_12_NS5a_AQN78665_1_2012_03_28_Malaysia_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFKVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >N07_1541B_433X_NA_ARE29992_1_2016_USA_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >TCG_14_NA_BBM61350_1_2009_03_Japan_Unknown_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG >MY_U1057_12_NS5a_AQN78753_1_2012_08_27_Malaysia_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >UNKNOWN_FJ425186_NA_ACJ66967_1_1994_01_01_USA_Antelope_Betacoronavirus_1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG >OC43_human_USA_873_19_1987_NS4_AGT51641_1_1987_03_17_USA_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >OC43_human_USA_872_5_1987_NS4_AGT51671_1_1987_02_10_USA_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >3074A_2012_NS5a_AIV41839_1_2012_02_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPRVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >5484_2007_NS5a_AIV41935_1_2007_06_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >OC43_human_USA_912_36_1991_NS4_AGT51751_1_1991_02_22_USA_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >OC43_human_USA_9211_43_1992_NS4_AGT51781_1_1992_11_30_USA_Human_Betacoronavirus_1 MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTVFANTVEDAVNKLVFLAVDFITWRRQELNVYG >5445_2007_NS5a_AIV41923_1_2007_06_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >MY_U945_12_NS5a_AQN78737_1_2012_08_01_Malaysia_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >3269A_2012_NS5a_AIV41845_1_2012_06_China_Human_Betacoronavirus_1 MDIWRPEKKFLRYINGFNVSELEDACSKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG >PHEV_CoV_swine_USA_15TOSU1765_2015_NA_ARC95268_1_2015_08_01_USA_Swine_Betacoronavirus_1 MDIWCPEMKYLRYTNGFNVSELEYVCFKYNYQFPKVGYCRVPNHAWCRNQGSFCATFTLYGKSKHYDNYFGIITGFTAFSNSLEEAVNKLVLLAVDFITWRSQSLNVYG >PHEV_CoV_swine_USA_15TOSU1655_2015_NA_ARC95244_1_2015_08_01_USA_Swine_Betacoronavirus_1 MDIWCPEKKYLRYTNGFNVSELEDVCFKYNYQFPKVGYCRVPNYAWCRNQGRFCVTFTLYGKSKHYDNYFGIITGFTVFSNSLEEAVNKLVFLAVDFITWRSQCLNVYG >Quebec_NA_AAL40403_1_NA_NA_Unknown_Betacoronavirus_1 MDIWRPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHVWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTARGGC----------------------
Reading sequence file /data//pss_subsets/DcCoV_HKU23_camel_Morocco_CAC2586_2016_NA_QEY10634_1_2016_03_05_Morocco_Camel_Betacoronavirus_1.result/original_alignment/codeml/fasta/DcCoV_HKU23_camel_Morocco_CAC2586_2016_NA_QEY10634_1_2016_03_05_Morocco_Camel_Betacoronavirus_1.result.1
Found 30 sequences of length 327
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 4.9%
Found 46 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 11
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 45 polymorphic sites
**p-Value(s)**
----------
NSS: 3.72e-01 (1000 permutations)
Max Chi^2: 1.01e-01 (1000 permutations)
PHI (Permutation): 2.29e-01 (1000 permutations)
PHI (Normal): 2.12e-01
#NEXUS
[ID: 7645956928]
begin taxa;
dimensions ntax=30;
taxlabels
Obihiro12_1_p12_7_BAS18857_1_2012_Japan_Horse_Betacoronavirus_1
3194A_2012_NS5a_AIV41899_1_2012_03_China_Human_Betacoronavirus_1
DcCoV_HKU23_camel_Ethiopia_CAC1019_2015_NA_QEY10626_1_2015_02_21_Ethiopia_Camel_Betacoronavirus_1
MY_U1057_12_NS5a_AQN78753_1_2012_08_27_Malaysia_Human_Betacoronavirus_1
TCG_14_NA_BBM61350_1_2009_03_Japan_Unknown_Betacoronavirus_1
UNKNOWN_FJ425186_NA_ACJ66967_1_1994_01_01_USA_Antelope_Betacoronavirus_1
5484_2007_NS5a_AIV41935_1_2007_06_China_Human_Betacoronavirus_1
3074A_2012_NS5a_AIV41839_1_2012_02_China_Human_Betacoronavirus_1
3269A_2012_NS5a_AIV41845_1_2012_06_China_Human_Betacoronavirus_1
MY_U945_12_NS5a_AQN78737_1_2012_08_01_Malaysia_Human_Betacoronavirus_1
HKU23_362F_NS5_AHN64784_1_2013_05_15_United_Arab_Emirates_Camel_Betacoronavirus_1
Quebec_NA_AAL40403_1_NA_NA_Unknown_Betacoronavirus_1
HCoV_OC43_UK_London_2011_NS5a_AMK59678_1_2011_08_20_United_Kingdom_Human_Betacoronavirus_1
HCoV_OC43_Seattle_USA_SC9430_2018_NA_QEG03795_1_2019_USA_Human_Betacoronavirus_1
IWT_13_NA_BBM61050_1_2015_06_Japan_Unknown_Betacoronavirus_1
IWT_19_NA_BBM61090_1_2016_12_Japan_Unknown_Betacoronavirus_1
1926_2006_NS5a_AIV41797_1_2006_03_China_Human_Betacoronavirus_1
IWT_22_NA_BBM61140_1_2016_12_Japan_Unknown_Betacoronavirus_1
IWT_26_NA_BBM61180_1_2017_02_Japan_Unknown_Betacoronavirus_1
2007_09_12_9_kDa_ATP16768_1_2007_France_Human_Betacoronavirus_1
MY_U208_12_NS5a_AQN78665_1_2012_03_28_Malaysia_Human_Betacoronavirus_1
N07_1541B_433X_NA_ARE29992_1_2016_USA_Human_Betacoronavirus_1
OC43_human_USA_872_5_1987_NS4_AGT51671_1_1987_02_10_USA_Human_Betacoronavirus_1
OC43_human_USA_873_19_1987_NS4_AGT51641_1_1987_03_17_USA_Human_Betacoronavirus_1
5445_2007_NS5a_AIV41923_1_2007_06_China_Human_Betacoronavirus_1
OC43_human_USA_912_36_1991_NS4_AGT51751_1_1991_02_22_USA_Human_Betacoronavirus_1
OC43_human_USA_9211_43_1992_NS4_AGT51781_1_1992_11_30_USA_Human_Betacoronavirus_1
39A_2007_NS5a_AIV41803_1_2007_04_China_Human_Betacoronavirus_1
PHEV_CoV_swine_USA_15TOSU1655_2015_NA_ARC95244_1_2015_08_01_USA_Swine_Betacoronavirus_1
PHEV_CoV_swine_USA_15TOSU1765_2015_NA_ARC95268_1_2015_08_01_USA_Swine_Betacoronavirus_1
;
end;
begin trees;
translate
1 Obihiro12_1_p12_7_BAS18857_1_2012_Japan_Horse_Betacoronavirus_1,
2 3194A_2012_NS5a_AIV41899_1_2012_03_China_Human_Betacoronavirus_1,
3 DcCoV_HKU23_camel_Ethiopia_CAC1019_2015_NA_QEY10626_1_2015_02_21_Ethiopia_Camel_Betacoronavirus_1,
4 MY_U1057_12_NS5a_AQN78753_1_2012_08_27_Malaysia_Human_Betacoronavirus_1,
5 TCG_14_NA_BBM61350_1_2009_03_Japan_Unknown_Betacoronavirus_1,
6 UNKNOWN_FJ425186_NA_ACJ66967_1_1994_01_01_USA_Antelope_Betacoronavirus_1,
7 5484_2007_NS5a_AIV41935_1_2007_06_China_Human_Betacoronavirus_1,
8 3074A_2012_NS5a_AIV41839_1_2012_02_China_Human_Betacoronavirus_1,
9 3269A_2012_NS5a_AIV41845_1_2012_06_China_Human_Betacoronavirus_1,
10 MY_U945_12_NS5a_AQN78737_1_2012_08_01_Malaysia_Human_Betacoronavirus_1,
11 HKU23_362F_NS5_AHN64784_1_2013_05_15_United_Arab_Emirates_Camel_Betacoronavirus_1,
12 Quebec_NA_AAL40403_1_NA_NA_Unknown_Betacoronavirus_1,
13 HCoV_OC43_UK_London_2011_NS5a_AMK59678_1_2011_08_20_United_Kingdom_Human_Betacoronavirus_1,
14 HCoV_OC43_Seattle_USA_SC9430_2018_NA_QEG03795_1_2019_USA_Human_Betacoronavirus_1,
15 IWT_13_NA_BBM61050_1_2015_06_Japan_Unknown_Betacoronavirus_1,
16 IWT_19_NA_BBM61090_1_2016_12_Japan_Unknown_Betacoronavirus_1,
17 1926_2006_NS5a_AIV41797_1_2006_03_China_Human_Betacoronavirus_1,
18 IWT_22_NA_BBM61140_1_2016_12_Japan_Unknown_Betacoronavirus_1,
19 IWT_26_NA_BBM61180_1_2017_02_Japan_Unknown_Betacoronavirus_1,
20 2007_09_12_9_kDa_ATP16768_1_2007_France_Human_Betacoronavirus_1,
21 MY_U208_12_NS5a_AQN78665_1_2012_03_28_Malaysia_Human_Betacoronavirus_1,
22 N07_1541B_433X_NA_ARE29992_1_2016_USA_Human_Betacoronavirus_1,
23 OC43_human_USA_872_5_1987_NS4_AGT51671_1_1987_02_10_USA_Human_Betacoronavirus_1,
24 OC43_human_USA_873_19_1987_NS4_AGT51641_1_1987_03_17_USA_Human_Betacoronavirus_1,
25 5445_2007_NS5a_AIV41923_1_2007_06_China_Human_Betacoronavirus_1,
26 OC43_human_USA_912_36_1991_NS4_AGT51751_1_1991_02_22_USA_Human_Betacoronavirus_1,
27 OC43_human_USA_9211_43_1992_NS4_AGT51781_1_1992_11_30_USA_Human_Betacoronavirus_1,
28 39A_2007_NS5a_AIV41803_1_2007_04_China_Human_Betacoronavirus_1,
29 PHEV_CoV_swine_USA_15TOSU1655_2015_NA_ARC95244_1_2015_08_01_USA_Swine_Betacoronavirus_1,
30 PHEV_CoV_swine_USA_15TOSU1765_2015_NA_ARC95268_1_2015_08_01_USA_Swine_Betacoronavirus_1
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:6.032198e-02,(29:2.281195e-02,30:1.580627e-02)1.000:4.644408e-02,((((2:1.539196e-03,8:1.516300e-03)0.976:5.330227e-03,(4:1.754924e-03,7:1.550129e-03,9:3.642703e-03,10:1.548630e-03,14:3.827097e-03,17:5.060352e-03,21:3.743808e-03,22:1.587342e-03,25:1.534379e-03,26:3.017034e-03,28:1.535140e-03)0.646:5.463128e-03)0.635:6.129592e-03,((13:1.537574e-03,20:1.579280e-03,27:1.572015e-03)0.929:3.743090e-03,23:1.536321e-03,24:1.511211e-03)0.841:5.731225e-03)1.000:1.751696e-02,(3:1.419760e-02,(5:3.754913e-03,6:1.514329e-03,11:9.690926e-03,15:1.556474e-03,(16:1.503433e-03,18:1.532190e-03,19:1.493170e-03)0.999:5.951539e-03)0.835:5.791228e-03,12:3.492464e-02)0.999:1.289152e-02)1.000:2.687594e-02);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:6.032198e-02,(29:2.281195e-02,30:1.580627e-02):4.644408e-02,((((2:1.539196e-03,8:1.516300e-03):5.330227e-03,(4:1.754924e-03,7:1.550129e-03,9:3.642703e-03,10:1.548630e-03,14:3.827097e-03,17:5.060352e-03,21:3.743808e-03,22:1.587342e-03,25:1.534379e-03,26:3.017034e-03,28:1.535140e-03):5.463128e-03):6.129592e-03,((13:1.537574e-03,20:1.579280e-03,27:1.572015e-03):3.743090e-03,23:1.536321e-03,24:1.511211e-03):5.731225e-03):1.751696e-02,(3:1.419760e-02,(5:3.754913e-03,6:1.514329e-03,11:9.690926e-03,15:1.556474e-03,(16:1.503433e-03,18:1.532190e-03,19:1.493170e-03):5.951539e-03):5.791228e-03,12:3.492464e-02):1.289152e-02):2.687594e-02);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1067.96 -1097.64
2 -1069.66 -1103.07
--------------------------------------
TOTAL -1068.48 -1102.38
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.423846 0.002804 0.326037 0.530339 0.420690 1366.55 1383.56 1.000
r(A<->C){all} 0.091389 0.001129 0.032276 0.160658 0.088500 534.99 545.09 1.000
r(A<->G){all} 0.172207 0.001669 0.100152 0.254588 0.168477 611.76 675.21 1.000
r(A<->T){all} 0.081730 0.000488 0.042295 0.127442 0.080033 692.83 758.04 1.000
r(C<->G){all} 0.032199 0.000610 0.000045 0.080253 0.026518 556.68 585.80 1.000
r(C<->T){all} 0.531572 0.003082 0.420104 0.635364 0.533030 640.46 647.85 1.000
r(G<->T){all} 0.090903 0.000741 0.044897 0.147332 0.088133 713.18 761.25 1.000
pi(A){all} 0.296715 0.000557 0.250362 0.341705 0.296233 892.08 950.26 1.000
pi(C){all} 0.145053 0.000298 0.112492 0.178976 0.144243 762.10 790.27 1.000
pi(G){all} 0.193555 0.000393 0.156533 0.234158 0.193303 1099.28 1162.24 1.000
pi(T){all} 0.364676 0.000578 0.316428 0.409807 0.364229 804.08 955.16 1.000
alpha{1,2} 0.729988 0.265502 0.138972 1.663839 0.586726 1066.68 1125.87 1.000
alpha{3} 1.608187 0.861166 0.370928 3.505420 1.389508 1296.55 1350.82 1.000
pinvar{all} 0.205208 0.015207 0.000006 0.421413 0.200471 790.90 912.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/DcCoV_HKU23_camel_Morocco_CAC2586_2016_NA_QEY10634_1_2016_03_05_Morocco_Camel_Betacoronavirus_1.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 30 ls = 87
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 7 7 7 7 7 7 | Ser TCT 0 0 0 0 0 1 | Tyr TAT 5 7 7 7 7 6 | Cys TGT 3 3 3 3 3 3
TTC 3 1 1 1 1 2 | TCC 1 1 1 1 1 1 | TAC 1 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 2 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 2 1 2 2 1 2 | Arg CGT 2 3 2 2 3 2
CTC 1 2 2 1 2 1 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 2 1 1 1 1 2 | CGA 0 0 0 0 0 0
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 1 1 1 1 2 | Thr ACT 2 4 4 4 4 2 | Asn AAT 4 3 3 3 3 4 | Ser AGT 1 1 1 1 1 1
ATC 0 1 1 1 1 0 | ACC 0 0 0 0 0 0 | AAC 2 2 2 2 2 2 | AGC 0 1 1 1 1 0
ATA 1 1 1 1 1 1 | ACA 2 2 2 3 2 2 | Lys AAA 6 8 8 7 8 6 | Arg AGA 3 1 1 1 1 3
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 1 0 0 0 0 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 1 1 2 1 2 | Ala GCT 5 5 5 4 5 5 | Asp GAT 3 2 2 2 2 3 | Gly GGT 4 3 3 3 3 4
GTC 1 2 2 2 2 1 | GCC 0 0 0 0 0 0 | GAC 1 1 1 1 1 1 | GGC 0 1 1 1 1 0
GTA 3 3 3 3 3 3 | GCA 1 1 1 1 1 1 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 0 0 0 0 0 0 | GCG 0 0 0 0 0 0 | GAG 2 3 3 3 3 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 7 6 7 6 7 8 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 7 7 6 7 6 4 | Cys TGT 3 3 3 3 3 4
TTC 1 3 3 3 3 2 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 2 | TGC 1 1 1 1 1 0
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 1 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 1 2 2 2 2 1 | Arg CGT 3 2 2 2 2 2
CTC 2 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 1 | Gln CAA 1 2 2 2 2 2 | CGA 0 1 0 1 1 0
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 2 1 1 0 | Thr ACT 4 2 2 2 2 3 | Asn AAT 3 4 4 4 4 4 | Ser AGT 1 1 1 1 1 0
ATC 1 1 0 1 1 1 | ACC 0 0 0 0 0 1 | AAC 2 2 2 2 2 2 | AGC 1 0 0 0 0 1
ATA 1 1 1 1 1 3 | ACA 2 2 2 2 2 2 | Lys AAA 8 6 6 6 5 6 | Arg AGA 1 2 3 2 3 3
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 0 1 1 1 1 0 | AGG 0 0 0 0 0 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 2 2 2 2 2 | Ala GCT 5 5 5 5 5 3 | Asp GAT 2 2 3 2 3 2 | Gly GGT 3 4 4 4 4 2
GTC 2 1 1 1 1 2 | GCC 0 0 0 0 0 1 | GAC 1 2 1 2 1 1 | GGC 1 0 0 0 0 1
GTA 3 4 3 4 3 1 | GCA 1 0 1 0 1 0 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 0 0 0 0 0 0 | GCG 0 0 0 0 0 1 | GAG 3 2 2 2 2 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 6 7 7 7 7 7 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 8 6 6 7 6 7 | Cys TGT 3 3 3 3 3 3
TTC 2 3 3 1 3 1 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 1 1 1 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 1 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 2 1 2 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 2 2 1 2 1 | CGA 0 0 0 0 0 0
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 2 2 1 2 1 | Thr ACT 4 2 2 4 2 4 | Asn AAT 4 3 4 3 4 3 | Ser AGT 1 1 1 1 1 1
ATC 1 0 0 1 0 1 | ACC 0 0 0 0 0 0 | AAC 1 2 2 2 2 2 | AGC 1 0 0 1 0 1
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 7 7 6 8 6 8 | Arg AGA 2 3 3 1 3 1
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 0 1 1 0 1 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 2 2 1 2 1 | Ala GCT 4 5 5 5 5 5 | Asp GAT 2 3 3 2 3 2 | Gly GGT 3 4 4 3 4 3
GTC 1 1 1 2 1 2 | GCC 0 0 0 0 0 0 | GAC 1 1 1 1 1 1 | GGC 1 0 0 1 0 1
GTA 3 3 3 3 3 3 | GCA 1 1 1 1 1 1 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 0 0 0 0 0 0 | GCG 0 0 0 0 0 0 | GAG 3 2 2 3 2 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 6 6 7 7 6 6 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 7 7 6 6 7 7 | Cys TGT 3 3 3 3 3 3
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 0 0 1
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 2 2 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1
ATC 1 1 1 0 0 1 | ACC 0 0 0 0 0 0 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 6 6 5 6 6 6 | Arg AGA 2 2 3 3 3 2
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 5 5 5 5 5 5 | Asp GAT 2 2 3 3 3 2 | Gly GGT 4 4 4 4 4 4
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 2 2 1 1 1 2 | GGC 0 0 0 0 0 0
GTA 3 3 3 3 3 4 | GCA 1 1 1 1 1 0 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 0 0 0 0 0 0 | GCG 0 0 0 0 0 0 | GAG 2 2 2 2 2 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 7 7 6 6 6 7 | Ser TCT 0 0 1 2 2 0 | Tyr TAT 6 6 6 9 8 7 | Cys TGT 3 3 3 3 4 4
TTC 3 3 3 2 2 1 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 1 0 | TGC 1 1 1 2 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 1 1 0 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 0 0 1 | Pro CCT 3 3 3 3 3 3 | His CAT 2 2 2 2 1 2 | Arg CGT 2 2 2 1 2 2
CTC 1 1 1 1 1 2 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 0 0 0 1 1 0 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 1 | CGA 0 0 0 1 0 0
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 0 0 1 | Thr ACT 2 2 2 3 3 4 | Asn AAT 4 4 4 4 5 3 | Ser AGT 1 1 1 1 0 1
ATC 0 0 0 1 1 1 | ACC 0 0 0 0 0 0 | AAC 2 2 2 3 2 2 | AGC 0 0 0 0 0 1
ATA 1 1 1 2 2 1 | ACA 2 2 2 2 2 2 | Lys AAA 6 6 6 5 5 7 | Arg AGA 3 3 3 1 1 3
Met ATG 1 1 1 2 1 1 | ACG 0 0 0 0 0 0 | AAG 1 1 1 0 1 0 | AGG 0 0 0 0 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 3 4 2 | Ala GCT 5 5 5 3 2 4 | Asp GAT 3 3 3 1 2 2 | Gly GGT 4 4 4 2 2 3
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 1 1 1 1 1 1 | GGC 0 0 0 1 1 2
GTA 3 3 3 1 2 2 | GCA 1 1 1 1 0 1 | Glu GAA 2 2 2 5 5 2 | GGA 2 2 2 3 3 3
GTG 0 0 0 0 0 0 | GCG 0 0 0 0 0 0 | GAG 2 2 2 0 0 1 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C101
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.26437 C:0.17241 A:0.35632 G:0.20690
position 3: T:0.52874 C:0.12644 A:0.27586 G:0.06897
Average T:0.36015 C:0.14176 A:0.30651 G:0.19157
#2: C129
position 1: T:0.27586 C:0.12644 A:0.29885 G:0.29885
position 2: T:0.25287 C:0.19540 A:0.34483 G:0.20690
position 3: T:0.51724 C:0.14943 A:0.26437 G:0.06897
Average T:0.34866 C:0.15709 A:0.30268 G:0.19157
#3: C124
position 1: T:0.27586 C:0.12644 A:0.29885 G:0.29885
position 2: T:0.25287 C:0.19540 A:0.35632 G:0.19540
position 3: T:0.51724 C:0.14943 A:0.26437 G:0.06897
Average T:0.34866 C:0.15709 A:0.30651 G:0.18774
#4: C114
position 1: T:0.27586 C:0.12644 A:0.29885 G:0.29885
position 2: T:0.26437 C:0.19540 A:0.34483 G:0.19540
position 3: T:0.52874 C:0.13793 A:0.26437 G:0.06897
Average T:0.35632 C:0.15326 A:0.30268 G:0.18774
#5: C133
position 1: T:0.27586 C:0.12644 A:0.29885 G:0.29885
position 2: T:0.25287 C:0.19540 A:0.34483 G:0.20690
position 3: T:0.51724 C:0.14943 A:0.26437 G:0.06897
Average T:0.34866 C:0.15709 A:0.30268 G:0.19157
#6: C10
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.25287 C:0.18391 A:0.35632 G:0.20690
position 3: T:0.55172 C:0.10345 A:0.27586 G:0.06897
Average T:0.36398 C:0.13793 A:0.30651 G:0.19157
#7: C137
position 1: T:0.27586 C:0.12644 A:0.29885 G:0.29885
position 2: T:0.25287 C:0.19540 A:0.34483 G:0.20690
position 3: T:0.51724 C:0.14943 A:0.26437 G:0.06897
Average T:0.34866 C:0.15709 A:0.30268 G:0.19157
#8: C104
position 1: T:0.28736 C:0.13793 A:0.27586 G:0.29885
position 2: T:0.26437 C:0.16092 A:0.36782 G:0.20690
position 3: T:0.51724 C:0.13793 A:0.27586 G:0.06897
Average T:0.35632 C:0.14559 A:0.30651 G:0.19157
#9: C25
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.26437 C:0.17241 A:0.35632 G:0.20690
position 3: T:0.54023 C:0.11494 A:0.27586 G:0.06897
Average T:0.36398 C:0.13793 A:0.30651 G:0.19157
#10: C14
position 1: T:0.28736 C:0.13793 A:0.27586 G:0.29885
position 2: T:0.26437 C:0.16092 A:0.36782 G:0.20690
position 3: T:0.51724 C:0.13793 A:0.27586 G:0.06897
Average T:0.35632 C:0.14559 A:0.30651 G:0.19157
#11: C21
position 1: T:0.28736 C:0.13793 A:0.27586 G:0.29885
position 2: T:0.26437 C:0.17241 A:0.34483 G:0.21839
position 3: T:0.52874 C:0.12644 A:0.27586 G:0.06897
Average T:0.36015 C:0.14559 A:0.29885 G:0.19540
#12: C224
position 1: T:0.28736 C:0.12644 A:0.32184 G:0.26437
position 2: T:0.27586 C:0.18391 A:0.33333 G:0.20690
position 3: T:0.44828 C:0.18391 A:0.26437 G:0.10345
Average T:0.33716 C:0.16475 A:0.30651 G:0.19157
#13: C71
position 1: T:0.28736 C:0.11494 A:0.29885 G:0.29885
position 2: T:0.26437 C:0.18391 A:0.34483 G:0.20690
position 3: T:0.54023 C:0.12644 A:0.26437 G:0.06897
Average T:0.36398 C:0.14176 A:0.30268 G:0.19157
#14: C165
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.26437 C:0.17241 A:0.35632 G:0.20690
position 3: T:0.52874 C:0.11494 A:0.28736 G:0.06897
Average T:0.36015 C:0.13793 A:0.31034 G:0.19157
#15: C175
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.26437 C:0.17241 A:0.35632 G:0.20690
position 3: T:0.54023 C:0.11494 A:0.27586 G:0.06897
Average T:0.36398 C:0.13793 A:0.30651 G:0.19157
#16: C251
position 1: T:0.27586 C:0.12644 A:0.29885 G:0.29885
position 2: T:0.25287 C:0.19540 A:0.35632 G:0.19540
position 3: T:0.51724 C:0.14943 A:0.26437 G:0.06897
Average T:0.34866 C:0.15709 A:0.30651 G:0.18774
#17: C161
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.26437 C:0.17241 A:0.35632 G:0.20690
position 3: T:0.54023 C:0.11494 A:0.27586 G:0.06897
Average T:0.36398 C:0.13793 A:0.30651 G:0.19157
#18: C290
position 1: T:0.27586 C:0.12644 A:0.29885 G:0.29885
position 2: T:0.25287 C:0.19540 A:0.35632 G:0.19540
position 3: T:0.51724 C:0.14943 A:0.26437 G:0.06897
Average T:0.34866 C:0.15709 A:0.30651 G:0.18774
#19: C193
position 1: T:0.28736 C:0.13793 A:0.27586 G:0.29885
position 2: T:0.25287 C:0.17241 A:0.36782 G:0.20690
position 3: T:0.51724 C:0.13793 A:0.27586 G:0.06897
Average T:0.35249 C:0.14943 A:0.30651 G:0.19157
#20: C190
position 1: T:0.28736 C:0.13793 A:0.27586 G:0.29885
position 2: T:0.25287 C:0.17241 A:0.36782 G:0.20690
position 3: T:0.51724 C:0.13793 A:0.27586 G:0.06897
Average T:0.35249 C:0.14943 A:0.30651 G:0.19157
#21: C19
position 1: T:0.28736 C:0.13793 A:0.27586 G:0.29885
position 2: T:0.26437 C:0.17241 A:0.34483 G:0.21839
position 3: T:0.52874 C:0.12644 A:0.27586 G:0.06897
Average T:0.36015 C:0.14559 A:0.29885 G:0.19540
#22: C39
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.26437 C:0.17241 A:0.35632 G:0.20690
position 3: T:0.54023 C:0.11494 A:0.27586 G:0.06897
Average T:0.36398 C:0.13793 A:0.30651 G:0.19157
#23: C205
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.25287 C:0.17241 A:0.36782 G:0.20690
position 3: T:0.54023 C:0.11494 A:0.27586 G:0.06897
Average T:0.36015 C:0.13793 A:0.31034 G:0.19157
#24: C208
position 1: T:0.28736 C:0.13793 A:0.27586 G:0.29885
position 2: T:0.26437 C:0.16092 A:0.36782 G:0.20690
position 3: T:0.51724 C:0.13793 A:0.27586 G:0.06897
Average T:0.35632 C:0.14559 A:0.30651 G:0.19157
#25: C36
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.26437 C:0.17241 A:0.35632 G:0.20690
position 3: T:0.54023 C:0.11494 A:0.27586 G:0.06897
Average T:0.36398 C:0.13793 A:0.30651 G:0.19157
#26: C174
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.26437 C:0.17241 A:0.35632 G:0.20690
position 3: T:0.54023 C:0.11494 A:0.27586 G:0.06897
Average T:0.36398 C:0.13793 A:0.30651 G:0.19157
#27: C22
position 1: T:0.28736 C:0.12644 A:0.28736 G:0.29885
position 2: T:0.25287 C:0.18391 A:0.35632 G:0.20690
position 3: T:0.54023 C:0.11494 A:0.27586 G:0.06897
Average T:0.36015 C:0.14176 A:0.30651 G:0.19157
#28: C233
position 1: T:0.34483 C:0.12644 A:0.27586 G:0.25287
position 2: T:0.25287 C:0.18391 A:0.36782 G:0.19540
position 3: T:0.49425 C:0.14943 A:0.29885 G:0.05747
Average T:0.36398 C:0.15326 A:0.31418 G:0.16858
#29: C231
position 1: T:0.34483 C:0.11494 A:0.27586 G:0.26437
position 2: T:0.26437 C:0.16092 A:0.37931 G:0.19540
position 3: T:0.50575 C:0.13793 A:0.28736 G:0.06897
Average T:0.37165 C:0.13793 A:0.31418 G:0.17625
#30: C236
position 1: T:0.28736 C:0.12644 A:0.31034 G:0.27586
position 2: T:0.24138 C:0.18391 A:0.32184 G:0.25287
position 3: T:0.52874 C:0.14943 A:0.27586 G:0.04598
Average T:0.35249 C:0.15326 A:0.30268 G:0.19157
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 201 | Ser S TCT 6 | Tyr Y TAT 198 | Cys C TGT 93
TTC 69 | TCC 30 | TAC 4 | TGC 30
Leu L TTA 30 | TCA 29 | *** * TAA 0 | *** * TGA 0
TTG 3 | TCG 0 | TAG 0 | Trp W TGG 60
------------------------------------------------------------------------------
Leu L CTT 30 | Pro P CCT 90 | His H CAT 54 | Arg R CGT 62
CTC 37 | CCC 0 | CAC 0 | CGC 0
CTA 2 | CCA 1 | Gln Q CAA 51 | CGA 8
CTG 0 | CCG 0 | CAG 0 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 38 | Thr T ACT 81 | Asn N AAT 112 | Ser S AGT 28
ATC 19 | ACC 1 | AAC 60 | AGC 10
ATA 34 | ACA 61 | Lys K AAA 192 | Arg R AGA 66
Met M ATG 31 | ACG 0 | AAG 19 | AGG 2
------------------------------------------------------------------------------
Val V GTT 58 | Ala A GCT 140 | Asp D GAT 72 | Gly G GGT 105
GTC 38 | GCC 1 | GAC 35 | GGC 13
GTA 87 | GCA 25 | Glu E GAA 66 | GGA 63
GTG 0 | GCG 1 | GAG 64 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.28851 C:0.12835 A:0.28889 G:0.29425
position 2: T:0.25939 C:0.17854 A:0.35517 G:0.20690
position 3: T:0.52414 C:0.13295 A:0.27395 G:0.06897
Average T:0.35734 C:0.14662 A:0.30600 G:0.19004
Model 1: NearlyNeutral (2 categories)
TREE # 1: (12, (29, 28), ((((11, 21), (17, 22, 27, 26, 1, 6, 14, 15, 25, 23, 9)), ((8, 10, 24), 20, 19)), (13, (16, 18, 4, 3, (2, 5, 7)), 30))); MP score: 84
check convergence..
lnL(ntime: 41 np: 44): -817.312563 +0.000000
31..12 31..32 32..29 32..28 31..33 33..34 34..35 35..36 36..11 36..21 35..37 37..17 37..22 37..27 37..26 37..1 37..6 37..14 37..15 37..25 37..23 37..9 34..38 38..39 39..8 39..10 39..24 38..20 38..19 33..40 40..13 40..41 41..16 41..18 41..4 41..3 41..42 42..2 42..5 42..7 40..30
0.228325 0.220768 0.077279 0.085288 0.084133 0.085003 0.013543 0.013006 0.000004 0.000004 0.025047 0.000004 0.000004 0.012467 0.000004 0.012407 0.025096 0.012529 0.000004 0.000004 0.012544 0.000004 0.011962 0.012386 0.000004 0.000004 0.000004 0.000004 0.000004 0.068290 0.063371 0.025542 0.000004 0.000004 0.038077 0.000004 0.012537 0.000004 0.000004 0.000004 0.161667 3.282541 0.828514 0.113232
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.301344
(12: 0.228325, (29: 0.077279, 28: 0.085288): 0.220768, ((((11: 0.000004, 21: 0.000004): 0.013006, (17: 0.000004, 22: 0.000004, 27: 0.012467, 26: 0.000004, 1: 0.012407, 6: 0.025096, 14: 0.012529, 15: 0.000004, 25: 0.000004, 23: 0.012544, 9: 0.000004): 0.025047): 0.013543, ((8: 0.000004, 10: 0.000004, 24: 0.000004): 0.012386, 20: 0.000004, 19: 0.000004): 0.011962): 0.085003, (13: 0.063371, (16: 0.000004, 18: 0.000004, 4: 0.038077, 3: 0.000004, (2: 0.000004, 5: 0.000004, 7: 0.000004): 0.012537): 0.025542, 30: 0.161667): 0.068290): 0.084133);
(C224: 0.228325, (C231: 0.077279, C233: 0.085288): 0.220768, ((((C21: 0.000004, C19: 0.000004): 0.013006, (C161: 0.000004, C39: 0.000004, C22: 0.012467, C174: 0.000004, C101: 0.012407, C10: 0.025096, C165: 0.012529, C175: 0.000004, C36: 0.000004, C205: 0.012544, C25: 0.000004): 0.025047): 0.013543, ((C104: 0.000004, C14: 0.000004, C208: 0.000004): 0.012386, C190: 0.000004, C193: 0.000004): 0.011962): 0.085003, (C71: 0.063371, (C251: 0.000004, C290: 0.000004, C114: 0.038077, C124: 0.000004, (C129: 0.000004, C133: 0.000004, C137: 0.000004): 0.012537): 0.025542, C236: 0.161667): 0.068290): 0.084133);
Detailed output identifying parameters
kappa (ts/tv) = 3.28254
MLEs of dN/dS (w) for site classes (K=2)
p: 0.82851 0.17149
w: 0.11323 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
31..12 0.228 217.0 44.0 0.2653 0.0519 0.1956 11.3 8.6
31..32 0.221 217.0 44.0 0.2653 0.0502 0.1891 10.9 8.3
32..29 0.077 217.0 44.0 0.2653 0.0176 0.0662 3.8 2.9
32..28 0.085 217.0 44.0 0.2653 0.0194 0.0731 4.2 3.2
31..33 0.084 217.0 44.0 0.2653 0.0191 0.0721 4.1 3.2
33..34 0.085 217.0 44.0 0.2653 0.0193 0.0728 4.2 3.2
34..35 0.014 217.0 44.0 0.2653 0.0031 0.0116 0.7 0.5
35..36 0.013 217.0 44.0 0.2653 0.0030 0.0111 0.6 0.5
36..11 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
36..21 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
35..37 0.025 217.0 44.0 0.2653 0.0057 0.0215 1.2 0.9
37..17 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
37..22 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
37..27 0.012 217.0 44.0 0.2653 0.0028 0.0107 0.6 0.5
37..26 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
37..1 0.012 217.0 44.0 0.2653 0.0028 0.0106 0.6 0.5
37..6 0.025 217.0 44.0 0.2653 0.0057 0.0215 1.2 0.9
37..14 0.013 217.0 44.0 0.2653 0.0028 0.0107 0.6 0.5
37..15 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
37..25 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
37..23 0.013 217.0 44.0 0.2653 0.0029 0.0107 0.6 0.5
37..9 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
34..38 0.012 217.0 44.0 0.2653 0.0027 0.0102 0.6 0.5
38..39 0.012 217.0 44.0 0.2653 0.0028 0.0106 0.6 0.5
39..8 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
39..10 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
39..24 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
38..20 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
38..19 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
33..40 0.068 217.0 44.0 0.2653 0.0155 0.0585 3.4 2.6
40..13 0.063 217.0 44.0 0.2653 0.0144 0.0543 3.1 2.4
40..41 0.026 217.0 44.0 0.2653 0.0058 0.0219 1.3 1.0
41..16 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
41..18 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
41..4 0.038 217.0 44.0 0.2653 0.0087 0.0326 1.9 1.4
41..3 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
41..42 0.013 217.0 44.0 0.2653 0.0028 0.0107 0.6 0.5
42..2 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
42..5 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
42..7 0.000 217.0 44.0 0.2653 0.0000 0.0000 0.0 0.0
40..30 0.162 217.0 44.0 0.2653 0.0367 0.1385 8.0 6.1
Time used: 1:35
Model 2: PositiveSelection (3 categories)
TREE # 1: (12, (29, 28), ((((11, 21), (17, 22, 27, 26, 1, 6, 14, 15, 25, 23, 9)), ((8, 10, 24), 20, 19)), (13, (16, 18, 4, 3, (2, 5, 7)), 30))); MP score: 84
lnL(ntime: 41 np: 46): -817.293493 +0.000000
31..12 31..32 32..29 32..28 31..33 33..34 34..35 35..36 36..11 36..21 35..37 37..17 37..22 37..27 37..26 37..1 37..6 37..14 37..15 37..25 37..23 37..9 34..38 38..39 39..8 39..10 39..24 38..20 38..19 33..40 40..13 40..41 41..16 41..18 41..4 41..3 41..42 42..2 42..5 42..7 40..30
0.228717 0.221850 0.076741 0.086241 0.084902 0.085271 0.013476 0.013032 0.000004 0.000004 0.025087 0.000004 0.000004 0.012475 0.000004 0.012415 0.025112 0.012535 0.000004 0.000004 0.012557 0.000004 0.012075 0.012409 0.000004 0.000004 0.000004 0.000004 0.000004 0.068469 0.063398 0.025575 0.000004 0.000004 0.038111 0.000004 0.012542 0.000004 0.000004 0.000004 0.161724 3.305324 0.837454 0.000000 0.117677 1.077693
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.304788
(12: 0.228717, (29: 0.076741, 28: 0.086241): 0.221850, ((((11: 0.000004, 21: 0.000004): 0.013032, (17: 0.000004, 22: 0.000004, 27: 0.012475, 26: 0.000004, 1: 0.012415, 6: 0.025112, 14: 0.012535, 15: 0.000004, 25: 0.000004, 23: 0.012557, 9: 0.000004): 0.025087): 0.013476, ((8: 0.000004, 10: 0.000004, 24: 0.000004): 0.012409, 20: 0.000004, 19: 0.000004): 0.012075): 0.085271, (13: 0.063398, (16: 0.000004, 18: 0.000004, 4: 0.038111, 3: 0.000004, (2: 0.000004, 5: 0.000004, 7: 0.000004): 0.012542): 0.025575, 30: 0.161724): 0.068469): 0.084902);
(C224: 0.228717, (C231: 0.076741, C233: 0.086241): 0.221850, ((((C21: 0.000004, C19: 0.000004): 0.013032, (C161: 0.000004, C39: 0.000004, C22: 0.012475, C174: 0.000004, C101: 0.012415, C10: 0.025112, C165: 0.012535, C175: 0.000004, C36: 0.000004, C205: 0.012557, C25: 0.000004): 0.025087): 0.013476, ((C104: 0.000004, C14: 0.000004, C208: 0.000004): 0.012409, C190: 0.000004, C193: 0.000004): 0.012075): 0.085271, (C71: 0.063398, (C251: 0.000004, C290: 0.000004, C114: 0.038111, C124: 0.000004, (C129: 0.000004, C133: 0.000004, C137: 0.000004): 0.012542): 0.025575, C236: 0.161724): 0.068469): 0.084902);
Detailed output identifying parameters
kappa (ts/tv) = 3.30532
MLEs of dN/dS (w) for site classes (K=3)
p: 0.83745 0.00000 0.16255
w: 0.11768 1.00000 1.07769
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
31..12 0.229 217.0 44.0 0.2737 0.0527 0.1924 11.4 8.5
31..32 0.222 217.0 44.0 0.2737 0.0511 0.1866 11.1 8.2
32..29 0.077 217.0 44.0 0.2737 0.0177 0.0646 3.8 2.8
32..28 0.086 217.0 44.0 0.2737 0.0199 0.0725 4.3 3.2
31..33 0.085 217.0 44.0 0.2737 0.0195 0.0714 4.2 3.1
33..34 0.085 217.0 44.0 0.2737 0.0196 0.0717 4.3 3.2
34..35 0.013 217.0 44.0 0.2737 0.0031 0.0113 0.7 0.5
35..36 0.013 217.0 44.0 0.2737 0.0030 0.0110 0.7 0.5
36..11 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
36..21 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
35..37 0.025 217.0 44.0 0.2737 0.0058 0.0211 1.3 0.9
37..17 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
37..22 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
37..27 0.012 217.0 44.0 0.2737 0.0029 0.0105 0.6 0.5
37..26 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
37..1 0.012 217.0 44.0 0.2737 0.0029 0.0104 0.6 0.5
37..6 0.025 217.0 44.0 0.2737 0.0058 0.0211 1.3 0.9
37..14 0.013 217.0 44.0 0.2737 0.0029 0.0105 0.6 0.5
37..15 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
37..25 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
37..23 0.013 217.0 44.0 0.2737 0.0029 0.0106 0.6 0.5
37..9 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
34..38 0.012 217.0 44.0 0.2737 0.0028 0.0102 0.6 0.4
38..39 0.012 217.0 44.0 0.2737 0.0029 0.0104 0.6 0.5
39..8 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
39..10 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
39..24 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
38..20 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
38..19 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
33..40 0.068 217.0 44.0 0.2737 0.0158 0.0576 3.4 2.5
40..13 0.063 217.0 44.0 0.2737 0.0146 0.0533 3.2 2.3
40..41 0.026 217.0 44.0 0.2737 0.0059 0.0215 1.3 0.9
41..16 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
41..18 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
41..4 0.038 217.0 44.0 0.2737 0.0088 0.0321 1.9 1.4
41..3 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
41..42 0.013 217.0 44.0 0.2737 0.0029 0.0106 0.6 0.5
42..2 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
42..5 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
42..7 0.000 217.0 44.0 0.2737 0.0000 0.0000 0.0 0.0
40..30 0.162 217.0 44.0 0.2737 0.0372 0.1360 8.1 6.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C101)
Pr(w>1) post mean +- SE for w
5 R 0.994** 1.072
8 K 0.996** 1.074
10 F 0.895 0.977
25 A 0.937 1.017
44 H 0.982* 1.060
52 R 0.815 0.901
78 A 0.782 0.869
83 V 0.964* 1.043
84 E 0.791 0.877
85 D 0.704 0.794
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C101)
Pr(w>1) post mean +- SE for w
5 R 0.503 1.622 +- 1.280
8 K 0.516 1.537 +- 0.936
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.053 0.938 0.009 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.589 0.180 0.072 0.040 0.028 0.022 0.019 0.018 0.017 0.016
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006 0.090
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.012 0.073 0.389
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.020 0.100 0.212 0.087
sum of density on p0-p1 = 1.000000
Time used: 6:22
Model 7: beta (10 categories)
TREE # 1: (12, (29, 28), ((((11, 21), (17, 22, 27, 26, 1, 6, 14, 15, 25, 23, 9)), ((8, 10, 24), 20, 19)), (13, (16, 18, 4, 3, (2, 5, 7)), 30))); MP score: 84
lnL(ntime: 41 np: 44): -818.877794 +0.000000
31..12 31..32 32..29 32..28 31..33 33..34 34..35 35..36 36..11 36..21 35..37 37..17 37..22 37..27 37..26 37..1 37..6 37..14 37..15 37..25 37..23 37..9 34..38 38..39 39..8 39..10 39..24 38..20 38..19 33..40 40..13 40..41 41..16 41..18 41..4 41..3 41..42 42..2 42..5 42..7 40..30
0.227144 0.215446 0.079743 0.079972 0.078330 0.083186 0.013810 0.012809 0.000004 0.000004 0.024785 0.000004 0.000004 0.012380 0.000004 0.012341 0.024891 0.012460 0.000004 0.000004 0.012425 0.000004 0.011426 0.012243 0.000004 0.000004 0.000004 0.000004 0.000004 0.067077 0.062830 0.025203 0.000004 0.000004 0.037614 0.000004 0.012420 0.000004 0.000004 0.000004 0.160504 3.257020 0.434722 1.271674
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.279117
(12: 0.227144, (29: 0.079743, 28: 0.079972): 0.215446, ((((11: 0.000004, 21: 0.000004): 0.012809, (17: 0.000004, 22: 0.000004, 27: 0.012380, 26: 0.000004, 1: 0.012341, 6: 0.024891, 14: 0.012460, 15: 0.000004, 25: 0.000004, 23: 0.012425, 9: 0.000004): 0.024785): 0.013810, ((8: 0.000004, 10: 0.000004, 24: 0.000004): 0.012243, 20: 0.000004, 19: 0.000004): 0.011426): 0.083186, (13: 0.062830, (16: 0.000004, 18: 0.000004, 4: 0.037614, 3: 0.000004, (2: 0.000004, 5: 0.000004, 7: 0.000004): 0.012420): 0.025203, 30: 0.160504): 0.067077): 0.078330);
(C224: 0.227144, (C231: 0.079743, C233: 0.079972): 0.215446, ((((C21: 0.000004, C19: 0.000004): 0.012809, (C161: 0.000004, C39: 0.000004, C22: 0.012380, C174: 0.000004, C101: 0.012341, C10: 0.024891, C165: 0.012460, C175: 0.000004, C36: 0.000004, C205: 0.012425, C25: 0.000004): 0.024785): 0.013810, ((C104: 0.000004, C14: 0.000004, C208: 0.000004): 0.012243, C190: 0.000004, C193: 0.000004): 0.011426): 0.083186, (C71: 0.062830, (C251: 0.000004, C290: 0.000004, C114: 0.037614, C124: 0.000004, (C129: 0.000004, C133: 0.000004, C137: 0.000004): 0.012420): 0.025203, C236: 0.160504): 0.067077): 0.078330);
Detailed output identifying parameters
kappa (ts/tv) = 3.25702
Parameters in M7 (beta):
p = 0.43472 q = 1.27167
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00075 0.00946 0.03077 0.06720 0.12108 0.19507 0.29262 0.41891 0.58333 0.81072
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
31..12 0.227 217.1 43.9 0.2530 0.0506 0.1999 11.0 8.8
31..32 0.215 217.1 43.9 0.2530 0.0480 0.1896 10.4 8.3
32..29 0.080 217.1 43.9 0.2530 0.0178 0.0702 3.9 3.1
32..28 0.080 217.1 43.9 0.2530 0.0178 0.0704 3.9 3.1
31..33 0.078 217.1 43.9 0.2530 0.0174 0.0689 3.8 3.0
33..34 0.083 217.1 43.9 0.2530 0.0185 0.0732 4.0 3.2
34..35 0.014 217.1 43.9 0.2530 0.0031 0.0122 0.7 0.5
35..36 0.013 217.1 43.9 0.2530 0.0029 0.0113 0.6 0.5
36..11 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
36..21 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
35..37 0.025 217.1 43.9 0.2530 0.0055 0.0218 1.2 1.0
37..17 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
37..22 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
37..27 0.012 217.1 43.9 0.2530 0.0028 0.0109 0.6 0.5
37..26 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
37..1 0.012 217.1 43.9 0.2530 0.0027 0.0109 0.6 0.5
37..6 0.025 217.1 43.9 0.2530 0.0055 0.0219 1.2 1.0
37..14 0.012 217.1 43.9 0.2530 0.0028 0.0110 0.6 0.5
37..15 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
37..25 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
37..23 0.012 217.1 43.9 0.2530 0.0028 0.0109 0.6 0.5
37..9 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
34..38 0.011 217.1 43.9 0.2530 0.0025 0.0101 0.6 0.4
38..39 0.012 217.1 43.9 0.2530 0.0027 0.0108 0.6 0.5
39..8 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
39..10 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
39..24 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
38..20 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
38..19 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
33..40 0.067 217.1 43.9 0.2530 0.0149 0.0590 3.2 2.6
40..13 0.063 217.1 43.9 0.2530 0.0140 0.0553 3.0 2.4
40..41 0.025 217.1 43.9 0.2530 0.0056 0.0222 1.2 1.0
41..16 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
41..18 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
41..4 0.038 217.1 43.9 0.2530 0.0084 0.0331 1.8 1.5
41..3 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
41..42 0.012 217.1 43.9 0.2530 0.0028 0.0109 0.6 0.5
42..2 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
42..5 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
42..7 0.000 217.1 43.9 0.2530 0.0000 0.0000 0.0 0.0
40..30 0.161 217.1 43.9 0.2530 0.0357 0.1413 7.8 6.2
Time used: 14:50
Model 8: beta&w>1 (11 categories)
TREE # 1: (12, (29, 28), ((((11, 21), (17, 22, 27, 26, 1, 6, 14, 15, 25, 23, 9)), ((8, 10, 24), 20, 19)), (13, (16, 18, 4, 3, (2, 5, 7)), 30))); MP score: 84
lnL(ntime: 41 np: 46): -817.335504 +0.000000
31..12 31..32 32..29 32..28 31..33 33..34 34..35 35..36 36..11 36..21 35..37 37..17 37..22 37..27 37..26 37..1 37..6 37..14 37..15 37..25 37..23 37..9 34..38 38..39 39..8 39..10 39..24 38..20 38..19 33..40 40..13 40..41 41..16 41..18 41..4 41..3 41..42 42..2 42..5 42..7 40..30
0.228716 0.221815 0.076776 0.086172 0.084783 0.085262 0.013485 0.013030 0.000004 0.000004 0.025088 0.000004 0.000004 0.012474 0.000004 0.012415 0.025109 0.012535 0.000004 0.000004 0.012555 0.000004 0.012067 0.012409 0.000004 0.000004 0.000004 0.000004 0.000004 0.068436 0.063369 0.025560 0.000004 0.000004 0.038086 0.000004 0.012534 0.000004 0.000004 0.000004 0.161645 3.306780 0.840612 13.567967 99.000000 1.086857
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.304398
(12: 0.228716, (29: 0.076776, 28: 0.086172): 0.221815, ((((11: 0.000004, 21: 0.000004): 0.013030, (17: 0.000004, 22: 0.000004, 27: 0.012474, 26: 0.000004, 1: 0.012415, 6: 0.025109, 14: 0.012535, 15: 0.000004, 25: 0.000004, 23: 0.012555, 9: 0.000004): 0.025088): 0.013485, ((8: 0.000004, 10: 0.000004, 24: 0.000004): 0.012409, 20: 0.000004, 19: 0.000004): 0.012067): 0.085262, (13: 0.063369, (16: 0.000004, 18: 0.000004, 4: 0.038086, 3: 0.000004, (2: 0.000004, 5: 0.000004, 7: 0.000004): 0.012534): 0.025560, 30: 0.161645): 0.068436): 0.084783);
(C224: 0.228716, (C231: 0.076776, C233: 0.086172): 0.221815, ((((C21: 0.000004, C19: 0.000004): 0.013030, (C161: 0.000004, C39: 0.000004, C22: 0.012474, C174: 0.000004, C101: 0.012415, C10: 0.025109, C165: 0.012535, C175: 0.000004, C36: 0.000004, C205: 0.012555, C25: 0.000004): 0.025088): 0.013485, ((C104: 0.000004, C14: 0.000004, C208: 0.000004): 0.012409, C190: 0.000004, C193: 0.000004): 0.012067): 0.085262, (C71: 0.063369, (C251: 0.000004, C290: 0.000004, C114: 0.038086, C124: 0.000004, (C129: 0.000004, C133: 0.000004, C137: 0.000004): 0.012534): 0.025560, C236: 0.161645): 0.068436): 0.084783);
Detailed output identifying parameters
kappa (ts/tv) = 3.30678
Parameters in M8 (beta&w>1):
p0 = 0.84061 p = 13.56797 q = 99.00000
(p1 = 0.15939) w = 1.08686
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08406 0.08406 0.08406 0.08406 0.08406 0.08406 0.08406 0.08406 0.08406 0.08406 0.15939
w: 0.07438 0.08917 0.09877 0.10688 0.11449 0.12215 0.13036 0.13985 0.15226 0.17437 1.08686
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
31..12 0.229 217.0 44.0 0.2743 0.0527 0.1921 11.4 8.5
31..32 0.222 217.0 44.0 0.2743 0.0511 0.1863 11.1 8.2
32..29 0.077 217.0 44.0 0.2743 0.0177 0.0645 3.8 2.8
32..28 0.086 217.0 44.0 0.2743 0.0199 0.0724 4.3 3.2
31..33 0.085 217.0 44.0 0.2743 0.0195 0.0712 4.2 3.1
33..34 0.085 217.0 44.0 0.2743 0.0197 0.0716 4.3 3.2
34..35 0.013 217.0 44.0 0.2743 0.0031 0.0113 0.7 0.5
35..36 0.013 217.0 44.0 0.2743 0.0030 0.0109 0.7 0.5
36..11 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
36..21 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
35..37 0.025 217.0 44.0 0.2743 0.0058 0.0211 1.3 0.9
37..17 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
37..22 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
37..27 0.012 217.0 44.0 0.2743 0.0029 0.0105 0.6 0.5
37..26 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
37..1 0.012 217.0 44.0 0.2743 0.0029 0.0104 0.6 0.5
37..6 0.025 217.0 44.0 0.2743 0.0058 0.0211 1.3 0.9
37..14 0.013 217.0 44.0 0.2743 0.0029 0.0105 0.6 0.5
37..15 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
37..25 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
37..23 0.013 217.0 44.0 0.2743 0.0029 0.0105 0.6 0.5
37..9 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
34..38 0.012 217.0 44.0 0.2743 0.0028 0.0101 0.6 0.4
38..39 0.012 217.0 44.0 0.2743 0.0029 0.0104 0.6 0.5
39..8 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
39..10 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
39..24 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
38..20 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
38..19 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
33..40 0.068 217.0 44.0 0.2743 0.0158 0.0575 3.4 2.5
40..13 0.063 217.0 44.0 0.2743 0.0146 0.0532 3.2 2.3
40..41 0.026 217.0 44.0 0.2743 0.0059 0.0215 1.3 0.9
41..16 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
41..18 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
41..4 0.038 217.0 44.0 0.2743 0.0088 0.0320 1.9 1.4
41..3 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
41..42 0.013 217.0 44.0 0.2743 0.0029 0.0105 0.6 0.5
42..2 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
42..5 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
42..7 0.000 217.0 44.0 0.2743 0.0000 0.0000 0.0 0.0
40..30 0.162 217.0 44.0 0.2743 0.0373 0.1358 8.1 6.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C101)
Pr(w>1) post mean +- SE for w
5 R 0.991** 1.079
8 K 0.995** 1.082
10 F 0.877 0.970
25 A 0.925 1.016
44 H 0.975* 1.063
52 R 0.801 0.897
78 A 0.766 0.864
83 V 0.957* 1.046
84 E 0.776 0.873
85 D 0.685 0.786
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C101)
Pr(w>1) post mean +- SE for w
5 R 0.614 1.609 +- 1.270
8 K 0.652 1.593 +- 1.038
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.129 0.867
p : 0.153 0.492 0.291 0.058 0.005 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.033 0.046 0.046 0.079 0.115 0.140 0.161 0.180 0.199
ws: 0.640 0.202 0.068 0.030 0.017 0.012 0.009 0.008 0.007 0.006
Time used: 29:22
Model 1: NearlyNeutral -817.312563 Model 2: PositiveSelection -817.293493 Model 7: beta -818.877794 Model 8: beta&w>1 -817.335504 Model 2 vs 1 .038140 Model 8 vs 7 3.084580
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
