--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -854.97 -866.31
2 -854.96 -866.16
--------------------------------------
TOTAL -854.97 -866.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.093203 0.000358 0.058858 0.131155 0.090837 1347.16 1424.08 1.000
r(A<->C){all} 0.082698 0.001753 0.015341 0.167786 0.076230 677.63 754.93 1.002
r(A<->G){all} 0.253154 0.005514 0.122308 0.407673 0.247810 340.57 371.16 1.000
r(A<->T){all} 0.082169 0.001618 0.014997 0.161858 0.075938 595.54 642.39 1.001
r(C<->G){all} 0.043326 0.001472 0.000018 0.118620 0.032519 467.44 515.63 1.003
r(C<->T){all} 0.390746 0.006680 0.231735 0.543070 0.388783 454.16 539.93 1.000
r(G<->T){all} 0.147908 0.003503 0.037087 0.260888 0.141226 590.27 620.87 1.007
pi(A){all} 0.295606 0.000421 0.256404 0.335086 0.294951 1199.82 1325.62 1.000
pi(C){all} 0.225250 0.000345 0.189409 0.262090 0.224890 1248.34 1254.17 1.000
pi(G){all} 0.193895 0.000330 0.157420 0.228435 0.193361 980.79 1184.40 1.000
pi(T){all} 0.285249 0.000404 0.248145 0.325299 0.284923 1177.44 1200.22 1.000
alpha{1,2} 0.703206 0.615702 0.000198 2.241400 0.441514 1152.55 1212.30 1.000
alpha{3} 1.324228 1.223212 0.000646 3.485764 1.019498 1202.04 1314.42 1.000
pinvar{all} 0.371197 0.041543 0.004650 0.708667 0.368601 727.96 808.22 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -830.463453
Model 2: PositiveSelection -829.715194
Model 7: beta -830.472597
Model 8: beta&w>1 -829.716349
Model 2 vs 1 1.496518
Model 8 vs 7 1.512496
-- Starting log on Thu Oct 20 00:46:21 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=8, Len=153
C1 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C2 MKLLLLLSILSFSSAAPTTYRASQAAKVLIHTTEKVTLNNQRTHSYTKWS
C3 MKLLLLLSILSFSSAAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C4 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C5 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C6 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C7 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C8 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
*********:*** :***************:************:*****.
C1 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C2 VCSTGWNTYTNTMVVVNGRWVETAKPPKPTAVAIPTFPYEPRSEKPGFGS
C3 VCSTGWNTYTNTMVVVNGRWVETTKPPRPTAIAIPTFPYEPRSEKPGFGS
C4 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C5 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C6 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C7 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C8 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
***********************:***.***.****.*** *********
C1 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C2 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWST
C3 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHQTFAVTTFRWST
C4 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C5 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C6 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C7 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C8 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
***********:***.**** *****************:*******:**:
C1 PLN
C2 PSN
C3 PSN
C4 PSN
C5 PSN
C6 PSN
C7 PSN
C8 PSN
* *
-- Starting log on Thu Oct 20 00:46:44 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=8, Len=153
C1 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C2 MKLLLLLSILSFSSAAPTTYRASQAAKVLIHTTEKVTLNNQRTHSYTKWS
C3 MKLLLLLSILSFSSAAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C4 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C5 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C6 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C7 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C8 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
*********:*** :***************:************:*****.
C1 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C2 VCSTGWNTYTNTMVVVNGRWVETAKPPKPTAVAIPTFPYEPRSEKPGFGS
C3 VCSTGWNTYTNTMVVVNGRWVETTKPPRPTAIAIPTFPYEPRSEKPGFGS
C4 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C5 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C6 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C7 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C8 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
***********************:***.***.****.*** *********
C1 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C2 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWST
C3 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHQTFAVTTFRWST
C4 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C5 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C6 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C7 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C8 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
***********:***.**** *****************:*******:**:
C1 PLN
C2 PSN
C3 PSN
C4 PSN
C5 PSN
C6 PSN
C7 PSN
C8 PSN
* *
-- Starting log on Thu Oct 20 00:57:34 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/gapped_alignment/codeml,175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 459 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666227457
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 573207569
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5249122880
Seed = 1526464657
Swapseed = 1666227457
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 15 unique site patterns
Division 2 has 10 unique site patterns
Division 3 has 15 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1065.688387 -- 29.153684
Chain 2 -- -1054.900945 -- 29.153684
Chain 3 -- -1027.294170 -- 29.153684
Chain 4 -- -1052.606034 -- 29.153684
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1065.688386 -- 29.153684
Chain 2 -- -1031.148711 -- 29.153684
Chain 3 -- -1048.609161 -- 29.153684
Chain 4 -- -1055.039923 -- 29.153684
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1065.688] (-1054.901) (-1027.294) (-1052.606) * [-1065.688] (-1031.149) (-1048.609) (-1055.040)
1000 -- (-870.937) (-867.436) [-868.744] (-874.213) * [-867.681] (-876.457) (-870.079) (-859.581) -- 0:00:00
2000 -- (-868.713) (-867.846) [-861.596] (-867.207) * (-867.395) (-864.724) [-866.735] (-866.694) -- 0:00:00
3000 -- (-862.660) (-870.218) [-855.333] (-867.854) * [-862.836] (-865.061) (-856.026) (-856.748) -- 0:00:00
4000 -- (-862.795) [-860.853] (-856.344) (-874.333) * (-861.111) (-866.816) [-861.543] (-863.004) -- 0:04:09
5000 -- [-863.240] (-866.822) (-855.175) (-864.355) * (-859.326) (-863.389) [-855.236] (-860.769) -- 0:03:19
Average standard deviation of split frequencies: 0.084611
6000 -- (-866.718) (-862.082) [-859.209] (-875.320) * (-856.180) (-865.458) (-867.679) [-857.450] -- 0:02:45
7000 -- (-861.161) (-859.939) [-861.236] (-866.374) * (-862.148) [-863.702] (-855.189) (-854.970) -- 0:02:21
8000 -- (-864.658) [-863.548] (-865.488) (-864.035) * (-869.652) [-865.249] (-852.491) (-860.109) -- 0:04:08
9000 -- (-864.696) (-854.557) [-857.170] (-862.713) * (-865.110) [-855.810] (-858.834) (-865.341) -- 0:03:40
10000 -- (-858.338) [-857.531] (-856.414) (-864.931) * (-866.159) [-864.393] (-863.940) (-863.757) -- 0:03:18
Average standard deviation of split frequencies: 0.095754
11000 -- (-865.609) [-854.606] (-854.767) (-861.659) * (-865.439) [-857.108] (-856.201) (-863.456) -- 0:02:59
12000 -- (-860.273) [-856.167] (-852.576) (-861.634) * (-867.046) (-865.912) (-853.238) [-857.776] -- 0:02:44
13000 -- [-855.315] (-862.367) (-858.024) (-860.523) * (-862.959) (-857.811) [-854.969] (-863.326) -- 0:02:31
14000 -- (-856.443) [-856.062] (-857.713) (-859.571) * (-860.703) (-856.717) (-858.650) [-859.311] -- 0:03:31
15000 -- (-856.706) (-858.656) [-855.127] (-863.758) * (-861.320) (-862.235) [-855.066] (-859.000) -- 0:03:17
Average standard deviation of split frequencies: 0.049105
16000 -- [-857.443] (-870.420) (-864.032) (-862.992) * [-861.668] (-859.240) (-859.784) (-868.301) -- 0:03:04
17000 -- (-859.498) (-859.650) (-863.351) [-857.507] * (-862.855) (-858.232) [-858.742] (-854.059) -- 0:02:53
18000 -- (-855.891) (-869.301) (-860.879) [-862.267] * (-859.265) [-855.611] (-856.287) (-860.140) -- 0:03:38
19000 -- [-858.180] (-862.808) (-862.811) (-858.390) * [-859.097] (-862.637) (-863.213) (-861.231) -- 0:03:26
20000 -- (-866.275) (-875.722) [-855.086] (-868.273) * [-855.378] (-857.177) (-856.968) (-859.619) -- 0:03:16
Average standard deviation of split frequencies: 0.042111
21000 -- (-861.813) [-863.973] (-869.876) (-870.194) * (-855.210) (-862.756) [-859.574] (-863.404) -- 0:03:06
22000 -- (-855.672) (-872.007) [-857.839] (-865.014) * (-871.146) [-859.756] (-858.713) (-858.696) -- 0:02:57
23000 -- (-862.346) (-868.206) (-858.987) [-857.796] * (-858.427) [-859.525] (-866.247) (-854.371) -- 0:03:32
24000 -- (-861.038) [-866.448] (-857.334) (-860.118) * (-863.700) [-853.399] (-855.050) (-855.308) -- 0:03:23
25000 -- (-856.657) (-864.105) [-856.248] (-860.916) * (-862.187) [-860.257] (-850.825) (-866.798) -- 0:03:15
Average standard deviation of split frequencies: 0.033473
26000 -- (-861.375) (-862.739) (-860.704) [-858.268] * (-858.059) [-854.490] (-857.764) (-856.516) -- 0:03:07
27000 -- (-855.524) (-865.153) [-856.315] (-862.880) * [-858.290] (-857.270) (-864.577) (-859.464) -- 0:03:00
28000 -- (-855.362) (-859.718) [-854.892] (-865.506) * [-860.596] (-860.574) (-859.489) (-861.250) -- 0:02:53
29000 -- [-852.279] (-860.624) (-862.112) (-870.674) * (-858.495) (-866.664) [-864.310] (-864.616) -- 0:03:20
30000 -- (-859.369) (-862.063) (-858.006) [-856.550] * [-858.152] (-867.060) (-860.980) (-859.947) -- 0:03:14
Average standard deviation of split frequencies: 0.026014
31000 -- (-859.645) [-854.485] (-853.622) (-866.305) * [-857.381] (-868.627) (-861.472) (-858.840) -- 0:03:07
32000 -- [-862.602] (-860.733) (-853.886) (-861.981) * (-858.557) [-858.408] (-860.095) (-854.263) -- 0:03:01
33000 -- (-857.677) (-856.399) (-863.082) [-856.704] * (-857.906) [-859.864] (-855.842) (-864.452) -- 0:02:55
34000 -- (-858.929) (-864.935) (-859.504) [-859.654] * [-859.184] (-858.220) (-855.587) (-861.929) -- 0:03:18
35000 -- (-860.777) (-857.420) [-856.635] (-860.149) * [-863.629] (-860.168) (-858.758) (-863.945) -- 0:03:13
Average standard deviation of split frequencies: 0.020145
36000 -- (-859.211) (-863.289) (-860.316) [-860.628] * (-865.357) [-858.751] (-857.527) (-857.982) -- 0:03:07
37000 -- (-866.074) (-859.515) [-850.163] (-858.180) * (-861.630) [-858.646] (-860.229) (-860.400) -- 0:03:02
38000 -- [-866.202] (-861.372) (-863.693) (-860.159) * (-856.980) (-861.266) [-857.298] (-863.511) -- 0:02:57
39000 -- [-862.073] (-866.600) (-866.638) (-856.941) * [-857.381] (-863.842) (-871.876) (-867.395) -- 0:03:17
40000 -- (-869.269) [-861.113] (-863.186) (-860.183) * (-863.579) (-860.801) [-860.831] (-859.630) -- 0:03:12
Average standard deviation of split frequencies: 0.024967
41000 -- (-866.512) [-863.099] (-861.871) (-857.851) * (-864.009) [-856.571] (-861.521) (-857.687) -- 0:03:07
42000 -- (-860.888) (-867.674) [-862.268] (-862.572) * (-869.422) (-861.404) (-860.981) [-861.616] -- 0:03:02
43000 -- (-862.576) (-863.031) (-859.398) [-858.231] * (-859.283) (-858.996) [-855.380] (-864.515) -- 0:02:58
44000 -- (-866.297) (-855.801) (-861.960) [-858.425] * (-870.959) (-859.771) (-868.017) [-855.403] -- 0:03:15
45000 -- (-860.865) (-861.193) [-861.602] (-855.793) * (-863.251) (-860.416) [-862.494] (-863.493) -- 0:03:11
Average standard deviation of split frequencies: 0.022861
46000 -- (-864.005) [-864.764] (-863.527) (-863.181) * (-858.940) (-858.397) [-856.584] (-866.977) -- 0:03:06
47000 -- (-862.307) [-858.301] (-870.789) (-859.191) * [-860.422] (-858.043) (-861.415) (-873.257) -- 0:03:02
48000 -- (-856.954) [-861.221] (-866.795) (-862.665) * (-866.559) [-862.841] (-857.291) (-860.505) -- 0:02:58
49000 -- [-863.583] (-860.912) (-860.532) (-868.562) * (-859.078) (-864.111) (-861.075) [-869.795] -- 0:03:14
50000 -- (-864.016) [-853.309] (-867.149) (-862.359) * [-859.574] (-856.796) (-858.746) (-863.673) -- 0:03:10
Average standard deviation of split frequencies: 0.020039
51000 -- [-860.746] (-856.342) (-864.453) (-864.992) * (-860.102) (-867.351) (-860.989) [-859.829] -- 0:03:06
52000 -- [-858.030] (-858.963) (-866.822) (-865.378) * [-857.126] (-859.443) (-859.871) (-855.915) -- 0:03:02
53000 -- [-858.513] (-863.610) (-869.667) (-866.957) * (-858.129) (-862.628) (-863.511) [-857.001] -- 0:02:58
54000 -- (-857.189) (-855.464) (-863.995) [-858.248] * [-858.024] (-865.700) (-861.348) (-861.236) -- 0:03:12
55000 -- (-858.281) (-859.718) [-862.467] (-863.562) * [-858.483] (-862.761) (-866.315) (-865.130) -- 0:03:09
Average standard deviation of split frequencies: 0.019426
56000 -- (-862.650) [-856.745] (-857.887) (-863.193) * [-854.576] (-859.349) (-856.490) (-856.475) -- 0:03:05
57000 -- (-857.943) (-861.628) [-853.928] (-857.233) * [-856.086] (-863.455) (-862.585) (-858.438) -- 0:03:01
58000 -- (-860.435) [-859.728] (-854.757) (-862.717) * [-857.886] (-865.555) (-861.412) (-865.694) -- 0:02:58
59000 -- (-858.218) [-861.394] (-859.286) (-863.389) * (-863.783) (-861.627) (-858.976) [-864.865] -- 0:03:11
60000 -- [-852.347] (-859.444) (-858.467) (-858.495) * (-859.768) [-856.861] (-857.336) (-871.950) -- 0:03:08
Average standard deviation of split frequencies: 0.020323
61000 -- [-853.726] (-862.856) (-862.069) (-858.675) * (-867.595) [-865.101] (-859.810) (-862.347) -- 0:03:04
62000 -- (-862.256) [-856.742] (-865.551) (-856.756) * (-859.769) (-864.482) [-853.896] (-857.024) -- 0:03:01
63000 -- (-856.234) (-867.771) [-859.818] (-863.507) * (-862.903) [-854.079] (-863.009) (-857.732) -- 0:02:58
64000 -- (-856.826) (-868.505) (-857.686) [-858.355] * (-859.748) [-862.649] (-853.636) (-858.943) -- 0:03:10
65000 -- (-860.852) (-864.202) [-860.852] (-866.027) * (-865.991) (-855.663) (-857.321) [-857.315] -- 0:03:07
Average standard deviation of split frequencies: 0.021977
66000 -- (-864.550) [-857.412] (-866.682) (-861.807) * [-865.780] (-859.164) (-857.420) (-859.641) -- 0:03:03
67000 -- (-860.726) (-863.211) [-859.548] (-864.538) * (-876.710) (-858.235) [-863.578] (-860.219) -- 0:03:01
68000 -- (-867.348) [-851.872] (-857.474) (-857.650) * [-859.507] (-864.541) (-858.708) (-859.702) -- 0:02:58
69000 -- (-854.083) [-861.032] (-855.286) (-860.535) * (-862.609) (-861.874) (-856.970) [-855.456] -- 0:03:08
70000 -- (-857.751) (-857.961) (-855.858) [-852.655] * (-865.073) [-857.377] (-856.157) (-853.166) -- 0:03:06
Average standard deviation of split frequencies: 0.022578
71000 -- (-868.501) (-856.041) [-855.159] (-859.443) * (-866.454) [-859.044] (-865.915) (-865.298) -- 0:03:03
72000 -- (-862.066) (-862.491) [-856.079] (-855.970) * (-871.899) (-861.604) (-857.999) [-860.286] -- 0:03:00
73000 -- (-859.738) (-859.801) (-858.905) [-855.161] * (-866.205) [-860.169] (-856.717) (-859.636) -- 0:02:57
74000 -- (-858.030) (-860.721) (-858.308) [-858.048] * (-867.439) (-859.552) [-855.710] (-861.777) -- 0:03:07
75000 -- (-860.942) (-857.763) [-857.221] (-858.453) * (-859.307) [-863.576] (-865.080) (-865.793) -- 0:03:05
Average standard deviation of split frequencies: 0.021948
76000 -- (-865.871) (-864.275) [-854.475] (-856.773) * (-863.823) (-860.135) (-867.579) [-861.234] -- 0:03:02
77000 -- (-857.731) [-854.855] (-860.579) (-860.555) * (-865.828) [-859.956] (-860.803) (-863.757) -- 0:02:59
78000 -- (-860.216) (-853.193) (-856.919) [-857.034] * (-861.844) [-857.991] (-867.345) (-871.391) -- 0:02:57
79000 -- [-854.789] (-853.245) (-856.759) (-857.950) * (-855.106) [-854.180] (-871.326) (-860.056) -- 0:03:06
80000 -- (-856.053) (-858.880) (-860.222) [-862.451] * (-858.705) (-864.555) (-864.850) [-854.760] -- 0:03:04
Average standard deviation of split frequencies: 0.017981
81000 -- [-855.696] (-861.546) (-859.927) (-861.374) * (-859.828) (-860.084) [-864.455] (-876.349) -- 0:03:01
82000 -- (-855.953) (-864.219) (-857.980) [-857.580] * (-856.860) (-858.842) (-863.192) [-859.903] -- 0:02:59
83000 -- (-855.647) (-857.273) (-860.616) [-859.865] * [-858.860] (-853.853) (-861.078) (-855.731) -- 0:02:56
84000 -- (-861.496) (-859.635) (-863.273) [-869.355] * [-855.643] (-862.699) (-863.360) (-860.990) -- 0:03:05
85000 -- (-858.047) (-858.089) (-856.819) [-858.892] * (-867.729) [-856.822] (-863.989) (-857.728) -- 0:03:03
Average standard deviation of split frequencies: 0.016866
86000 -- [-862.771] (-861.563) (-855.850) (-862.090) * (-870.138) (-856.137) (-860.435) [-854.043] -- 0:03:00
87000 -- (-856.853) (-872.605) (-855.159) [-862.133] * (-857.012) (-857.885) [-863.866] (-856.062) -- 0:02:58
88000 -- (-860.491) (-863.583) (-860.963) [-854.511] * (-866.053) (-867.520) (-859.160) [-856.520] -- 0:02:56
89000 -- (-857.735) [-858.791] (-852.887) (-863.589) * (-865.781) (-861.398) (-860.586) [-858.892] -- 0:03:04
90000 -- [-857.752] (-859.811) (-861.592) (-866.029) * (-868.458) (-861.151) [-855.345] (-853.435) -- 0:03:02
Average standard deviation of split frequencies: 0.015198
91000 -- (-857.724) (-860.529) (-860.239) [-856.859] * [-860.316] (-858.027) (-875.903) (-857.144) -- 0:02:59
92000 -- (-850.649) (-862.688) (-853.883) [-854.334] * [-856.579] (-856.410) (-864.542) (-858.939) -- 0:02:57
93000 -- [-864.162] (-854.048) (-861.436) (-861.985) * (-862.937) (-862.742) [-860.512] (-863.501) -- 0:02:55
94000 -- (-857.599) (-854.218) (-857.418) [-860.097] * [-859.992] (-863.875) (-859.164) (-865.974) -- 0:03:03
95000 -- (-863.803) [-856.888] (-858.421) (-861.602) * (-862.639) (-861.058) [-856.069] (-868.401) -- 0:03:01
Average standard deviation of split frequencies: 0.015109
96000 -- (-854.224) [-859.654] (-860.414) (-859.688) * (-859.664) (-863.263) [-863.962] (-864.299) -- 0:02:58
97000 -- (-865.838) [-855.388] (-865.699) (-859.617) * [-854.958] (-862.688) (-857.675) (-860.018) -- 0:02:56
98000 -- (-860.311) (-859.252) (-855.621) [-855.919] * (-858.553) (-857.893) [-860.583] (-866.293) -- 0:02:54
99000 -- (-857.553) (-860.855) [-860.996] (-862.388) * (-860.920) (-861.901) [-862.599] (-863.369) -- 0:03:02
100000 -- (-856.902) (-856.644) [-857.807] (-855.549) * (-861.760) (-862.473) (-861.921) [-857.272] -- 0:03:00
Average standard deviation of split frequencies: 0.016570
101000 -- (-867.216) (-852.854) [-861.468] (-857.676) * [-855.398] (-859.575) (-863.646) (-861.935) -- 0:02:58
102000 -- [-862.229] (-860.444) (-860.191) (-859.374) * (-857.306) (-857.650) [-867.409] (-856.929) -- 0:02:56
103000 -- (-860.541) (-861.435) [-859.019] (-866.723) * (-865.691) (-859.913) (-864.819) [-857.429] -- 0:02:54
104000 -- (-866.128) (-863.421) (-866.400) [-856.388] * (-856.940) (-856.951) (-858.146) [-854.531] -- 0:03:00
105000 -- (-858.919) [-865.542] (-859.968) (-857.543) * (-853.936) (-858.685) (-860.035) [-859.793] -- 0:02:59
Average standard deviation of split frequencies: 0.018473
106000 -- (-856.960) (-872.174) [-857.690] (-860.904) * (-861.099) (-857.554) [-870.095] (-859.232) -- 0:02:57
107000 -- [-857.162] (-861.019) (-859.182) (-860.072) * [-872.994] (-860.223) (-855.830) (-861.833) -- 0:02:55
108000 -- [-852.699] (-856.610) (-867.997) (-864.944) * (-864.098) [-856.241] (-859.129) (-867.298) -- 0:02:53
109000 -- [-857.725] (-859.950) (-865.598) (-862.777) * (-862.784) (-865.523) (-858.172) [-853.832] -- 0:02:59
110000 -- (-869.954) [-856.887] (-864.842) (-861.095) * [-856.889] (-858.036) (-853.945) (-858.011) -- 0:02:58
Average standard deviation of split frequencies: 0.016711
111000 -- (-870.344) (-861.492) [-860.154] (-864.320) * (-862.048) (-863.265) (-863.014) [-865.509] -- 0:02:56
112000 -- [-863.610] (-854.491) (-864.535) (-866.819) * (-863.608) (-857.574) [-859.292] (-860.239) -- 0:02:54
113000 -- (-856.439) [-856.077] (-858.806) (-858.703) * (-860.269) (-853.495) (-856.085) [-858.081] -- 0:02:52
114000 -- (-855.437) [-855.890] (-869.518) (-866.911) * [-857.499] (-855.321) (-857.220) (-863.449) -- 0:02:58
115000 -- [-853.156] (-868.284) (-859.554) (-862.240) * (-855.702) (-860.938) [-855.947] (-871.385) -- 0:02:57
Average standard deviation of split frequencies: 0.017193
116000 -- (-860.834) (-869.114) [-859.045] (-856.931) * (-859.856) (-860.910) (-856.675) [-855.794] -- 0:02:55
117000 -- (-864.174) [-863.032] (-864.175) (-858.281) * (-867.992) (-854.724) (-865.845) [-856.331] -- 0:02:53
118000 -- (-863.967) [-857.520] (-858.256) (-862.971) * (-852.221) [-857.443] (-866.735) (-863.474) -- 0:02:51
119000 -- [-858.686] (-862.617) (-867.148) (-862.379) * (-859.801) (-862.582) (-855.021) [-856.227] -- 0:02:57
120000 -- (-862.161) [-866.445] (-867.627) (-859.031) * (-859.345) [-861.387] (-855.436) (-860.931) -- 0:02:56
Average standard deviation of split frequencies: 0.016228
121000 -- (-855.850) (-867.332) (-865.186) [-855.037] * [-861.231] (-863.317) (-868.896) (-856.422) -- 0:02:54
122000 -- [-857.253] (-860.271) (-856.938) (-857.604) * (-861.007) [-853.694] (-864.919) (-860.256) -- 0:02:52
123000 -- (-855.295) (-858.058) [-862.313] (-857.964) * (-857.474) [-854.524] (-858.628) (-863.838) -- 0:02:51
124000 -- (-859.880) (-860.431) [-861.362] (-866.258) * (-863.715) [-862.150] (-861.451) (-861.417) -- 0:02:56
125000 -- (-851.679) (-865.028) [-858.031] (-859.655) * (-859.004) (-862.553) (-873.683) [-859.072] -- 0:02:55
Average standard deviation of split frequencies: 0.012087
126000 -- [-854.165] (-862.458) (-854.987) (-856.710) * [-860.649] (-860.337) (-854.409) (-855.152) -- 0:02:53
127000 -- [-862.425] (-864.565) (-859.084) (-862.019) * [-857.417] (-865.791) (-854.845) (-856.410) -- 0:02:51
128000 -- [-860.698] (-856.115) (-855.498) (-863.526) * (-856.855) (-869.086) [-856.501] (-860.136) -- 0:02:50
129000 -- (-864.452) (-860.155) (-857.966) [-860.625] * (-859.566) (-855.200) [-861.365] (-854.384) -- 0:02:55
130000 -- (-860.437) [-861.380] (-860.236) (-861.905) * [-854.693] (-866.482) (-867.548) (-862.145) -- 0:02:54
Average standard deviation of split frequencies: 0.012766
131000 -- (-860.367) [-858.331] (-861.988) (-856.589) * (-859.910) [-861.066] (-871.953) (-862.834) -- 0:02:52
132000 -- [-857.631] (-857.598) (-857.783) (-857.981) * (-864.203) (-869.358) (-861.785) [-854.581] -- 0:02:50
133000 -- (-859.051) (-857.850) [-859.360] (-863.093) * (-858.883) (-854.834) (-863.710) [-855.804] -- 0:02:49
134000 -- (-856.666) (-859.597) (-858.920) [-853.640] * (-863.733) (-855.959) [-854.511] (-862.544) -- 0:02:54
135000 -- (-855.703) (-859.515) (-857.143) [-862.537] * (-862.136) (-868.367) (-858.934) [-863.518] -- 0:02:53
Average standard deviation of split frequencies: 0.012265
136000 -- (-862.372) (-858.493) (-864.511) [-855.698] * (-854.819) (-861.068) (-861.069) [-855.926] -- 0:02:51
137000 -- (-856.868) (-856.928) [-861.620] (-864.543) * (-855.048) (-866.414) (-866.846) [-858.302] -- 0:02:50
138000 -- (-861.292) [-858.542] (-859.361) (-857.171) * [-860.156] (-877.934) (-859.533) (-856.930) -- 0:02:48
139000 -- (-859.263) [-852.391] (-866.752) (-860.277) * (-868.236) [-859.828] (-859.375) (-858.721) -- 0:02:53
140000 -- [-853.153] (-856.789) (-864.461) (-873.614) * (-865.887) (-865.352) [-861.540] (-852.734) -- 0:02:52
Average standard deviation of split frequencies: 0.014178
141000 -- (-858.273) (-859.527) (-859.272) [-858.755] * (-868.254) [-861.752] (-860.334) (-855.333) -- 0:02:50
142000 -- (-861.338) [-862.360] (-861.618) (-861.354) * (-863.139) [-864.841] (-858.988) (-860.768) -- 0:02:49
143000 -- (-864.891) [-859.116] (-858.175) (-864.531) * (-858.652) [-857.927] (-859.460) (-853.524) -- 0:02:47
144000 -- (-859.989) (-863.280) (-861.821) [-856.803] * (-863.922) (-867.191) [-853.090] (-861.449) -- 0:02:52
145000 -- (-869.141) [-858.635] (-854.740) (-854.756) * (-860.006) (-864.360) [-856.821] (-860.037) -- 0:02:51
Average standard deviation of split frequencies: 0.012418
146000 -- (-861.325) [-858.944] (-861.456) (-865.277) * (-860.499) (-858.058) [-861.268] (-854.366) -- 0:02:49
147000 -- (-860.001) (-855.891) (-865.758) [-857.418] * (-869.723) (-857.950) [-860.343] (-857.407) -- 0:02:48
148000 -- (-861.456) (-857.017) (-856.232) [-856.933] * (-863.120) (-857.128) (-860.579) [-860.925] -- 0:02:46
149000 -- (-865.501) [-857.311] (-853.826) (-863.720) * (-861.325) [-857.766] (-862.254) (-859.703) -- 0:02:51
150000 -- (-863.886) (-862.923) (-863.241) [-854.622] * [-858.934] (-861.091) (-862.664) (-866.980) -- 0:02:50
Average standard deviation of split frequencies: 0.015885
151000 -- (-859.288) [-859.975] (-859.980) (-859.548) * (-859.705) (-860.768) (-864.054) [-863.957] -- 0:02:48
152000 -- (-861.458) [-856.816] (-870.462) (-860.677) * (-860.166) (-859.343) (-856.605) [-860.295] -- 0:02:47
153000 -- (-862.560) [-859.199] (-866.786) (-860.393) * (-855.371) [-858.274] (-864.360) (-869.296) -- 0:02:46
154000 -- (-864.301) (-857.368) [-864.755] (-869.635) * (-853.697) [-857.121] (-862.402) (-865.888) -- 0:02:50
155000 -- (-860.801) [-862.148] (-859.290) (-863.572) * [-860.778] (-866.201) (-863.088) (-862.706) -- 0:02:49
Average standard deviation of split frequencies: 0.014877
156000 -- [-858.909] (-860.445) (-864.662) (-858.031) * [-859.545] (-857.609) (-865.326) (-860.918) -- 0:02:47
157000 -- [-860.191] (-852.976) (-864.181) (-859.019) * (-857.723) (-863.064) (-858.471) [-855.273] -- 0:02:46
158000 -- (-856.322) (-865.668) [-862.562] (-855.382) * (-863.091) (-858.402) [-858.488] (-860.763) -- 0:02:45
159000 -- (-858.461) (-860.514) [-855.937] (-859.291) * (-858.572) (-859.638) (-868.948) [-856.526] -- 0:02:49
160000 -- (-862.987) [-859.822] (-858.658) (-852.847) * [-857.473] (-861.123) (-867.485) (-859.078) -- 0:02:48
Average standard deviation of split frequencies: 0.014896
161000 -- [-854.466] (-860.247) (-857.645) (-861.521) * (-864.986) (-864.452) (-863.863) [-855.509] -- 0:02:46
162000 -- [-855.080] (-864.077) (-860.892) (-858.633) * (-854.882) (-858.737) (-858.353) [-860.512] -- 0:02:45
163000 -- (-858.928) [-863.652] (-859.271) (-852.144) * (-862.674) (-861.202) [-854.378] (-861.834) -- 0:02:44
164000 -- [-863.871] (-865.433) (-857.409) (-856.579) * [-854.390] (-866.825) (-855.032) (-857.448) -- 0:02:48
165000 -- (-854.911) (-864.628) [-862.193] (-856.452) * [-858.498] (-868.126) (-859.714) (-857.228) -- 0:02:47
Average standard deviation of split frequencies: 0.013544
166000 -- (-866.568) (-859.754) (-867.657) [-856.195] * (-866.908) (-854.944) [-857.310] (-866.151) -- 0:02:45
167000 -- (-863.325) (-860.478) (-857.052) [-859.603] * (-864.186) (-860.380) [-858.640] (-862.373) -- 0:02:44
168000 -- (-859.449) (-852.903) (-861.068) [-861.890] * (-863.083) (-859.740) (-862.377) [-857.026] -- 0:02:43
169000 -- (-864.833) (-857.078) [-857.287] (-854.278) * (-865.901) [-855.276] (-857.175) (-856.489) -- 0:02:47
170000 -- (-859.609) (-859.312) [-856.721] (-860.871) * (-863.406) [-862.898] (-859.452) (-866.829) -- 0:02:46
Average standard deviation of split frequencies: 0.012111
171000 -- (-853.294) (-861.796) (-865.543) [-853.920] * (-869.328) (-859.631) [-854.228] (-861.225) -- 0:02:44
172000 -- (-865.477) (-861.603) [-856.102] (-863.425) * [-855.518] (-857.396) (-860.061) (-874.752) -- 0:02:43
173000 -- [-856.539] (-854.885) (-858.063) (-863.802) * (-857.042) (-865.883) (-852.746) [-857.615] -- 0:02:42
174000 -- [-860.665] (-865.171) (-863.826) (-862.044) * (-866.742) (-866.970) [-857.224] (-857.527) -- 0:02:46
175000 -- (-858.899) (-862.071) (-863.270) [-861.356] * (-864.600) [-867.432] (-856.232) (-860.633) -- 0:02:45
Average standard deviation of split frequencies: 0.013392
176000 -- (-856.281) (-856.495) [-860.307] (-866.533) * (-857.331) (-864.238) (-858.562) [-854.405] -- 0:02:43
177000 -- (-857.937) (-862.449) [-854.628] (-854.385) * (-858.292) (-859.519) [-854.796] (-860.720) -- 0:02:42
178000 -- (-855.956) (-860.349) [-865.559] (-863.691) * (-858.715) (-860.485) [-864.772] (-865.458) -- 0:02:41
179000 -- (-867.337) [-857.826] (-863.973) (-861.222) * [-856.650] (-863.860) (-873.593) (-855.436) -- 0:02:45
180000 -- (-857.820) (-862.219) [-862.015] (-862.952) * (-861.139) (-859.065) [-857.626] (-864.079) -- 0:02:44
Average standard deviation of split frequencies: 0.012444
181000 -- [-858.975] (-858.775) (-872.610) (-858.079) * (-864.179) (-868.132) [-857.872] (-863.237) -- 0:02:42
182000 -- (-862.062) [-851.792] (-868.840) (-861.344) * [-857.683] (-869.969) (-857.719) (-858.668) -- 0:02:41
183000 -- [-856.409] (-856.438) (-862.740) (-859.735) * (-859.214) [-857.968] (-862.389) (-856.652) -- 0:02:40
184000 -- (-855.822) (-861.989) [-857.836] (-858.626) * (-861.810) (-856.271) (-863.799) [-863.152] -- 0:02:44
185000 -- (-860.288) (-855.685) (-859.098) [-856.214] * (-860.002) [-855.944] (-858.851) (-863.911) -- 0:02:43
Average standard deviation of split frequencies: 0.011892
186000 -- (-859.659) (-862.659) [-853.962] (-853.220) * (-859.656) (-859.056) (-866.972) [-858.918] -- 0:02:41
187000 -- (-861.918) (-859.931) (-854.688) [-856.413] * (-860.620) [-862.374] (-855.727) (-855.939) -- 0:02:40
188000 -- (-858.552) [-860.127] (-853.463) (-859.664) * (-863.165) [-862.296] (-861.575) (-861.495) -- 0:02:39
189000 -- (-859.725) (-863.127) (-856.581) [-857.556] * (-867.234) [-855.637] (-861.616) (-862.523) -- 0:02:43
190000 -- (-861.452) [-855.640] (-859.976) (-861.770) * (-858.589) (-854.404) (-875.592) [-858.123] -- 0:02:42
Average standard deviation of split frequencies: 0.012552
191000 -- (-864.982) (-860.191) [-860.579] (-864.810) * [-852.665] (-854.771) (-864.722) (-872.421) -- 0:02:40
192000 -- (-862.292) (-857.191) [-858.429] (-867.819) * (-856.438) (-854.455) (-852.951) [-865.090] -- 0:02:39
193000 -- (-858.732) (-861.857) (-858.285) [-857.513] * (-859.134) [-855.682] (-852.584) (-861.027) -- 0:02:38
194000 -- (-861.708) (-864.727) [-859.699] (-863.047) * [-856.617] (-857.156) (-861.407) (-863.843) -- 0:02:42
195000 -- [-858.965] (-869.521) (-860.597) (-858.202) * (-867.611) [-858.759] (-861.349) (-855.880) -- 0:02:41
Average standard deviation of split frequencies: 0.012396
196000 -- [-858.065] (-861.544) (-862.117) (-859.857) * (-863.094) [-864.161] (-863.084) (-870.037) -- 0:02:39
197000 -- (-881.664) (-862.520) (-861.620) [-852.774] * (-869.189) (-865.251) (-857.039) [-854.902] -- 0:02:38
198000 -- (-858.838) (-866.730) (-866.995) [-854.364] * (-857.380) (-861.467) [-864.149] (-861.495) -- 0:02:37
199000 -- (-859.956) (-860.560) [-857.249] (-856.086) * (-865.605) (-864.036) [-856.479] (-862.124) -- 0:02:41
200000 -- (-857.898) (-869.964) (-858.627) [-855.223] * (-861.081) (-860.110) (-857.613) [-854.035] -- 0:02:40
Average standard deviation of split frequencies: 0.013192
201000 -- [-858.747] (-863.397) (-855.854) (-853.840) * (-859.258) (-861.075) [-854.359] (-862.887) -- 0:02:39
202000 -- [-861.244] (-856.371) (-860.639) (-860.615) * [-856.104] (-865.283) (-860.832) (-865.013) -- 0:02:38
203000 -- [-855.159] (-858.499) (-855.161) (-861.873) * [-855.303] (-865.644) (-861.648) (-859.026) -- 0:02:37
204000 -- (-865.902) [-854.648] (-857.589) (-860.315) * (-856.888) (-860.316) [-861.317] (-865.020) -- 0:02:39
205000 -- [-859.552] (-865.795) (-858.815) (-867.281) * (-858.931) [-860.757] (-856.601) (-860.391) -- 0:02:39
Average standard deviation of split frequencies: 0.013906
206000 -- (-861.982) [-853.540] (-858.321) (-869.767) * [-860.067] (-864.799) (-861.254) (-854.058) -- 0:02:38
207000 -- (-863.175) (-865.407) (-856.322) [-856.698] * (-863.531) (-853.254) [-853.121] (-862.025) -- 0:02:37
208000 -- [-860.509] (-857.601) (-860.075) (-856.234) * (-862.529) (-860.442) [-853.345] (-865.637) -- 0:02:36
209000 -- (-854.379) [-859.253] (-861.657) (-861.465) * [-862.591] (-864.689) (-860.960) (-858.596) -- 0:02:38
210000 -- (-851.430) (-861.281) (-863.701) [-857.143] * (-860.056) (-859.641) [-859.806] (-866.467) -- 0:02:38
Average standard deviation of split frequencies: 0.014459
211000 -- (-872.244) (-864.895) [-858.290] (-858.950) * (-856.385) [-861.428] (-861.355) (-856.648) -- 0:02:37
212000 -- [-861.585] (-864.771) (-859.778) (-859.045) * (-857.220) (-857.755) (-860.209) [-859.055] -- 0:02:36
213000 -- (-859.849) [-857.430] (-861.744) (-869.743) * [-854.031] (-858.452) (-858.186) (-860.563) -- 0:02:35
214000 -- (-861.371) (-859.134) [-860.202] (-865.745) * (-865.920) (-863.970) (-855.827) [-859.627] -- 0:02:37
215000 -- [-859.716] (-858.535) (-865.284) (-859.403) * [-853.537] (-858.728) (-867.318) (-863.116) -- 0:02:37
Average standard deviation of split frequencies: 0.013095
216000 -- (-857.676) (-855.487) [-861.211] (-866.596) * (-865.871) (-861.551) [-849.214] (-859.796) -- 0:02:36
217000 -- (-860.339) (-850.910) (-864.506) [-857.249] * [-862.002] (-854.603) (-859.895) (-867.423) -- 0:02:35
218000 -- [-863.329] (-855.994) (-868.517) (-861.025) * (-865.663) (-856.254) (-859.143) [-856.688] -- 0:02:34
219000 -- (-859.699) (-858.463) [-862.442] (-870.525) * (-857.057) (-862.495) [-857.601] (-857.599) -- 0:02:36
220000 -- (-858.985) (-857.895) (-878.478) [-860.189] * (-856.185) (-859.843) (-858.735) [-858.048] -- 0:02:36
Average standard deviation of split frequencies: 0.013804
221000 -- [-851.857] (-857.125) (-871.167) (-861.868) * [-863.268] (-858.930) (-856.484) (-860.412) -- 0:02:35
222000 -- [-861.656] (-864.304) (-866.153) (-855.750) * (-856.890) (-864.182) (-868.980) [-854.135] -- 0:02:34
223000 -- (-860.844) (-870.809) (-858.011) [-851.204] * (-858.479) (-861.396) (-857.468) [-852.704] -- 0:02:33
224000 -- (-857.271) [-859.882] (-861.911) (-866.909) * [-857.131] (-866.094) (-864.273) (-856.377) -- 0:02:35
225000 -- (-857.619) (-862.479) [-861.532] (-858.812) * (-860.347) [-858.474] (-863.067) (-864.022) -- 0:02:35
Average standard deviation of split frequencies: 0.013157
226000 -- (-873.268) (-856.757) (-856.465) [-857.945] * (-866.278) [-863.319] (-853.696) (-861.969) -- 0:02:34
227000 -- (-857.612) (-869.998) [-857.281] (-860.344) * (-855.218) (-869.191) [-855.269] (-863.471) -- 0:02:33
228000 -- (-857.012) [-859.278] (-864.632) (-859.576) * (-868.375) (-857.593) [-856.588] (-861.972) -- 0:02:32
229000 -- (-853.897) [-858.224] (-864.169) (-856.875) * [-863.040] (-861.905) (-865.526) (-860.520) -- 0:02:34
230000 -- [-856.761] (-863.716) (-860.825) (-860.205) * (-858.842) [-855.884] (-862.148) (-856.108) -- 0:02:34
Average standard deviation of split frequencies: 0.014777
231000 -- (-864.754) (-864.176) [-861.304] (-875.373) * (-858.443) (-856.664) (-863.647) [-858.604] -- 0:02:33
232000 -- (-866.312) [-859.593] (-860.946) (-865.228) * (-859.641) (-855.906) [-860.722] (-860.291) -- 0:02:32
233000 -- (-868.572) (-858.277) [-855.742] (-857.427) * (-861.016) (-859.906) [-860.422] (-856.626) -- 0:02:31
234000 -- (-859.846) (-863.120) [-855.832] (-859.416) * (-853.526) (-858.672) (-865.559) [-856.799] -- 0:02:33
235000 -- [-856.918] (-859.584) (-860.343) (-857.466) * (-860.204) (-860.729) [-855.811] (-858.624) -- 0:02:33
Average standard deviation of split frequencies: 0.014751
236000 -- (-854.218) (-874.715) [-860.548] (-867.006) * (-873.015) (-864.721) (-859.533) [-865.852] -- 0:02:32
237000 -- [-859.926] (-860.418) (-855.364) (-867.774) * (-861.393) [-855.015] (-868.360) (-856.886) -- 0:02:31
238000 -- (-869.044) (-861.141) (-859.452) [-856.280] * (-859.672) (-857.493) [-862.069] (-855.674) -- 0:02:30
239000 -- (-856.906) (-863.889) [-854.892] (-857.134) * (-861.470) (-857.398) (-859.636) [-861.679] -- 0:02:32
240000 -- [-856.200] (-866.061) (-857.935) (-858.951) * [-864.858] (-859.614) (-853.255) (-862.893) -- 0:02:32
Average standard deviation of split frequencies: 0.014465
241000 -- [-864.726] (-866.304) (-858.031) (-860.262) * [-858.370] (-865.274) (-857.565) (-858.883) -- 0:02:31
242000 -- (-868.921) [-863.170] (-856.940) (-856.625) * (-855.728) (-863.638) [-857.062] (-860.641) -- 0:02:30
243000 -- (-862.215) (-869.537) (-864.301) [-855.466] * (-862.302) [-861.185] (-856.171) (-856.085) -- 0:02:29
244000 -- (-854.175) (-864.356) (-872.799) [-852.226] * (-860.985) [-863.310] (-860.074) (-861.121) -- 0:02:31
245000 -- [-862.268] (-860.420) (-870.502) (-859.870) * (-857.186) (-857.995) [-859.822] (-859.008) -- 0:02:31
Average standard deviation of split frequencies: 0.015035
246000 -- (-859.662) [-857.602] (-869.021) (-858.604) * [-854.152] (-862.498) (-863.726) (-865.023) -- 0:02:30
247000 -- [-856.071] (-852.722) (-867.917) (-857.919) * [-859.832] (-861.339) (-855.819) (-867.428) -- 0:02:29
248000 -- (-867.498) [-855.911] (-861.227) (-854.665) * (-857.435) (-854.607) (-864.043) [-861.638] -- 0:02:28
249000 -- (-859.304) (-856.074) [-858.460] (-871.003) * (-859.432) [-856.398] (-861.823) (-864.736) -- 0:02:30
250000 -- (-862.169) [-856.555] (-853.108) (-864.673) * (-860.680) (-863.011) (-860.792) [-852.674] -- 0:02:30
Average standard deviation of split frequencies: 0.015045
251000 -- [-860.553] (-853.672) (-859.959) (-861.268) * (-866.836) [-854.060] (-862.731) (-854.092) -- 0:02:29
252000 -- [-858.348] (-858.653) (-857.812) (-854.041) * (-860.089) [-855.710] (-861.445) (-856.357) -- 0:02:28
253000 -- (-865.558) (-858.116) [-859.007] (-874.752) * (-855.199) (-855.955) [-862.371] (-860.940) -- 0:02:27
254000 -- (-855.764) [-858.085] (-860.822) (-863.169) * (-861.043) [-859.452] (-865.511) (-873.164) -- 0:02:29
255000 -- (-861.879) (-859.981) (-855.399) [-858.760] * [-856.255] (-853.667) (-862.448) (-861.146) -- 0:02:29
Average standard deviation of split frequencies: 0.015298
256000 -- [-854.128] (-861.649) (-853.017) (-861.025) * (-857.293) [-855.474] (-864.829) (-863.139) -- 0:02:28
257000 -- (-856.902) (-864.088) [-857.263] (-856.479) * (-858.487) (-863.634) (-864.156) [-867.438] -- 0:02:27
258000 -- (-863.363) [-860.661] (-855.494) (-868.214) * (-855.701) (-855.818) [-867.613] (-858.615) -- 0:02:26
259000 -- (-857.761) [-857.115] (-857.429) (-858.116) * (-863.167) (-862.453) (-862.923) [-856.443] -- 0:02:28
260000 -- (-857.381) [-856.766] (-856.967) (-857.679) * (-863.328) [-862.979] (-863.220) (-860.571) -- 0:02:28
Average standard deviation of split frequencies: 0.015024
261000 -- (-860.622) [-859.008] (-860.894) (-865.576) * (-861.568) (-858.123) (-859.934) [-857.624] -- 0:02:27
262000 -- (-861.682) (-855.323) [-858.429] (-858.744) * [-855.598] (-855.625) (-858.567) (-859.440) -- 0:02:26
263000 -- (-865.788) (-862.161) (-862.320) [-856.489] * [-858.694] (-858.126) (-862.902) (-854.030) -- 0:02:25
264000 -- [-860.051] (-857.318) (-859.350) (-856.683) * (-856.503) (-864.860) (-858.567) [-856.599] -- 0:02:27
265000 -- (-862.289) (-865.589) [-863.613] (-859.976) * (-858.408) (-856.119) (-859.074) [-864.413] -- 0:02:27
Average standard deviation of split frequencies: 0.013905
266000 -- (-866.099) (-864.737) [-861.322] (-862.427) * (-862.020) (-859.420) (-855.946) [-860.077] -- 0:02:26
267000 -- (-874.167) (-859.550) [-860.076] (-857.273) * (-861.149) (-860.747) [-854.841] (-864.767) -- 0:02:25
268000 -- [-857.377] (-861.562) (-863.754) (-859.588) * (-861.538) (-863.290) (-863.890) [-854.288] -- 0:02:24
269000 -- [-860.847] (-859.660) (-859.349) (-860.028) * [-858.979] (-866.478) (-859.349) (-855.556) -- 0:02:26
270000 -- (-866.048) (-865.610) [-860.452] (-856.912) * (-854.532) (-868.218) [-856.666] (-863.768) -- 0:02:26
Average standard deviation of split frequencies: 0.012995
271000 -- (-862.377) (-867.751) (-861.933) [-861.300] * (-873.729) [-858.235] (-856.084) (-856.077) -- 0:02:25
272000 -- (-868.569) [-859.835] (-868.303) (-863.318) * (-855.940) (-857.933) (-853.160) [-857.833] -- 0:02:24
273000 -- (-864.066) [-854.604] (-859.891) (-862.275) * (-858.700) (-860.658) [-856.057] (-862.499) -- 0:02:23
274000 -- (-863.475) [-855.853] (-859.314) (-863.654) * [-854.467] (-857.100) (-855.248) (-864.635) -- 0:02:25
275000 -- (-867.974) (-858.084) [-863.307] (-856.916) * (-860.056) (-864.973) (-857.813) [-859.965] -- 0:02:25
Average standard deviation of split frequencies: 0.014321
276000 -- (-857.220) [-861.906] (-861.659) (-861.380) * [-857.856] (-867.551) (-859.623) (-858.442) -- 0:02:24
277000 -- (-867.554) (-855.114) [-855.179] (-854.104) * (-861.883) (-871.955) (-865.276) [-853.841] -- 0:02:23
278000 -- (-860.190) [-858.741] (-863.872) (-863.510) * [-854.087] (-857.929) (-865.742) (-859.457) -- 0:02:22
279000 -- (-857.517) [-856.843] (-855.621) (-860.867) * (-872.694) [-861.390] (-862.799) (-860.955) -- 0:02:24
280000 -- (-859.047) (-862.045) (-862.559) [-862.500] * (-865.559) [-856.532] (-866.769) (-858.189) -- 0:02:24
Average standard deviation of split frequencies: 0.014212
281000 -- (-852.346) (-855.400) (-858.422) [-857.584] * (-859.182) (-863.271) (-864.120) [-865.988] -- 0:02:23
282000 -- [-850.664] (-861.514) (-861.135) (-862.078) * [-861.749] (-864.423) (-864.354) (-864.241) -- 0:02:22
283000 -- [-858.354] (-861.767) (-866.581) (-856.479) * (-854.139) [-854.149] (-874.342) (-862.129) -- 0:02:21
284000 -- [-858.693] (-859.402) (-865.487) (-858.886) * [-855.622] (-859.480) (-864.801) (-857.546) -- 0:02:23
285000 -- [-856.856] (-865.502) (-863.441) (-867.231) * [-859.139] (-860.732) (-868.377) (-860.007) -- 0:02:23
Average standard deviation of split frequencies: 0.015215
286000 -- (-852.888) (-862.393) (-861.366) [-858.260] * (-865.218) (-856.009) [-859.270] (-860.430) -- 0:02:22
287000 -- (-865.823) [-857.629] (-859.855) (-857.317) * [-856.143] (-860.915) (-854.897) (-862.383) -- 0:02:21
288000 -- (-861.033) (-869.821) (-860.998) [-855.955] * (-863.431) (-863.777) (-855.230) [-855.899] -- 0:02:20
289000 -- (-856.374) [-857.112] (-860.739) (-859.014) * (-857.703) (-860.091) [-862.201] (-858.375) -- 0:02:22
290000 -- [-862.412] (-865.430) (-860.851) (-859.404) * (-859.783) (-863.608) [-859.200] (-857.048) -- 0:02:22
Average standard deviation of split frequencies: 0.015095
291000 -- (-869.053) (-858.143) (-859.707) [-856.235] * (-868.092) [-858.296] (-860.210) (-856.512) -- 0:02:21
292000 -- (-860.593) (-854.832) (-860.781) [-856.765] * [-858.048] (-854.642) (-869.751) (-856.756) -- 0:02:20
293000 -- (-854.163) (-858.857) (-861.421) [-859.374] * (-861.603) (-859.083) (-863.363) [-860.600] -- 0:02:19
294000 -- (-865.198) (-862.061) (-860.821) [-857.567] * (-866.423) [-858.700] (-858.066) (-855.664) -- 0:02:21
295000 -- (-865.050) (-857.320) [-856.898] (-856.918) * [-859.708] (-861.369) (-871.943) (-866.517) -- 0:02:21
Average standard deviation of split frequencies: 0.016293
296000 -- (-861.750) [-860.294] (-866.733) (-860.561) * (-860.211) [-861.367] (-860.213) (-854.887) -- 0:02:20
297000 -- (-862.197) [-855.790] (-863.555) (-871.132) * (-858.185) [-861.709] (-853.405) (-860.504) -- 0:02:19
298000 -- [-859.288] (-859.909) (-859.774) (-858.294) * (-855.907) (-859.775) [-860.561] (-860.029) -- 0:02:18
299000 -- [-864.788] (-859.192) (-862.719) (-858.869) * (-866.188) (-860.878) (-858.107) [-855.302] -- 0:02:20
300000 -- (-860.008) (-854.310) [-858.901] (-856.815) * (-858.144) (-867.465) [-855.587] (-865.570) -- 0:02:20
Average standard deviation of split frequencies: 0.015558
301000 -- (-873.197) (-858.020) (-854.159) [-855.666] * [-861.690] (-862.103) (-857.394) (-860.609) -- 0:02:19
302000 -- (-861.212) [-856.545] (-852.897) (-862.345) * (-862.412) (-861.997) [-855.499] (-862.592) -- 0:02:18
303000 -- (-863.498) [-852.049] (-859.435) (-858.869) * (-854.359) [-862.370] (-871.249) (-859.088) -- 0:02:18
304000 -- (-858.877) [-855.662] (-859.900) (-859.422) * (-860.115) [-856.259] (-862.348) (-856.523) -- 0:02:19
305000 -- (-865.505) (-859.260) (-859.371) [-855.739] * (-856.922) [-856.498] (-858.562) (-854.302) -- 0:02:19
Average standard deviation of split frequencies: 0.015761
306000 -- (-860.345) (-860.213) [-857.415] (-860.335) * (-863.280) (-854.755) [-859.027] (-869.654) -- 0:02:18
307000 -- (-864.808) [-856.513] (-854.957) (-859.838) * (-857.030) [-858.745] (-858.859) (-859.823) -- 0:02:17
308000 -- (-862.768) (-852.880) [-859.179] (-863.562) * (-859.797) (-856.347) [-858.404] (-859.907) -- 0:02:17
309000 -- (-863.037) (-863.351) [-862.977] (-861.811) * (-859.235) [-857.159] (-863.552) (-862.200) -- 0:02:18
310000 -- (-853.507) (-867.572) (-866.802) [-862.990] * (-860.745) [-858.529] (-869.239) (-867.193) -- 0:02:18
Average standard deviation of split frequencies: 0.016224
311000 -- (-861.845) (-865.756) (-863.541) [-862.017] * (-859.166) [-857.440] (-870.127) (-869.236) -- 0:02:17
312000 -- [-858.795] (-862.297) (-862.266) (-864.959) * (-864.177) (-861.220) (-868.941) [-860.237] -- 0:02:16
313000 -- [-857.360] (-863.843) (-858.649) (-860.003) * [-856.688] (-866.171) (-857.126) (-863.256) -- 0:02:16
314000 -- (-858.459) (-860.781) [-858.957] (-862.588) * (-864.731) (-861.664) (-854.589) [-863.734] -- 0:02:17
315000 -- (-855.244) (-865.131) [-862.665] (-859.763) * (-860.366) (-860.261) [-864.344] (-865.908) -- 0:02:17
Average standard deviation of split frequencies: 0.016869
316000 -- (-858.252) [-857.775] (-863.064) (-854.203) * (-852.530) (-868.693) (-858.088) [-859.290] -- 0:02:16
317000 -- (-865.902) (-855.856) [-856.160] (-859.148) * (-855.142) [-861.801] (-864.052) (-858.056) -- 0:02:15
318000 -- (-858.203) (-860.165) (-859.746) [-859.891] * (-862.178) [-856.483] (-858.641) (-859.273) -- 0:02:15
319000 -- (-856.872) (-876.698) (-858.420) [-858.404] * (-863.055) [-862.688] (-861.570) (-864.116) -- 0:02:16
320000 -- (-861.899) (-868.885) (-856.906) [-865.729] * (-859.146) [-856.496] (-866.660) (-857.557) -- 0:02:16
Average standard deviation of split frequencies: 0.015719
321000 -- (-861.480) (-866.314) (-859.143) [-861.588] * (-856.396) (-862.912) [-860.324] (-861.188) -- 0:02:15
322000 -- (-860.364) (-856.274) (-860.675) [-864.584] * [-855.906] (-857.638) (-859.431) (-865.455) -- 0:02:14
323000 -- (-864.782) (-857.701) (-870.151) [-856.151] * (-871.292) [-854.682] (-867.082) (-854.814) -- 0:02:14
324000 -- (-857.861) (-857.966) (-866.894) [-856.062] * (-861.338) (-858.865) [-863.020] (-859.400) -- 0:02:15
325000 -- (-858.301) (-856.142) (-873.521) [-867.146] * (-861.386) (-856.810) (-868.778) [-863.067] -- 0:02:15
Average standard deviation of split frequencies: 0.015461
326000 -- (-859.183) (-856.651) [-861.564] (-861.779) * (-857.574) [-857.313] (-855.703) (-863.485) -- 0:02:14
327000 -- (-861.908) (-856.289) (-860.286) [-860.840] * (-863.495) (-861.271) (-856.109) [-855.283] -- 0:02:13
328000 -- (-861.706) (-864.548) (-864.195) [-862.305] * (-872.890) [-858.140] (-857.829) (-860.344) -- 0:02:13
329000 -- (-869.754) [-856.895] (-865.663) (-865.351) * (-857.514) (-858.426) (-862.880) [-859.155] -- 0:02:14
330000 -- (-862.232) [-860.469] (-858.141) (-858.318) * (-861.405) (-861.607) [-853.704] (-860.333) -- 0:02:14
Average standard deviation of split frequencies: 0.015682
331000 -- (-857.720) [-853.496] (-861.626) (-853.796) * [-852.336] (-857.189) (-862.808) (-858.064) -- 0:02:13
332000 -- (-861.736) (-865.531) [-859.812] (-857.036) * [-864.962] (-856.188) (-856.646) (-863.275) -- 0:02:12
333000 -- (-856.723) [-854.586] (-860.396) (-858.322) * (-857.913) (-863.739) [-858.442] (-861.071) -- 0:02:12
334000 -- [-858.628] (-859.628) (-855.445) (-856.804) * [-855.796] (-860.168) (-859.075) (-859.270) -- 0:02:13
335000 -- [-860.291] (-859.356) (-856.288) (-857.786) * (-866.059) [-858.107] (-857.760) (-861.479) -- 0:02:13
Average standard deviation of split frequencies: 0.015001
336000 -- (-863.480) (-859.703) (-870.610) [-858.602] * (-859.653) (-857.007) [-859.233] (-858.374) -- 0:02:12
337000 -- (-870.074) (-859.359) (-858.551) [-857.660] * (-862.233) [-854.146] (-854.911) (-857.385) -- 0:02:11
338000 -- (-867.150) (-859.943) [-857.240] (-862.113) * [-858.765] (-866.194) (-861.405) (-860.301) -- 0:02:11
339000 -- (-866.281) [-857.727] (-860.170) (-860.156) * (-866.946) [-861.748] (-859.010) (-865.839) -- 0:02:12
340000 -- (-867.607) [-861.008] (-867.779) (-855.553) * [-855.242] (-859.494) (-859.313) (-864.271) -- 0:02:12
Average standard deviation of split frequencies: 0.014370
341000 -- (-867.101) (-864.560) (-866.644) [-855.918] * (-859.235) (-858.253) (-866.803) [-854.589] -- 0:02:11
342000 -- [-858.729] (-859.524) (-858.384) (-854.548) * [-858.134] (-863.319) (-862.807) (-863.393) -- 0:02:10
343000 -- [-863.999] (-854.380) (-860.763) (-864.935) * (-856.145) (-861.454) (-857.163) [-857.928] -- 0:02:10
344000 -- (-866.140) [-854.090] (-867.336) (-861.928) * (-860.251) (-867.398) (-858.647) [-864.156] -- 0:02:11
345000 -- (-863.014) [-856.299] (-854.041) (-859.555) * (-856.962) (-858.338) [-858.831] (-865.911) -- 0:02:11
Average standard deviation of split frequencies: 0.015196
346000 -- (-867.617) [-855.508] (-855.090) (-870.448) * (-867.711) (-857.127) (-855.557) [-856.847] -- 0:02:10
347000 -- [-860.682] (-856.862) (-862.190) (-863.658) * [-861.105] (-867.671) (-861.730) (-857.985) -- 0:02:09
348000 -- [-858.489] (-867.648) (-855.645) (-858.582) * (-862.144) (-865.204) [-858.948] (-855.622) -- 0:02:09
349000 -- [-856.030] (-870.942) (-863.676) (-861.867) * (-864.657) (-865.359) (-851.593) [-862.854] -- 0:02:10
350000 -- [-860.982] (-866.801) (-859.288) (-861.839) * (-861.286) [-860.714] (-853.421) (-862.086) -- 0:02:10
Average standard deviation of split frequencies: 0.015511
351000 -- (-855.736) (-878.850) (-855.251) [-865.739] * [-859.182] (-857.550) (-859.609) (-860.169) -- 0:02:09
352000 -- (-859.835) (-869.359) [-853.355] (-855.920) * (-866.273) (-854.747) [-861.511] (-863.146) -- 0:02:08
353000 -- (-864.251) (-859.396) (-857.887) [-857.091] * (-858.543) [-861.494] (-858.954) (-857.879) -- 0:02:08
354000 -- [-859.134] (-860.628) (-859.669) (-873.117) * (-861.981) (-857.994) [-857.700] (-857.601) -- 0:02:09
355000 -- (-866.144) (-859.716) (-860.509) [-862.930] * (-868.013) (-864.127) (-859.756) [-858.560] -- 0:02:09
Average standard deviation of split frequencies: 0.015686
356000 -- (-863.209) (-861.555) (-861.631) [-858.225] * (-858.226) (-863.188) (-860.512) [-862.876] -- 0:02:08
357000 -- (-862.375) (-860.818) [-859.469] (-861.954) * (-857.966) (-857.842) (-863.328) [-855.404] -- 0:02:07
358000 -- (-861.927) (-869.440) [-856.797] (-862.037) * [-857.905] (-857.681) (-860.387) (-858.247) -- 0:02:07
359000 -- (-862.015) (-854.952) (-858.477) [-857.763] * (-862.181) (-861.769) [-862.843] (-858.080) -- 0:02:08
360000 -- [-855.555] (-862.126) (-857.000) (-855.852) * (-860.712) (-856.357) (-868.075) [-869.033] -- 0:02:08
Average standard deviation of split frequencies: 0.015081
361000 -- (-855.968) (-859.581) (-864.902) [-854.695] * (-858.031) (-853.865) (-862.794) [-861.788] -- 0:02:07
362000 -- (-865.377) (-859.652) [-866.682] (-864.225) * (-860.577) (-854.620) [-862.702] (-862.844) -- 0:02:06
363000 -- (-856.809) [-862.742] (-857.767) (-861.103) * [-857.334] (-863.770) (-862.622) (-856.882) -- 0:02:06
364000 -- (-857.600) (-861.872) (-857.034) [-859.033] * (-858.064) (-858.135) (-858.588) [-860.675] -- 0:02:07
365000 -- (-874.651) (-858.509) (-861.536) [-857.868] * (-856.704) [-861.506] (-865.209) (-862.692) -- 0:02:07
Average standard deviation of split frequencies: 0.014465
366000 -- (-856.846) [-857.667] (-858.742) (-858.929) * (-856.869) (-865.489) [-858.906] (-857.419) -- 0:02:06
367000 -- (-861.357) (-866.064) (-860.241) [-858.070] * (-863.141) [-862.166] (-868.718) (-861.587) -- 0:02:05
368000 -- [-861.952] (-859.665) (-862.632) (-863.316) * [-856.561] (-863.482) (-863.900) (-858.661) -- 0:02:05
369000 -- (-857.804) (-873.298) [-859.636] (-859.537) * [-857.360] (-875.185) (-861.997) (-864.693) -- 0:02:06
370000 -- (-861.761) (-858.722) (-861.449) [-862.241] * [-859.067] (-858.154) (-858.804) (-865.141) -- 0:02:06
Average standard deviation of split frequencies: 0.013696
371000 -- (-861.577) (-862.922) (-867.262) [-853.839] * (-860.405) (-858.055) (-863.271) [-859.816] -- 0:02:05
372000 -- (-870.856) (-863.937) [-854.646] (-858.096) * (-861.076) (-867.196) [-857.224] (-863.342) -- 0:02:04
373000 -- (-863.663) (-859.757) [-861.012] (-856.680) * [-857.435] (-860.501) (-862.641) (-861.262) -- 0:02:04
374000 -- (-858.885) [-853.283] (-864.527) (-857.806) * (-855.372) (-864.855) (-854.184) [-857.715] -- 0:02:05
375000 -- (-858.802) [-858.905] (-862.908) (-859.698) * (-860.583) (-859.522) [-859.294] (-854.409) -- 0:02:05
Average standard deviation of split frequencies: 0.013309
376000 -- (-858.542) (-853.858) [-860.133] (-856.147) * (-854.098) (-859.402) (-867.824) [-856.833] -- 0:02:04
377000 -- (-860.652) [-867.044] (-859.396) (-866.087) * [-852.856] (-853.791) (-860.452) (-856.789) -- 0:02:03
378000 -- (-857.924) (-858.954) (-860.711) [-862.119] * (-862.797) (-856.490) [-861.817] (-861.848) -- 0:02:03
379000 -- (-861.761) (-874.766) (-861.376) [-858.582] * [-857.346] (-863.934) (-861.128) (-859.683) -- 0:02:04
380000 -- (-866.658) (-862.109) (-862.244) [-855.935] * (-859.955) (-860.268) [-854.402] (-860.894) -- 0:02:04
Average standard deviation of split frequencies: 0.014098
381000 -- (-863.032) (-869.055) [-855.576] (-856.064) * (-862.237) (-865.342) [-855.521] (-865.229) -- 0:02:03
382000 -- (-856.344) (-875.843) [-853.850] (-854.773) * [-858.901] (-855.449) (-855.868) (-861.179) -- 0:02:02
383000 -- (-866.167) (-867.934) (-858.709) [-855.981] * (-853.821) [-855.301] (-862.910) (-855.734) -- 0:02:02
384000 -- (-870.923) (-867.225) (-860.972) [-856.547] * (-856.893) [-856.378] (-865.882) (-863.026) -- 0:02:03
385000 -- (-863.271) [-858.274] (-862.993) (-858.315) * (-860.804) [-851.755] (-856.801) (-859.176) -- 0:02:03
Average standard deviation of split frequencies: 0.013904
386000 -- (-874.043) (-862.261) (-862.147) [-853.809] * [-861.676] (-860.768) (-866.486) (-859.192) -- 0:02:02
387000 -- (-862.226) (-870.011) (-854.492) [-858.500] * (-858.612) [-860.588] (-870.069) (-865.500) -- 0:02:01
388000 -- (-864.598) (-866.062) [-862.151] (-859.437) * (-862.917) (-864.367) (-862.547) [-857.930] -- 0:02:01
389000 -- [-860.410] (-859.541) (-854.652) (-862.218) * [-859.589] (-861.713) (-869.619) (-859.825) -- 0:02:02
390000 -- (-863.026) (-854.451) (-862.149) [-862.915] * (-859.571) (-861.912) [-860.089] (-859.670) -- 0:02:02
Average standard deviation of split frequencies: 0.013552
391000 -- (-864.958) [-859.198] (-860.925) (-857.050) * (-859.847) [-853.690] (-873.957) (-859.721) -- 0:02:01
392000 -- (-868.131) [-858.068] (-860.283) (-859.413) * (-861.374) (-859.123) [-860.098] (-858.448) -- 0:02:00
393000 -- (-858.528) (-863.064) [-859.756] (-860.640) * (-857.333) [-861.144] (-867.918) (-854.143) -- 0:02:00
394000 -- [-857.652] (-861.846) (-869.203) (-865.744) * [-862.251] (-856.060) (-864.059) (-862.136) -- 0:02:01
395000 -- (-870.655) (-862.779) [-851.642] (-869.704) * (-860.759) (-857.559) [-859.457] (-866.021) -- 0:02:01
Average standard deviation of split frequencies: 0.013552
396000 -- (-864.597) [-858.899] (-861.233) (-866.895) * [-862.255] (-855.343) (-866.135) (-854.424) -- 0:02:00
397000 -- (-865.365) [-854.305] (-859.514) (-859.188) * (-860.672) [-860.102] (-870.441) (-860.463) -- 0:01:59
398000 -- (-866.119) [-854.490] (-867.396) (-860.455) * (-862.326) (-863.431) (-865.609) [-863.482] -- 0:01:59
399000 -- (-872.238) (-856.564) (-864.822) [-855.814] * [-858.413] (-861.566) (-865.340) (-854.412) -- 0:02:00
400000 -- (-867.039) (-857.415) [-859.060] (-869.050) * (-860.048) (-859.744) (-860.936) [-856.238] -- 0:02:00
Average standard deviation of split frequencies: 0.013757
401000 -- [-855.995] (-868.229) (-859.972) (-862.361) * (-863.955) (-860.786) [-856.496] (-851.552) -- 0:01:59
402000 -- (-861.569) [-856.329] (-873.824) (-858.842) * (-860.636) [-857.399] (-863.108) (-859.199) -- 0:01:59
403000 -- (-856.266) (-861.450) [-853.175] (-862.374) * (-857.577) [-861.751] (-866.103) (-857.660) -- 0:01:58
404000 -- (-862.889) [-856.965] (-863.426) (-859.623) * (-857.526) [-854.952] (-861.707) (-856.369) -- 0:01:59
405000 -- (-859.382) (-863.738) [-857.177] (-863.470) * [-855.677] (-859.709) (-864.192) (-857.376) -- 0:01:59
Average standard deviation of split frequencies: 0.012861
406000 -- (-864.155) [-858.222] (-858.630) (-865.569) * (-862.064) (-870.528) (-859.561) [-857.943] -- 0:01:58
407000 -- [-854.791] (-857.542) (-860.124) (-871.071) * (-853.681) (-859.387) [-860.414] (-853.637) -- 0:01:58
408000 -- [-860.149] (-865.701) (-857.140) (-857.615) * [-854.077] (-867.389) (-862.820) (-857.010) -- 0:01:57
409000 -- [-857.078] (-864.734) (-862.669) (-872.519) * [-858.846] (-862.530) (-861.203) (-859.671) -- 0:01:58
410000 -- [-856.282] (-865.223) (-862.960) (-854.413) * (-865.678) (-860.008) (-868.427) [-857.082] -- 0:01:58
Average standard deviation of split frequencies: 0.012009
411000 -- [-858.471] (-859.103) (-867.227) (-857.202) * (-862.571) (-857.009) (-861.729) [-853.323] -- 0:01:57
412000 -- (-863.794) (-861.533) [-858.026] (-860.481) * (-862.074) (-857.098) (-857.217) [-859.605] -- 0:01:57
413000 -- [-854.049] (-861.873) (-856.489) (-860.935) * (-860.501) [-862.029] (-860.089) (-864.212) -- 0:01:56
414000 -- (-859.641) (-857.073) [-858.819] (-863.798) * [-856.932] (-859.252) (-857.158) (-862.909) -- 0:01:57
415000 -- [-859.611] (-859.861) (-862.851) (-868.663) * (-868.785) (-861.826) (-857.039) [-857.116] -- 0:01:57
Average standard deviation of split frequencies: 0.012378
416000 -- (-860.427) [-854.440] (-861.717) (-867.928) * (-861.035) [-857.617] (-862.316) (-860.653) -- 0:01:56
417000 -- (-859.006) (-861.094) [-862.564] (-860.442) * [-859.054] (-856.830) (-863.892) (-854.911) -- 0:01:56
418000 -- [-857.681] (-858.381) (-859.026) (-857.916) * [-860.057] (-864.118) (-864.618) (-854.503) -- 0:01:55
419000 -- (-856.435) (-860.273) [-859.832] (-859.244) * [-856.624] (-861.293) (-860.325) (-860.868) -- 0:01:56
420000 -- (-862.513) [-861.939] (-868.145) (-857.886) * (-864.272) (-863.437) [-856.056] (-854.043) -- 0:01:56
Average standard deviation of split frequencies: 0.012758
421000 -- [-858.627] (-861.911) (-858.507) (-857.496) * (-866.392) [-852.878] (-861.222) (-855.426) -- 0:01:55
422000 -- [-859.487] (-869.900) (-855.571) (-858.324) * [-856.411] (-859.842) (-863.830) (-854.711) -- 0:01:55
423000 -- [-855.860] (-863.702) (-861.674) (-861.372) * (-861.508) (-856.602) (-863.351) [-861.457] -- 0:01:54
424000 -- (-857.122) (-865.386) [-851.782] (-856.955) * (-857.404) [-857.806] (-865.358) (-862.709) -- 0:01:55
425000 -- (-863.176) (-863.252) [-856.013] (-860.203) * (-868.249) (-864.594) [-858.108] (-859.315) -- 0:01:55
Average standard deviation of split frequencies: 0.012939
426000 -- [-863.505] (-852.481) (-862.135) (-858.001) * (-866.182) (-859.492) (-860.726) [-856.750] -- 0:01:54
427000 -- [-864.984] (-863.543) (-864.813) (-868.732) * [-852.857] (-859.919) (-864.260) (-865.130) -- 0:01:54
428000 -- [-855.669] (-857.003) (-867.395) (-856.132) * (-861.045) (-863.739) (-862.004) [-862.086] -- 0:01:53
429000 -- (-859.787) (-860.352) [-861.017] (-863.172) * (-857.081) (-864.294) (-869.085) [-859.057] -- 0:01:54
430000 -- (-861.464) [-860.144] (-858.601) (-861.302) * (-855.316) (-863.697) (-857.811) [-857.388] -- 0:01:54
Average standard deviation of split frequencies: 0.013304
431000 -- (-861.503) [-858.167] (-858.083) (-859.764) * (-857.985) (-866.369) [-855.433] (-869.750) -- 0:01:53
432000 -- (-857.242) (-858.588) [-858.401] (-867.427) * (-862.227) (-862.251) [-853.304] (-860.755) -- 0:01:53
433000 -- (-862.846) [-858.405] (-862.511) (-869.409) * [-857.471] (-859.999) (-856.527) (-868.188) -- 0:01:52
434000 -- (-865.070) [-856.944] (-854.895) (-856.387) * (-853.130) (-859.498) [-860.375] (-866.943) -- 0:01:53
435000 -- (-866.448) (-855.296) (-864.356) [-858.935] * (-860.100) (-861.636) (-861.913) [-853.521] -- 0:01:53
Average standard deviation of split frequencies: 0.012642
436000 -- (-861.934) (-856.944) (-859.547) [-855.864] * [-858.559] (-864.036) (-864.769) (-856.806) -- 0:01:52
437000 -- (-862.229) (-857.888) (-868.359) [-859.029] * (-856.728) (-860.308) (-859.113) [-860.627] -- 0:01:52
438000 -- [-852.458] (-857.128) (-858.792) (-861.565) * (-861.118) [-853.910] (-873.025) (-868.035) -- 0:01:51
439000 -- (-860.281) (-864.594) (-855.827) [-860.736] * (-855.901) [-854.431] (-862.896) (-863.384) -- 0:01:52
440000 -- [-857.462] (-857.360) (-861.646) (-860.827) * (-865.283) (-861.551) (-864.792) [-861.735] -- 0:01:52
Average standard deviation of split frequencies: 0.013002
441000 -- (-861.973) [-863.118] (-863.948) (-861.361) * [-862.564] (-856.450) (-856.545) (-861.216) -- 0:01:51
442000 -- (-858.703) (-859.298) (-863.584) [-853.045] * (-866.870) (-868.043) (-864.361) [-855.264] -- 0:01:51
443000 -- (-860.717) [-862.308] (-863.645) (-859.450) * (-858.492) (-864.042) (-855.454) [-855.325] -- 0:01:50
444000 -- (-861.932) (-858.326) [-857.555] (-855.475) * (-861.439) (-858.668) (-864.583) [-856.313] -- 0:01:51
445000 -- (-858.952) [-858.528] (-853.456) (-861.795) * [-856.525] (-869.101) (-859.086) (-858.508) -- 0:01:51
Average standard deviation of split frequencies: 0.014310
446000 -- (-858.959) (-859.888) [-860.009] (-865.083) * (-865.265) (-859.181) (-873.112) [-852.348] -- 0:01:50
447000 -- [-857.325] (-865.050) (-856.880) (-864.039) * [-862.888] (-863.808) (-860.164) (-859.315) -- 0:01:50
448000 -- (-860.046) [-859.180] (-864.405) (-864.771) * (-858.785) [-860.629] (-864.397) (-859.640) -- 0:01:49
449000 -- (-854.341) (-865.412) [-857.883] (-870.476) * [-863.313] (-863.671) (-863.996) (-859.735) -- 0:01:50
450000 -- (-857.079) (-857.817) (-859.669) [-863.068] * (-859.351) [-855.832] (-864.832) (-862.741) -- 0:01:50
Average standard deviation of split frequencies: 0.014483
451000 -- (-857.554) (-869.372) [-854.754] (-864.046) * [-852.354] (-857.621) (-860.363) (-862.145) -- 0:01:49
452000 -- (-862.217) (-858.082) [-854.979] (-860.019) * [-856.698] (-862.607) (-853.530) (-857.906) -- 0:01:49
453000 -- (-855.967) [-856.970] (-870.374) (-868.183) * (-859.109) (-863.493) [-865.673] (-858.543) -- 0:01:48
454000 -- [-860.585] (-855.949) (-858.066) (-862.562) * (-860.464) (-860.839) (-864.876) [-863.805] -- 0:01:49
455000 -- (-858.909) [-855.599] (-860.617) (-862.508) * (-856.805) [-871.794] (-859.636) (-857.173) -- 0:01:49
Average standard deviation of split frequencies: 0.014473
456000 -- (-857.472) (-865.753) [-856.297] (-866.792) * (-864.883) (-868.502) (-861.151) [-861.040] -- 0:01:48
457000 -- [-862.850] (-862.325) (-862.185) (-863.139) * [-857.277] (-871.659) (-856.925) (-860.405) -- 0:01:48
458000 -- (-859.489) [-860.073] (-863.301) (-862.121) * (-859.418) [-854.237] (-860.500) (-866.416) -- 0:01:47
459000 -- (-862.132) (-855.848) (-863.467) [-855.748] * (-862.356) [-857.539] (-856.519) (-867.014) -- 0:01:48
460000 -- [-872.805] (-865.320) (-863.296) (-859.468) * (-855.490) [-857.515] (-860.270) (-855.338) -- 0:01:48
Average standard deviation of split frequencies: 0.014169
461000 -- (-861.809) (-866.625) [-855.914] (-860.131) * (-858.673) [-857.494] (-861.001) (-855.285) -- 0:01:47
462000 -- (-868.103) (-856.345) (-862.062) [-864.789] * (-866.711) [-861.558] (-859.129) (-866.858) -- 0:01:47
463000 -- (-861.615) (-856.645) [-857.414] (-859.757) * (-859.917) (-864.676) [-859.731] (-859.781) -- 0:01:46
464000 -- (-865.187) (-861.893) (-855.442) [-858.329] * (-863.507) [-860.807] (-859.795) (-857.560) -- 0:01:47
465000 -- (-861.688) (-860.186) (-862.144) [-855.736] * (-867.019) (-861.133) [-862.790] (-871.923) -- 0:01:47
Average standard deviation of split frequencies: 0.014085
466000 -- (-859.384) (-861.387) (-859.051) [-857.750] * (-857.576) (-864.451) (-861.892) [-855.019] -- 0:01:46
467000 -- (-858.492) [-856.487] (-857.319) (-854.304) * [-854.395] (-857.871) (-864.014) (-856.674) -- 0:01:46
468000 -- (-863.810) (-855.286) (-861.732) [-858.335] * (-853.890) [-861.375] (-855.179) (-865.146) -- 0:01:45
469000 -- (-862.753) (-867.082) [-855.022] (-854.453) * (-859.451) [-858.518] (-858.376) (-862.893) -- 0:01:46
470000 -- [-859.209] (-867.612) (-856.538) (-863.542) * (-862.426) [-855.221] (-860.398) (-865.861) -- 0:01:46
Average standard deviation of split frequencies: 0.013406
471000 -- [-861.233] (-857.504) (-858.825) (-864.917) * (-865.162) (-859.832) [-860.275] (-857.885) -- 0:01:45
472000 -- (-866.048) (-862.239) [-854.309] (-862.232) * (-860.482) (-860.592) [-861.373] (-858.277) -- 0:01:45
473000 -- [-858.411] (-854.627) (-858.117) (-856.875) * [-857.559] (-866.709) (-856.396) (-861.300) -- 0:01:44
474000 -- (-859.985) [-858.808] (-856.300) (-863.000) * [-854.502] (-863.911) (-856.767) (-854.516) -- 0:01:45
475000 -- (-857.148) (-859.572) [-859.830] (-859.781) * [-860.315] (-858.966) (-861.245) (-867.453) -- 0:01:45
Average standard deviation of split frequencies: 0.013408
476000 -- (-857.222) (-860.017) [-861.895] (-859.987) * (-860.434) [-867.565] (-858.246) (-859.952) -- 0:01:44
477000 -- [-856.411] (-857.638) (-861.443) (-855.003) * (-860.637) (-866.863) (-856.389) [-857.381] -- 0:01:44
478000 -- (-863.392) (-859.561) (-866.177) [-863.315] * [-859.739] (-863.179) (-859.419) (-861.514) -- 0:01:43
479000 -- (-861.344) (-862.732) [-861.686] (-856.202) * (-860.507) [-865.590] (-860.759) (-870.679) -- 0:01:44
480000 -- (-858.012) (-863.602) [-860.182] (-856.209) * [-859.653] (-877.155) (-860.364) (-863.099) -- 0:01:44
Average standard deviation of split frequencies: 0.012372
481000 -- (-860.984) (-859.734) [-856.402] (-857.281) * (-865.700) (-868.618) (-863.595) [-860.171] -- 0:01:43
482000 -- (-859.890) (-858.750) (-861.152) [-861.723] * [-863.344] (-860.775) (-867.443) (-855.695) -- 0:01:43
483000 -- (-859.508) (-859.970) (-861.095) [-855.050] * (-856.620) (-862.107) [-857.580] (-853.235) -- 0:01:43
484000 -- [-856.505] (-864.252) (-859.051) (-864.972) * (-858.820) [-861.931] (-865.140) (-854.815) -- 0:01:43
485000 -- (-862.472) [-855.516] (-858.364) (-862.312) * (-864.089) (-858.554) (-856.539) [-858.786] -- 0:01:43
Average standard deviation of split frequencies: 0.012162
486000 -- (-859.016) (-859.936) [-858.030] (-872.283) * (-865.054) (-859.416) (-860.551) [-862.744] -- 0:01:42
487000 -- (-861.953) (-854.650) [-863.154] (-860.628) * (-854.552) (-859.838) (-861.506) [-854.628] -- 0:01:42
488000 -- (-857.967) (-863.617) (-856.383) [-859.902] * (-862.656) (-857.055) (-863.848) [-856.318] -- 0:01:42
489000 -- (-856.600) (-861.530) [-860.330] (-868.038) * (-854.873) [-857.596] (-864.246) (-862.127) -- 0:01:42
490000 -- (-872.087) (-862.784) (-859.035) [-866.322] * (-862.062) (-857.481) [-859.546] (-855.360) -- 0:01:42
Average standard deviation of split frequencies: 0.012120
491000 -- (-863.424) (-856.726) (-866.689) [-859.726] * (-856.036) (-861.842) (-864.648) [-856.520] -- 0:01:41
492000 -- [-862.355] (-861.351) (-863.450) (-866.750) * (-858.051) (-859.914) (-859.866) [-862.330] -- 0:01:41
493000 -- (-871.381) [-857.206] (-853.221) (-865.289) * [-856.426] (-857.897) (-864.716) (-857.300) -- 0:01:41
494000 -- [-861.720] (-862.275) (-860.833) (-862.960) * (-867.875) (-869.418) (-861.465) [-864.008] -- 0:01:41
495000 -- (-866.069) (-862.248) (-859.548) [-856.881] * (-865.085) (-861.493) (-858.561) [-853.365] -- 0:01:41
Average standard deviation of split frequencies: 0.011624
496000 -- (-856.692) (-863.259) [-859.117] (-856.120) * [-859.151] (-865.257) (-859.471) (-858.128) -- 0:01:40
497000 -- [-861.727] (-855.420) (-864.170) (-860.429) * (-860.780) (-858.118) [-856.169] (-857.489) -- 0:01:40
498000 -- [-862.407] (-861.118) (-854.065) (-858.219) * (-868.921) (-858.308) [-856.033] (-856.820) -- 0:01:39
499000 -- [-857.074] (-858.519) (-854.837) (-857.268) * (-855.620) [-865.500] (-864.341) (-859.626) -- 0:01:40
500000 -- (-855.197) (-864.489) (-860.573) [-858.057] * [-857.629] (-855.701) (-856.895) (-863.859) -- 0:01:40
Average standard deviation of split frequencies: 0.011516
501000 -- (-860.916) (-869.769) (-867.083) [-855.045] * (-869.508) (-858.858) [-860.429] (-861.200) -- 0:01:39
502000 -- (-858.515) (-859.282) (-854.919) [-851.638] * [-858.278] (-872.914) (-864.244) (-859.986) -- 0:01:39
503000 -- (-855.172) (-862.938) [-854.733] (-861.190) * (-863.811) [-859.668] (-858.444) (-861.399) -- 0:01:38
504000 -- [-852.875] (-855.136) (-862.960) (-868.947) * (-866.338) [-861.848] (-856.587) (-856.048) -- 0:01:39
505000 -- (-858.055) (-863.944) (-862.568) [-857.003] * (-864.655) (-861.538) (-861.883) [-863.400] -- 0:01:39
Average standard deviation of split frequencies: 0.011753
506000 -- (-857.402) [-856.998] (-855.731) (-865.716) * (-852.693) (-856.263) [-860.031] (-854.199) -- 0:01:38
507000 -- (-868.537) [-854.577] (-864.995) (-864.368) * (-857.817) (-856.552) [-858.573] (-859.930) -- 0:01:38
508000 -- (-857.495) [-858.393] (-858.757) (-859.121) * (-860.254) (-860.621) [-865.805] (-854.999) -- 0:01:37
509000 -- (-863.174) (-859.520) (-859.061) [-853.552] * [-858.997] (-860.162) (-861.961) (-854.078) -- 0:01:38
510000 -- (-853.819) (-863.501) (-857.243) [-856.600] * [-865.371] (-859.251) (-858.496) (-859.208) -- 0:01:38
Average standard deviation of split frequencies: 0.010651
511000 -- (-863.013) (-866.080) [-853.452] (-857.773) * (-858.071) (-862.613) [-856.635] (-854.810) -- 0:01:37
512000 -- [-859.361] (-860.610) (-857.307) (-857.577) * (-860.570) (-859.370) [-859.503] (-863.866) -- 0:01:37
513000 -- [-861.561] (-855.711) (-857.959) (-855.754) * (-862.884) (-858.381) (-858.077) [-859.573] -- 0:01:37
514000 -- (-861.106) [-856.047] (-863.423) (-858.235) * (-863.555) [-853.576] (-858.693) (-858.566) -- 0:01:37
515000 -- (-858.581) [-855.226] (-862.351) (-863.316) * [-859.684] (-860.603) (-857.141) (-863.595) -- 0:01:37
Average standard deviation of split frequencies: 0.010471
516000 -- (-866.587) [-855.284] (-865.046) (-855.670) * (-862.208) (-862.380) [-857.323] (-864.644) -- 0:01:36
517000 -- [-861.068] (-859.263) (-859.533) (-859.052) * [-857.853] (-856.386) (-859.134) (-866.646) -- 0:01:36
518000 -- (-865.825) [-859.533] (-862.410) (-874.143) * (-859.155) (-865.855) (-859.679) [-859.449] -- 0:01:36
519000 -- (-874.631) (-858.130) [-853.004] (-859.793) * (-858.897) (-856.797) (-859.953) [-857.929] -- 0:01:36
520000 -- (-858.494) (-854.651) [-856.098] (-856.760) * [-858.440] (-857.309) (-866.711) (-855.789) -- 0:01:36
Average standard deviation of split frequencies: 0.011213
521000 -- (-874.078) (-860.028) [-853.727] (-858.924) * (-861.224) [-866.663] (-856.758) (-860.191) -- 0:01:35
522000 -- (-864.993) (-859.174) (-862.820) [-855.390] * (-859.973) [-858.092] (-857.097) (-867.538) -- 0:01:35
523000 -- (-864.618) (-860.327) [-858.539] (-862.040) * (-860.277) (-868.887) (-856.480) [-857.672] -- 0:01:35
524000 -- (-857.538) (-860.205) [-850.602] (-863.080) * [-858.307] (-865.908) (-858.118) (-859.753) -- 0:01:35
525000 -- [-858.381] (-858.147) (-859.599) (-869.512) * (-866.005) (-861.591) (-857.111) [-860.929] -- 0:01:35
Average standard deviation of split frequencies: 0.011513
526000 -- (-856.660) (-864.443) (-858.858) [-860.435] * (-854.854) (-856.491) (-861.192) [-857.377] -- 0:01:34
527000 -- (-866.894) (-859.796) (-860.172) [-854.270] * (-866.887) (-855.140) (-858.566) [-857.456] -- 0:01:34
528000 -- (-855.630) [-856.477] (-865.427) (-861.794) * (-857.969) (-859.219) [-861.336] (-865.892) -- 0:01:34
529000 -- (-866.561) (-865.284) (-861.282) [-856.578] * (-853.981) [-858.701] (-856.013) (-864.868) -- 0:01:34
530000 -- (-864.833) (-857.714) (-863.971) [-855.029] * (-856.673) (-864.808) [-857.215] (-853.921) -- 0:01:34
Average standard deviation of split frequencies: 0.010523
531000 -- (-860.343) (-859.094) (-861.747) [-859.253] * (-860.850) (-858.835) [-864.640] (-863.593) -- 0:01:33
532000 -- (-864.282) (-858.421) (-868.018) [-854.723] * [-856.157] (-869.773) (-859.559) (-863.506) -- 0:01:33
533000 -- (-864.057) (-862.264) (-868.912) [-859.124] * (-873.808) [-854.601] (-862.367) (-854.180) -- 0:01:33
534000 -- [-852.047] (-856.603) (-860.640) (-860.842) * [-855.750] (-861.365) (-854.663) (-856.984) -- 0:01:33
535000 -- (-859.274) [-863.894] (-860.668) (-857.734) * (-855.422) [-856.496] (-859.497) (-858.612) -- 0:01:33
Average standard deviation of split frequencies: 0.010757
536000 -- (-861.696) (-867.355) [-859.436] (-864.290) * [-858.914] (-872.485) (-856.945) (-863.039) -- 0:01:32
537000 -- [-858.824] (-860.696) (-861.729) (-865.920) * (-864.447) [-855.828] (-860.949) (-859.335) -- 0:01:32
538000 -- (-855.148) (-858.495) [-864.320] (-862.343) * (-866.818) [-854.070] (-860.262) (-857.954) -- 0:01:32
539000 -- [-859.812] (-858.727) (-856.000) (-856.541) * (-867.046) [-855.505] (-863.197) (-864.647) -- 0:01:32
540000 -- [-860.124] (-869.943) (-856.847) (-855.158) * (-864.972) [-858.431] (-862.618) (-860.931) -- 0:01:32
Average standard deviation of split frequencies: 0.010999
541000 -- [-858.840] (-861.693) (-861.152) (-867.296) * (-857.060) (-857.793) (-854.518) [-866.193] -- 0:01:31
542000 -- [-858.101] (-868.770) (-856.640) (-856.080) * (-862.175) (-863.289) [-855.555] (-859.210) -- 0:01:31
543000 -- (-853.914) (-868.109) [-856.839] (-859.128) * (-860.597) (-855.490) (-862.716) [-859.370] -- 0:01:31
544000 -- (-864.453) [-852.994] (-862.067) (-859.766) * (-866.036) [-856.248] (-864.062) (-858.588) -- 0:01:31
545000 -- (-859.557) (-856.293) (-862.609) [-860.834] * (-861.213) [-860.180] (-863.463) (-859.070) -- 0:01:31
Average standard deviation of split frequencies: 0.011158
546000 -- [-855.221] (-857.330) (-864.072) (-864.272) * (-860.795) [-856.131] (-858.038) (-862.071) -- 0:01:30
547000 -- (-863.515) (-864.286) (-856.182) [-860.193] * (-860.192) (-857.863) (-863.207) [-854.994] -- 0:01:30
548000 -- (-860.477) (-857.718) [-861.038] (-855.312) * (-861.295) (-862.264) (-863.319) [-861.080] -- 0:01:30
549000 -- (-859.793) [-858.674] (-858.088) (-859.077) * (-857.916) [-856.295] (-860.943) (-854.205) -- 0:01:30
550000 -- (-863.994) (-863.694) [-859.061] (-860.230) * (-859.962) (-864.343) (-857.551) [-855.603] -- 0:01:30
Average standard deviation of split frequencies: 0.011195
551000 -- (-866.585) (-858.742) [-863.644] (-860.916) * (-863.080) [-859.321] (-860.827) (-870.812) -- 0:01:29
552000 -- [-853.734] (-865.244) (-860.624) (-862.134) * [-853.731] (-857.782) (-855.333) (-857.247) -- 0:01:29
553000 -- (-855.852) (-868.684) [-862.466] (-864.864) * [-856.931] (-862.610) (-864.703) (-863.401) -- 0:01:29
554000 -- (-859.219) (-859.432) [-853.320] (-863.628) * (-859.442) (-857.834) [-852.653] (-862.399) -- 0:01:29
555000 -- (-864.504) (-858.027) [-856.610] (-856.000) * (-858.170) (-864.140) (-855.960) [-860.226] -- 0:01:29
Average standard deviation of split frequencies: 0.011087
556000 -- (-867.264) (-859.514) [-857.831] (-853.521) * [-857.330] (-855.419) (-859.561) (-864.341) -- 0:01:28
557000 -- (-865.155) (-860.403) [-854.843] (-858.168) * (-858.523) [-857.112] (-864.921) (-862.055) -- 0:01:28
558000 -- (-861.546) [-858.940] (-858.319) (-863.222) * (-857.321) [-859.448] (-860.599) (-862.917) -- 0:01:28
559000 -- [-858.659] (-860.342) (-864.512) (-856.290) * [-858.652] (-859.161) (-856.984) (-861.684) -- 0:01:28
560000 -- [-859.869] (-860.687) (-859.955) (-862.466) * (-860.675) (-859.764) (-856.936) [-859.754] -- 0:01:28
Average standard deviation of split frequencies: 0.011254
561000 -- (-856.926) (-855.190) (-857.421) [-854.955] * (-861.650) [-856.144] (-861.902) (-857.310) -- 0:01:27
562000 -- [-859.516] (-866.169) (-868.133) (-865.164) * (-855.671) [-853.088] (-852.096) (-873.173) -- 0:01:27
563000 -- (-861.072) [-860.933] (-861.997) (-856.941) * (-862.150) [-857.089] (-855.230) (-861.684) -- 0:01:27
564000 -- (-855.162) (-867.481) [-855.502] (-852.740) * (-860.508) (-866.262) [-853.238] (-870.572) -- 0:01:27
565000 -- (-856.179) (-858.811) [-860.177] (-854.799) * [-854.484] (-857.841) (-858.992) (-867.411) -- 0:01:27
Average standard deviation of split frequencies: 0.010827
566000 -- (-862.920) [-855.581] (-865.571) (-865.040) * [-854.421] (-862.841) (-858.637) (-855.225) -- 0:01:26
567000 -- (-861.984) (-857.625) (-865.830) [-855.989] * (-863.542) (-854.906) (-859.718) [-856.702] -- 0:01:26
568000 -- (-858.094) (-855.542) (-861.319) [-854.361] * (-859.919) [-857.088] (-863.454) (-871.506) -- 0:01:26
569000 -- (-864.252) (-866.277) (-866.482) [-854.715] * (-866.565) [-856.134] (-856.256) (-859.477) -- 0:01:26
570000 -- (-857.414) (-853.672) [-856.380] (-857.270) * (-862.067) (-866.888) (-861.540) [-858.035] -- 0:01:26
Average standard deviation of split frequencies: 0.010485
571000 -- [-857.106] (-860.186) (-856.195) (-869.161) * (-854.842) (-858.054) (-873.283) [-860.608] -- 0:01:25
572000 -- [-856.782] (-871.091) (-859.798) (-855.346) * (-859.140) (-857.326) (-861.473) [-860.479] -- 0:01:25
573000 -- [-864.600] (-859.524) (-853.533) (-867.227) * (-865.486) [-853.433] (-864.644) (-865.089) -- 0:01:25
574000 -- [-861.546] (-857.447) (-867.173) (-877.702) * (-858.082) (-859.211) (-863.159) [-857.487] -- 0:01:25
575000 -- (-856.465) (-858.745) [-856.358] (-861.680) * [-853.212] (-858.879) (-860.238) (-865.131) -- 0:01:25
Average standard deviation of split frequencies: 0.010891
576000 -- (-858.166) (-854.337) [-860.669] (-859.685) * (-859.596) (-861.982) (-858.790) [-856.430] -- 0:01:24
577000 -- [-857.011] (-857.765) (-855.964) (-858.777) * [-853.813] (-854.918) (-863.201) (-858.228) -- 0:01:25
578000 -- (-851.063) (-860.526) (-870.581) [-858.887] * (-861.495) (-857.396) (-863.122) [-860.811] -- 0:01:24
579000 -- (-852.334) [-857.150] (-859.196) (-862.038) * (-859.315) (-867.587) [-857.761] (-864.235) -- 0:01:24
580000 -- (-856.235) [-858.641] (-859.307) (-865.151) * (-860.228) (-857.015) [-863.839] (-857.133) -- 0:01:24
Average standard deviation of split frequencies: 0.011116
581000 -- (-868.814) [-857.723] (-854.377) (-858.658) * [-859.499] (-857.435) (-863.683) (-858.819) -- 0:01:23
582000 -- [-853.891] (-869.084) (-860.243) (-861.564) * (-858.718) [-854.132] (-859.538) (-861.876) -- 0:01:24
583000 -- (-858.054) [-857.793] (-858.248) (-856.277) * (-869.997) (-864.104) (-855.703) [-859.368] -- 0:01:23
584000 -- (-863.315) (-856.735) [-860.331] (-860.134) * (-855.619) (-867.261) (-862.969) [-858.176] -- 0:01:23
585000 -- (-867.864) (-860.889) [-864.133] (-857.434) * (-857.420) [-852.912] (-870.087) (-870.925) -- 0:01:23
Average standard deviation of split frequencies: 0.011262
586000 -- (-867.072) (-853.224) (-862.283) [-859.840] * (-862.764) (-859.324) (-868.789) [-859.613] -- 0:01:22
587000 -- [-859.755] (-858.267) (-870.406) (-867.150) * (-864.187) (-856.193) (-864.244) [-856.423] -- 0:01:23
588000 -- (-861.395) (-854.756) [-855.028] (-857.812) * [-862.348] (-862.161) (-853.823) (-857.967) -- 0:01:22
589000 -- (-871.000) (-860.454) [-854.880] (-858.894) * (-859.712) [-856.847] (-861.805) (-855.903) -- 0:01:22
590000 -- (-862.613) (-858.188) (-864.322) [-854.445] * (-861.387) [-855.635] (-859.305) (-860.141) -- 0:01:22
Average standard deviation of split frequencies: 0.011296
591000 -- (-853.954) (-855.825) (-860.244) [-854.005] * (-855.338) [-857.477] (-862.280) (-853.530) -- 0:01:21
592000 -- [-857.461] (-858.918) (-856.044) (-861.386) * (-860.319) [-855.358] (-863.586) (-858.210) -- 0:01:22
593000 -- (-857.481) (-856.516) [-859.079] (-858.400) * (-861.390) (-862.523) (-863.062) [-855.314] -- 0:01:21
594000 -- (-857.802) (-859.173) (-860.789) [-858.078] * [-854.800] (-869.787) (-864.553) (-854.896) -- 0:01:21
595000 -- (-862.634) (-855.656) [-859.908] (-860.857) * [-856.538] (-867.264) (-865.810) (-862.349) -- 0:01:21
Average standard deviation of split frequencies: 0.012533
596000 -- (-858.755) (-854.688) (-880.106) [-857.891] * (-854.933) (-859.090) (-864.336) [-866.087] -- 0:01:20
597000 -- (-862.620) (-865.555) (-858.449) [-863.572] * [-872.375] (-861.211) (-869.778) (-867.520) -- 0:01:21
598000 -- [-855.719] (-862.268) (-862.941) (-857.845) * [-855.895] (-855.025) (-862.611) (-866.092) -- 0:01:20
599000 -- (-858.676) [-859.710] (-861.353) (-860.165) * (-858.330) (-859.921) (-865.008) [-864.463] -- 0:01:20
600000 -- (-859.853) (-857.666) [-858.314] (-867.225) * (-864.076) (-856.333) [-854.465] (-863.934) -- 0:01:20
Average standard deviation of split frequencies: 0.012074
601000 -- [-856.553] (-867.423) (-862.416) (-858.115) * (-860.205) [-858.190] (-863.112) (-857.521) -- 0:01:19
602000 -- (-862.003) [-860.532] (-867.368) (-862.391) * (-859.338) [-856.860] (-862.172) (-862.948) -- 0:01:19
603000 -- (-861.443) (-859.089) [-857.561] (-860.617) * (-859.817) (-861.509) (-857.654) [-858.327] -- 0:01:19
604000 -- [-854.546] (-872.796) (-857.349) (-871.699) * [-868.385] (-854.668) (-858.898) (-856.788) -- 0:01:19
605000 -- [-864.119] (-862.760) (-859.227) (-860.573) * (-862.100) (-859.822) [-861.823] (-856.662) -- 0:01:19
Average standard deviation of split frequencies: 0.012566
606000 -- [-854.269] (-862.131) (-860.744) (-862.150) * (-856.869) (-861.051) [-855.550] (-865.994) -- 0:01:18
607000 -- (-858.567) (-861.958) (-858.006) [-864.008] * (-857.399) (-867.968) (-863.744) [-857.998] -- 0:01:18
608000 -- (-861.724) [-865.489] (-863.276) (-870.417) * [-857.305] (-857.915) (-868.711) (-857.240) -- 0:01:18
609000 -- (-861.392) (-860.397) [-859.315] (-878.947) * (-857.403) (-854.344) (-852.363) [-853.444] -- 0:01:18
610000 -- [-859.204] (-854.643) (-855.821) (-865.945) * [-857.942] (-865.301) (-865.159) (-868.276) -- 0:01:18
Average standard deviation of split frequencies: 0.012945
611000 -- (-854.990) (-861.028) [-854.796] (-870.791) * (-862.408) (-855.287) (-866.128) [-851.390] -- 0:01:17
612000 -- (-857.777) (-855.224) [-859.494] (-865.525) * (-859.361) (-860.851) [-861.431] (-859.798) -- 0:01:17
613000 -- (-860.161) (-852.677) [-853.748] (-857.594) * (-855.227) [-860.211] (-858.747) (-858.689) -- 0:01:17
614000 -- (-859.999) (-866.761) [-854.920] (-859.834) * [-860.023] (-852.809) (-863.842) (-858.022) -- 0:01:17
615000 -- (-858.818) (-858.640) (-865.348) [-864.310] * (-862.746) (-861.800) (-860.767) [-858.617] -- 0:01:17
Average standard deviation of split frequencies: 0.013186
616000 -- (-856.688) (-867.208) [-859.586] (-854.585) * (-860.692) (-868.137) [-858.122] (-855.976) -- 0:01:16
617000 -- [-855.443] (-862.355) (-861.524) (-862.048) * (-861.244) (-859.664) (-867.487) [-854.555] -- 0:01:16
618000 -- (-869.503) (-862.991) [-862.449] (-860.548) * (-863.888) (-861.926) [-861.842] (-860.800) -- 0:01:16
619000 -- (-859.859) (-859.301) [-856.415] (-857.524) * (-855.300) (-863.487) [-856.760] (-870.453) -- 0:01:16
620000 -- (-859.172) (-853.377) (-862.995) [-854.480] * [-854.342] (-865.640) (-859.010) (-860.525) -- 0:01:16
Average standard deviation of split frequencies: 0.012970
621000 -- (-868.262) (-856.035) [-859.968] (-864.031) * (-856.561) (-864.603) [-857.630] (-856.738) -- 0:01:15
622000 -- [-861.867] (-866.260) (-861.010) (-862.562) * (-864.023) (-862.897) [-867.587] (-858.990) -- 0:01:15
623000 -- (-857.614) (-860.202) (-867.170) [-857.462] * (-859.541) (-856.658) [-858.116] (-863.659) -- 0:01:15
624000 -- (-863.742) (-858.726) (-855.884) [-859.233] * (-855.757) [-853.870] (-857.161) (-856.782) -- 0:01:15
625000 -- (-861.918) (-857.180) [-858.497] (-864.862) * (-860.328) [-857.237] (-858.920) (-865.280) -- 0:01:15
Average standard deviation of split frequencies: 0.012860
626000 -- (-867.559) [-855.455] (-859.831) (-862.757) * [-854.601] (-858.391) (-855.401) (-863.781) -- 0:01:14
627000 -- [-860.380] (-858.586) (-865.293) (-863.782) * [-852.052] (-858.501) (-858.416) (-859.907) -- 0:01:14
628000 -- [-854.692] (-856.511) (-865.022) (-864.112) * [-856.852] (-860.401) (-862.322) (-864.153) -- 0:01:14
629000 -- (-856.942) (-852.055) (-862.930) [-860.345] * (-853.684) [-854.629] (-865.579) (-860.912) -- 0:01:14
630000 -- [-859.250] (-853.889) (-868.478) (-861.621) * (-860.162) (-862.629) [-857.016] (-854.664) -- 0:01:14
Average standard deviation of split frequencies: 0.013109
631000 -- (-858.423) (-861.163) (-866.105) [-854.631] * (-861.713) (-869.113) [-852.042] (-860.884) -- 0:01:13
632000 -- (-860.611) (-859.189) [-856.027] (-868.516) * (-872.907) (-864.981) [-861.584] (-863.199) -- 0:01:13
633000 -- (-858.167) (-856.800) (-864.550) [-860.795] * (-863.253) (-858.873) (-870.059) [-861.758] -- 0:01:13
634000 -- (-863.726) [-861.372] (-859.444) (-859.872) * (-858.179) (-860.495) [-863.737] (-861.021) -- 0:01:13
635000 -- [-856.664] (-863.465) (-865.840) (-861.524) * (-862.294) [-860.932] (-862.496) (-858.152) -- 0:01:13
Average standard deviation of split frequencies: 0.013342
636000 -- (-860.933) [-855.581] (-859.845) (-864.981) * (-861.234) (-867.629) (-860.753) [-854.113] -- 0:01:12
637000 -- (-858.528) [-855.975] (-865.328) (-862.531) * [-855.667] (-862.080) (-862.685) (-859.705) -- 0:01:12
638000 -- (-856.126) [-860.169] (-864.340) (-869.788) * (-864.288) (-862.025) [-853.875] (-857.744) -- 0:01:12
639000 -- (-870.002) (-864.418) [-858.355] (-860.741) * (-856.910) (-861.471) (-862.298) [-857.367] -- 0:01:12
640000 -- (-862.725) (-853.019) [-857.948] (-862.361) * [-867.441] (-866.076) (-860.338) (-858.676) -- 0:01:12
Average standard deviation of split frequencies: 0.013018
641000 -- (-862.599) (-862.932) (-861.027) [-861.324] * (-856.602) (-864.183) [-856.463] (-866.552) -- 0:01:11
642000 -- [-862.879] (-855.577) (-866.525) (-861.945) * (-859.130) (-863.728) (-860.479) [-858.906] -- 0:01:11
643000 -- (-859.658) (-860.502) [-867.160] (-861.151) * [-854.689] (-859.246) (-859.419) (-861.439) -- 0:01:11
644000 -- [-859.573] (-865.477) (-859.190) (-861.373) * (-856.435) [-856.844] (-855.827) (-859.255) -- 0:01:11
645000 -- (-863.816) (-862.290) [-862.610] (-859.776) * (-856.921) (-861.896) [-852.850] (-867.193) -- 0:01:11
Average standard deviation of split frequencies: 0.012967
646000 -- (-857.120) (-859.907) (-857.518) [-864.663] * (-864.090) [-854.708] (-859.738) (-863.114) -- 0:01:10
647000 -- (-859.309) (-852.440) (-862.179) [-855.390] * (-867.364) [-858.689] (-861.078) (-868.284) -- 0:01:10
648000 -- (-862.392) (-857.782) [-855.176] (-854.527) * [-856.258] (-858.256) (-857.221) (-859.522) -- 0:01:10
649000 -- (-859.732) (-861.149) (-864.506) [-856.739] * (-858.067) (-860.532) [-856.403] (-864.368) -- 0:01:10
650000 -- (-865.384) (-860.374) [-853.930] (-855.047) * (-865.172) [-862.966] (-858.272) (-856.925) -- 0:01:10
Average standard deviation of split frequencies: 0.013208
651000 -- (-870.799) (-866.780) [-856.566] (-858.503) * (-865.072) (-862.550) (-859.392) [-854.750] -- 0:01:09
652000 -- (-852.645) (-859.786) (-860.275) [-855.501] * (-858.959) (-865.253) [-857.814] (-862.604) -- 0:01:09
653000 -- (-858.702) [-858.996] (-854.047) (-857.711) * (-859.932) [-857.985] (-861.238) (-871.656) -- 0:01:09
654000 -- (-864.819) (-865.953) (-856.668) [-853.289] * (-858.644) [-855.352] (-861.478) (-858.612) -- 0:01:09
655000 -- (-857.528) (-854.492) (-867.680) [-857.554] * (-864.335) [-861.229] (-862.343) (-864.049) -- 0:01:09
Average standard deviation of split frequencies: 0.012658
656000 -- (-855.698) [-862.983] (-861.736) (-869.290) * (-859.908) (-857.422) (-864.757) [-856.364] -- 0:01:08
657000 -- (-865.929) (-866.309) [-868.350] (-858.885) * (-861.874) (-863.126) [-859.383] (-859.899) -- 0:01:08
658000 -- (-857.847) (-859.794) (-867.024) [-857.539] * (-861.616) [-854.015] (-865.206) (-862.155) -- 0:01:08
659000 -- (-866.186) (-856.090) (-858.536) [-871.945] * (-864.668) [-858.115] (-863.691) (-855.179) -- 0:01:08
660000 -- (-857.215) [-862.354] (-862.799) (-864.368) * (-861.368) (-861.913) [-855.034] (-857.014) -- 0:01:08
Average standard deviation of split frequencies: 0.012789
661000 -- (-853.108) (-861.156) (-855.239) [-859.205] * (-859.755) [-859.808] (-867.293) (-860.491) -- 0:01:07
662000 -- (-863.742) (-858.042) [-857.644] (-855.481) * [-859.524] (-865.740) (-861.388) (-853.840) -- 0:01:07
663000 -- (-861.524) (-859.522) (-855.667) [-868.815] * (-855.195) (-860.039) (-865.039) [-857.087] -- 0:01:07
664000 -- [-857.473] (-862.543) (-858.570) (-861.162) * (-853.795) (-861.878) [-862.458] (-856.596) -- 0:01:07
665000 -- (-856.242) (-857.558) [-854.237] (-873.403) * (-860.029) (-863.995) [-862.168] (-857.691) -- 0:01:07
Average standard deviation of split frequencies: 0.012468
666000 -- (-855.346) (-862.268) [-857.710] (-860.125) * (-861.646) (-855.012) [-862.403] (-860.241) -- 0:01:06
667000 -- (-861.790) (-862.669) (-865.449) [-857.999] * [-860.351] (-858.153) (-857.189) (-863.675) -- 0:01:06
668000 -- (-854.287) (-859.072) [-863.131] (-861.894) * (-859.271) (-861.065) [-857.209] (-863.166) -- 0:01:06
669000 -- (-857.760) (-859.723) [-855.288] (-860.120) * [-857.097] (-862.520) (-856.839) (-861.892) -- 0:01:06
670000 -- (-864.915) [-858.599] (-865.311) (-858.567) * (-862.250) (-858.124) (-856.923) [-853.455] -- 0:01:06
Average standard deviation of split frequencies: 0.012165
671000 -- (-861.422) (-858.626) (-858.246) [-862.513] * (-859.749) (-857.871) [-854.281] (-857.166) -- 0:01:05
672000 -- (-862.632) [-862.300] (-857.658) (-868.039) * (-861.435) (-866.136) [-853.755] (-860.052) -- 0:01:05
673000 -- (-860.674) [-862.517] (-865.609) (-860.984) * (-859.323) (-864.292) (-853.842) [-864.930] -- 0:01:05
674000 -- [-861.785] (-859.556) (-860.138) (-859.812) * (-860.444) [-858.424] (-860.094) (-863.684) -- 0:01:05
675000 -- (-852.818) (-861.292) [-859.682] (-857.745) * [-854.552] (-855.943) (-859.939) (-862.572) -- 0:01:05
Average standard deviation of split frequencies: 0.011640
676000 -- [-855.607] (-863.621) (-860.382) (-856.771) * (-855.808) (-855.713) [-854.736] (-860.465) -- 0:01:04
677000 -- (-854.742) (-862.870) (-863.329) [-857.331] * (-861.825) (-863.740) [-856.278] (-862.495) -- 0:01:04
678000 -- [-861.357] (-857.055) (-857.215) (-854.258) * (-856.916) [-857.604] (-856.811) (-859.900) -- 0:01:04
679000 -- (-855.348) (-857.910) (-864.504) [-854.527] * (-855.181) [-859.202] (-860.565) (-860.055) -- 0:01:04
680000 -- [-860.699] (-866.206) (-857.836) (-860.887) * [-856.652] (-859.882) (-861.961) (-860.861) -- 0:01:04
Average standard deviation of split frequencies: 0.011667
681000 -- (-860.189) (-859.077) [-858.779] (-853.855) * (-860.893) (-855.342) [-859.856] (-863.588) -- 0:01:03
682000 -- (-858.164) (-861.821) (-863.464) [-860.128] * (-857.431) (-858.052) [-854.315] (-862.941) -- 0:01:03
683000 -- [-854.957] (-864.510) (-864.118) (-863.719) * (-857.409) [-861.924] (-857.971) (-860.568) -- 0:01:03
684000 -- (-859.092) (-858.588) (-856.385) [-855.998] * (-864.919) (-864.731) [-856.565] (-858.581) -- 0:01:03
685000 -- (-854.727) (-854.253) [-858.122] (-861.467) * (-863.731) [-856.091] (-859.408) (-863.288) -- 0:01:03
Average standard deviation of split frequencies: 0.012316
686000 -- (-854.281) [-861.428] (-865.082) (-860.327) * (-863.227) [-860.335] (-858.207) (-860.527) -- 0:01:02
687000 -- (-862.384) [-863.211] (-854.400) (-862.460) * (-856.977) (-864.630) (-857.863) [-859.024] -- 0:01:02
688000 -- (-864.365) (-856.813) [-862.146] (-856.099) * (-860.917) (-857.855) (-859.998) [-861.822] -- 0:01:02
689000 -- (-858.408) (-860.431) [-861.646] (-853.841) * [-860.699] (-865.856) (-860.314) (-860.823) -- 0:01:02
690000 -- (-856.364) (-859.325) [-860.882] (-856.279) * (-861.532) (-861.618) [-859.605] (-859.618) -- 0:01:02
Average standard deviation of split frequencies: 0.011761
691000 -- (-862.183) [-854.941] (-861.969) (-858.998) * (-873.012) (-865.062) [-853.186] (-859.207) -- 0:01:01
692000 -- [-857.886] (-853.256) (-866.177) (-869.639) * [-856.116] (-858.534) (-860.332) (-855.465) -- 0:01:01
693000 -- [-859.215] (-861.641) (-858.657) (-872.862) * (-870.092) [-856.011] (-859.309) (-860.845) -- 0:01:01
694000 -- [-854.712] (-862.132) (-863.222) (-871.815) * (-860.796) (-857.220) [-862.881] (-858.118) -- 0:01:01
695000 -- (-864.769) (-859.914) [-857.022] (-858.651) * [-854.902] (-860.793) (-868.345) (-860.772) -- 0:01:01
Average standard deviation of split frequencies: 0.012608
696000 -- (-860.929) (-859.993) (-863.836) [-856.187] * [-858.282] (-864.554) (-865.474) (-861.424) -- 0:01:00
697000 -- (-858.765) (-855.965) [-865.978] (-862.700) * (-864.305) [-860.075] (-863.273) (-862.466) -- 0:01:00
698000 -- (-861.576) [-855.359] (-856.297) (-857.909) * (-853.125) [-855.882] (-857.476) (-860.570) -- 0:01:00
699000 -- (-857.736) (-858.785) (-863.391) [-857.866] * [-862.704] (-867.979) (-861.027) (-856.319) -- 0:01:00
700000 -- (-861.271) (-861.799) (-863.794) [-863.388] * (-858.504) (-865.521) [-863.259] (-859.352) -- 0:01:00
Average standard deviation of split frequencies: 0.012317
701000 -- [-858.790] (-857.565) (-859.096) (-856.314) * (-857.073) (-862.926) (-857.088) [-863.426] -- 0:01:00
702000 -- (-855.015) [-857.482] (-862.424) (-862.755) * [-857.238] (-863.536) (-862.127) (-858.454) -- 0:00:59
703000 -- [-856.123] (-866.964) (-851.145) (-865.164) * (-868.184) (-867.889) [-854.879] (-858.406) -- 0:00:59
704000 -- (-861.888) [-858.944] (-853.924) (-855.771) * (-863.790) [-860.145] (-859.046) (-859.758) -- 0:00:59
705000 -- (-863.940) [-859.055] (-857.133) (-856.438) * (-862.746) (-861.216) (-861.892) [-865.360] -- 0:00:59
Average standard deviation of split frequencies: 0.012122
706000 -- [-858.732] (-867.119) (-855.554) (-855.439) * (-864.456) [-858.887] (-867.932) (-859.388) -- 0:00:59
707000 -- (-865.809) [-855.306] (-855.710) (-871.445) * (-857.189) (-864.621) (-859.337) [-857.933] -- 0:00:58
708000 -- (-862.313) (-854.699) (-866.735) [-854.322] * (-858.582) [-859.998] (-856.238) (-865.926) -- 0:00:58
709000 -- (-858.782) (-861.035) (-863.578) [-862.636] * (-855.710) (-862.019) (-854.108) [-859.071] -- 0:00:58
710000 -- (-858.803) (-864.003) [-857.705] (-858.111) * (-858.053) (-862.292) [-855.747] (-860.693) -- 0:00:58
Average standard deviation of split frequencies: 0.012450
711000 -- [-859.863] (-861.253) (-859.464) (-861.926) * [-860.507] (-860.916) (-858.195) (-864.992) -- 0:00:58
712000 -- [-856.709] (-857.545) (-862.001) (-859.816) * (-856.754) [-861.379] (-859.579) (-860.128) -- 0:00:57
713000 -- (-860.311) (-860.614) (-860.386) [-854.945] * (-859.769) (-868.514) (-858.689) [-863.702] -- 0:00:57
714000 -- [-861.043] (-857.981) (-859.342) (-869.188) * (-866.443) [-858.066] (-857.138) (-866.624) -- 0:00:57
715000 -- (-854.751) (-862.007) (-858.791) [-857.932] * (-854.902) (-864.467) (-859.748) [-860.015] -- 0:00:57
Average standard deviation of split frequencies: 0.012357
716000 -- (-865.088) (-855.762) (-863.419) [-858.225] * [-858.503] (-861.568) (-865.063) (-863.262) -- 0:00:57
717000 -- [-864.640] (-855.967) (-867.443) (-865.235) * (-868.968) [-858.224] (-858.718) (-863.125) -- 0:00:56
718000 -- (-863.472) (-856.941) [-854.579] (-854.734) * (-860.427) [-861.176] (-859.803) (-862.473) -- 0:00:56
719000 -- (-874.549) [-858.904] (-861.143) (-862.360) * [-859.888] (-859.662) (-860.546) (-862.457) -- 0:00:56
720000 -- (-869.861) (-862.540) (-855.121) [-858.958] * (-865.141) [-862.938] (-859.618) (-859.947) -- 0:00:56
Average standard deviation of split frequencies: 0.012579
721000 -- (-858.542) (-857.136) [-859.174] (-866.921) * [-858.425] (-870.301) (-859.450) (-859.973) -- 0:00:56
722000 -- (-863.960) [-856.417] (-859.740) (-868.329) * (-860.146) (-862.591) [-857.317] (-857.650) -- 0:00:55
723000 -- [-861.626] (-867.651) (-860.263) (-861.649) * [-859.106] (-862.427) (-861.557) (-854.374) -- 0:00:55
724000 -- (-867.910) (-862.680) [-857.815] (-859.440) * (-857.535) [-865.170] (-860.736) (-871.468) -- 0:00:55
725000 -- (-859.065) (-859.785) [-854.696] (-854.217) * (-860.771) (-866.311) (-862.807) [-854.965] -- 0:00:55
Average standard deviation of split frequencies: 0.013286
726000 -- (-860.252) [-855.435] (-858.168) (-861.940) * (-856.863) (-864.040) [-855.655] (-860.984) -- 0:00:55
727000 -- (-857.372) (-862.853) [-858.108] (-866.607) * (-857.988) [-862.970] (-866.678) (-861.322) -- 0:00:54
728000 -- (-867.004) (-858.868) [-861.356] (-864.629) * [-853.150] (-858.717) (-858.198) (-859.640) -- 0:00:54
729000 -- [-857.199] (-856.459) (-863.091) (-868.324) * (-856.088) (-864.048) (-858.808) [-857.489] -- 0:00:54
730000 -- (-861.944) [-863.852] (-858.025) (-862.077) * (-857.268) (-862.160) [-859.748] (-863.902) -- 0:00:54
Average standard deviation of split frequencies: 0.013201
731000 -- (-860.238) [-861.427] (-862.550) (-867.620) * [-859.465] (-855.813) (-857.269) (-862.110) -- 0:00:54
732000 -- (-859.239) [-860.005] (-858.175) (-859.920) * (-868.083) (-855.052) (-861.416) [-861.423] -- 0:00:53
733000 -- (-857.370) (-857.825) (-860.335) [-858.234] * (-861.212) (-857.696) (-859.519) [-859.647] -- 0:00:53
734000 -- [-857.357] (-855.158) (-853.682) (-858.681) * (-865.585) (-860.384) [-864.094] (-856.659) -- 0:00:53
735000 -- (-860.367) [-857.295] (-856.827) (-862.823) * (-860.443) [-859.098] (-854.068) (-861.824) -- 0:00:53
Average standard deviation of split frequencies: 0.013352
736000 -- (-859.638) (-858.638) (-855.796) [-853.396] * (-864.196) [-857.969] (-858.154) (-862.162) -- 0:00:53
737000 -- [-856.906] (-855.267) (-861.533) (-860.922) * (-865.529) [-858.377] (-865.577) (-853.148) -- 0:00:52
738000 -- [-860.249] (-854.785) (-856.309) (-862.883) * (-861.721) [-852.713] (-863.437) (-858.310) -- 0:00:52
739000 -- (-856.767) (-859.491) (-857.012) [-856.217] * (-863.437) [-862.464] (-859.694) (-869.467) -- 0:00:52
740000 -- (-872.502) (-861.637) (-861.229) [-863.859] * (-857.859) (-866.497) (-855.229) [-857.060] -- 0:00:52
Average standard deviation of split frequencies: 0.013023
741000 -- (-863.806) (-857.652) [-859.694] (-860.179) * (-861.283) (-871.440) [-861.885] (-860.011) -- 0:00:52
742000 -- [-865.263] (-866.807) (-859.639) (-853.127) * (-859.591) (-863.301) (-858.488) [-857.459] -- 0:00:51
743000 -- [-860.760] (-860.689) (-860.529) (-867.968) * (-861.960) (-859.951) [-860.162] (-861.337) -- 0:00:51
744000 -- [-862.085] (-861.159) (-859.309) (-866.443) * (-863.596) (-873.633) [-857.598] (-865.621) -- 0:00:51
745000 -- [-858.389] (-855.956) (-864.734) (-866.112) * (-857.039) (-861.097) (-862.689) [-857.210] -- 0:00:51
Average standard deviation of split frequencies: 0.013319
746000 -- [-860.268] (-864.096) (-862.511) (-857.496) * (-860.823) (-858.243) [-856.350] (-860.916) -- 0:00:51
747000 -- (-856.507) (-861.040) [-861.825] (-860.083) * (-858.428) (-858.635) (-866.736) [-857.113] -- 0:00:50
748000 -- [-854.413] (-855.012) (-868.907) (-860.936) * (-864.849) [-856.014] (-859.980) (-859.847) -- 0:00:50
749000 -- (-856.959) (-857.617) [-859.412] (-866.834) * (-864.211) (-863.426) [-852.757] (-856.291) -- 0:00:50
750000 -- (-856.600) (-864.808) (-860.320) [-858.580] * (-860.739) [-864.638] (-872.330) (-856.444) -- 0:00:50
Average standard deviation of split frequencies: 0.013622
751000 -- (-865.184) (-855.183) [-860.915] (-873.527) * (-857.461) [-855.645] (-855.950) (-867.432) -- 0:00:50
752000 -- (-859.507) (-868.042) [-855.439] (-861.614) * (-863.761) (-863.319) (-858.951) [-860.577] -- 0:00:49
753000 -- (-860.801) [-861.186] (-857.587) (-865.406) * (-854.475) (-859.689) (-863.319) [-857.607] -- 0:00:49
754000 -- (-863.536) (-861.130) (-855.545) [-857.710] * (-863.005) [-855.514] (-862.004) (-856.604) -- 0:00:49
755000 -- [-859.643] (-860.648) (-861.963) (-863.565) * (-859.935) [-862.381] (-864.944) (-856.196) -- 0:00:49
Average standard deviation of split frequencies: 0.013814
756000 -- (-864.402) (-864.458) (-859.422) [-855.889] * [-862.650] (-863.375) (-864.406) (-856.958) -- 0:00:49
757000 -- (-866.051) (-854.457) (-862.023) [-855.631] * [-860.826] (-859.231) (-858.806) (-869.651) -- 0:00:48
758000 -- (-859.145) (-856.537) (-860.814) [-859.490] * (-862.630) (-865.826) [-861.902] (-869.096) -- 0:00:48
759000 -- (-861.858) (-860.593) [-861.522] (-855.753) * (-859.374) (-859.046) (-862.458) [-855.886] -- 0:00:48
760000 -- (-861.600) (-857.764) [-862.551] (-864.545) * (-858.782) (-860.485) (-867.839) [-856.633] -- 0:00:48
Average standard deviation of split frequencies: 0.013062
761000 -- [-853.010] (-862.334) (-861.877) (-855.732) * (-861.036) (-856.725) [-861.150] (-855.466) -- 0:00:48
762000 -- (-852.913) (-864.456) (-863.376) [-860.724] * (-867.652) (-856.468) (-864.496) [-858.219] -- 0:00:47
763000 -- (-856.606) (-858.996) (-861.145) [-853.541] * (-862.939) (-862.208) [-862.402] (-860.301) -- 0:00:47
764000 -- (-862.874) [-857.940] (-861.117) (-862.338) * (-863.249) [-857.840] (-859.914) (-862.839) -- 0:00:47
765000 -- (-866.190) (-865.233) (-853.970) [-852.405] * (-874.439) [-855.976] (-862.976) (-863.211) -- 0:00:47
Average standard deviation of split frequencies: 0.013634
766000 -- (-870.060) (-868.528) [-859.250] (-857.062) * (-864.175) [-858.806] (-861.744) (-861.313) -- 0:00:47
767000 -- [-855.573] (-862.006) (-868.966) (-859.920) * (-860.258) (-857.918) (-857.218) [-856.930] -- 0:00:46
768000 -- (-857.265) [-861.188] (-875.945) (-859.980) * (-863.064) (-862.422) [-857.001] (-863.741) -- 0:00:46
769000 -- (-862.432) (-859.341) [-858.648] (-854.107) * (-867.200) [-859.373] (-859.774) (-859.084) -- 0:00:46
770000 -- [-855.795] (-866.774) (-859.092) (-858.005) * (-859.448) (-860.841) [-857.493] (-857.786) -- 0:00:46
Average standard deviation of split frequencies: 0.013645
771000 -- (-858.454) (-862.710) [-855.617] (-856.671) * [-857.416] (-879.832) (-861.919) (-859.321) -- 0:00:46
772000 -- (-859.667) [-860.245] (-855.961) (-860.442) * [-858.192] (-863.942) (-858.557) (-861.190) -- 0:00:45
773000 -- (-861.206) [-856.439] (-867.130) (-857.708) * (-858.753) (-861.188) [-856.630] (-858.378) -- 0:00:45
774000 -- [-861.402] (-863.652) (-855.788) (-852.215) * (-861.651) [-852.938] (-856.700) (-865.039) -- 0:00:45
775000 -- [-855.482] (-858.708) (-862.548) (-858.691) * (-856.859) (-865.153) (-866.796) [-861.125] -- 0:00:45
Average standard deviation of split frequencies: 0.013084
776000 -- (-860.674) (-865.881) [-862.805] (-856.045) * [-864.771] (-854.143) (-859.132) (-865.273) -- 0:00:45
777000 -- (-857.676) [-859.359] (-868.699) (-863.510) * (-856.811) (-863.104) (-870.121) [-855.255] -- 0:00:44
778000 -- (-870.063) (-860.541) (-855.942) [-860.460] * (-858.389) (-859.523) (-862.880) [-852.309] -- 0:00:44
779000 -- (-862.195) (-855.852) [-855.457] (-860.421) * (-863.963) (-864.240) [-857.813] (-854.151) -- 0:00:44
780000 -- (-862.721) [-855.756] (-856.327) (-859.527) * (-862.635) (-865.656) [-854.747] (-863.277) -- 0:00:44
Average standard deviation of split frequencies: 0.013517
781000 -- (-857.428) (-859.437) (-852.820) [-861.050] * [-852.804] (-863.550) (-862.970) (-858.417) -- 0:00:44
782000 -- (-862.527) [-858.703] (-856.693) (-858.733) * (-860.153) (-864.636) [-852.476] (-862.919) -- 0:00:43
783000 -- [-858.970] (-856.563) (-861.587) (-862.400) * [-861.099] (-867.180) (-860.319) (-858.469) -- 0:00:43
784000 -- [-860.574] (-861.919) (-853.442) (-862.358) * (-865.166) [-851.443] (-860.029) (-856.006) -- 0:00:43
785000 -- [-863.606] (-857.010) (-862.004) (-860.161) * (-868.461) (-865.640) (-860.301) [-851.271] -- 0:00:43
Average standard deviation of split frequencies: 0.013010
786000 -- (-854.390) [-856.618] (-868.185) (-864.096) * (-859.734) (-857.910) (-854.748) [-861.930] -- 0:00:43
787000 -- (-857.566) (-853.452) (-865.538) [-856.828] * (-860.432) [-859.820] (-863.343) (-861.226) -- 0:00:42
788000 -- (-856.923) [-855.934] (-859.429) (-852.759) * (-863.316) (-859.879) [-858.877] (-865.449) -- 0:00:42
789000 -- (-855.201) (-863.389) (-860.381) [-855.575] * (-857.691) (-863.756) [-864.284] (-868.134) -- 0:00:42
790000 -- [-852.671] (-856.187) (-858.108) (-859.955) * (-861.784) (-860.515) (-860.506) [-864.616] -- 0:00:42
Average standard deviation of split frequencies: 0.012612
791000 -- (-854.736) (-858.681) (-862.542) [-859.318] * (-858.938) (-856.208) [-860.254] (-862.100) -- 0:00:42
792000 -- (-854.617) (-853.983) [-858.718] (-871.205) * (-861.028) (-862.599) (-868.426) [-857.106] -- 0:00:41
793000 -- (-857.400) [-861.432] (-864.254) (-857.406) * (-855.149) [-857.071] (-857.669) (-863.698) -- 0:00:41
794000 -- (-863.649) (-856.211) (-861.926) [-855.862] * [-857.172] (-858.596) (-863.444) (-861.780) -- 0:00:41
795000 -- [-856.490] (-855.804) (-853.898) (-859.189) * (-859.121) [-852.913] (-864.594) (-861.089) -- 0:00:41
Average standard deviation of split frequencies: 0.012437
796000 -- (-855.730) [-861.843] (-858.374) (-864.139) * (-862.254) (-863.618) (-864.578) [-863.262] -- 0:00:41
797000 -- [-859.030] (-855.700) (-856.969) (-865.791) * [-858.156] (-854.815) (-871.955) (-858.427) -- 0:00:40
798000 -- [-857.524] (-857.564) (-860.001) (-870.043) * [-856.876] (-859.556) (-861.233) (-869.268) -- 0:00:40
799000 -- (-869.011) (-860.195) [-865.135] (-863.816) * (-862.760) [-853.204] (-859.262) (-854.356) -- 0:00:40
800000 -- [-865.208] (-867.841) (-862.221) (-862.122) * (-859.842) (-859.717) (-855.651) [-858.269] -- 0:00:40
Average standard deviation of split frequencies: 0.012183
801000 -- (-859.709) (-860.057) (-861.473) [-860.115] * (-858.565) (-859.642) (-868.858) [-857.102] -- 0:00:39
802000 -- (-858.042) (-864.173) [-860.185] (-859.312) * (-857.104) [-860.489] (-863.106) (-866.116) -- 0:00:39
803000 -- [-856.290] (-864.857) (-859.824) (-862.814) * [-852.947] (-859.622) (-857.840) (-869.026) -- 0:00:39
804000 -- (-860.404) (-853.082) (-858.906) [-858.798] * [-857.487] (-855.044) (-860.577) (-858.881) -- 0:00:39
805000 -- (-859.642) (-863.067) [-860.042] (-857.713) * [-856.374] (-861.747) (-867.102) (-858.705) -- 0:00:39
Average standard deviation of split frequencies: 0.011562
806000 -- (-855.045) (-857.074) [-864.089] (-861.825) * [-855.475] (-859.818) (-864.775) (-865.274) -- 0:00:38
807000 -- [-859.540] (-862.133) (-862.161) (-855.225) * (-856.788) (-857.636) [-858.806] (-863.218) -- 0:00:38
808000 -- (-859.404) (-862.121) (-854.286) [-856.133] * [-860.028] (-864.904) (-862.039) (-867.850) -- 0:00:38
809000 -- (-860.269) (-863.226) [-856.645] (-854.979) * [-856.795] (-866.362) (-863.898) (-861.627) -- 0:00:38
810000 -- (-860.305) (-858.820) (-856.090) [-860.475] * [-854.624] (-864.832) (-857.715) (-862.259) -- 0:00:38
Average standard deviation of split frequencies: 0.011675
811000 -- [-858.881] (-864.173) (-857.598) (-857.587) * (-851.854) (-864.018) (-861.612) [-860.473] -- 0:00:37
812000 -- (-859.941) (-867.180) [-854.806] (-864.244) * (-859.465) (-854.846) (-856.430) [-857.641] -- 0:00:37
813000 -- [-872.024] (-869.203) (-869.335) (-865.554) * (-858.008) [-859.368] (-867.175) (-871.134) -- 0:00:37
814000 -- (-864.738) [-863.902] (-860.519) (-861.987) * [-854.544] (-856.175) (-856.298) (-858.988) -- 0:00:37
815000 -- (-861.893) (-858.061) (-863.385) [-858.463] * (-865.335) (-860.993) (-858.628) [-861.862] -- 0:00:37
Average standard deviation of split frequencies: 0.011776
816000 -- (-859.174) (-859.542) [-860.860] (-857.208) * (-863.214) (-873.584) (-856.159) [-861.922] -- 0:00:36
817000 -- (-864.346) (-856.639) [-862.706] (-860.715) * [-857.898] (-862.198) (-868.986) (-867.624) -- 0:00:36
818000 -- (-864.389) (-862.448) [-858.720] (-855.042) * (-863.432) [-856.467] (-859.977) (-855.367) -- 0:00:36
819000 -- (-864.282) (-859.500) (-861.754) [-859.206] * (-867.315) [-859.488] (-855.483) (-859.380) -- 0:00:36
820000 -- (-863.643) [-857.703] (-864.996) (-862.342) * [-858.745] (-864.412) (-859.157) (-863.829) -- 0:00:36
Average standard deviation of split frequencies: 0.011533
821000 -- [-858.715] (-857.375) (-861.321) (-864.832) * (-857.903) (-867.345) [-858.702] (-858.277) -- 0:00:35
822000 -- (-869.656) (-860.153) [-855.570] (-866.813) * (-859.206) (-859.010) [-855.744] (-863.702) -- 0:00:35
823000 -- (-862.884) [-861.728] (-856.659) (-867.326) * (-863.817) (-866.909) (-858.273) [-853.780] -- 0:00:35
824000 -- (-862.040) (-856.664) [-857.422] (-858.612) * [-858.624] (-870.139) (-866.008) (-867.760) -- 0:00:35
825000 -- (-862.947) [-856.948] (-858.957) (-855.426) * [-852.649] (-860.036) (-864.301) (-859.425) -- 0:00:35
Average standard deviation of split frequencies: 0.010975
826000 -- (-865.118) (-860.783) (-864.750) [-856.116] * [-856.955] (-864.674) (-873.007) (-859.840) -- 0:00:34
827000 -- (-856.572) (-855.904) (-866.533) [-859.785] * (-861.535) [-858.833] (-859.784) (-856.991) -- 0:00:34
828000 -- (-861.666) (-862.455) [-853.896] (-865.190) * (-857.996) (-872.057) (-859.114) [-862.171] -- 0:00:34
829000 -- (-861.941) [-866.733] (-857.769) (-871.062) * [-854.257] (-868.920) (-861.235) (-856.015) -- 0:00:34
830000 -- (-860.315) (-859.427) (-861.717) [-860.141] * (-857.702) (-866.130) [-855.774] (-860.131) -- 0:00:34
Average standard deviation of split frequencies: 0.010477
831000 -- (-857.439) (-866.302) (-854.139) [-858.519] * (-859.591) [-862.639] (-856.674) (-857.706) -- 0:00:33
832000 -- (-857.354) (-861.746) (-861.565) [-860.567] * (-864.477) (-858.737) [-853.902] (-862.961) -- 0:00:33
833000 -- [-863.203] (-860.095) (-865.896) (-860.251) * (-856.207) (-862.623) [-861.341] (-857.720) -- 0:00:33
834000 -- (-863.958) (-862.590) (-869.029) [-858.531] * (-860.064) [-859.854] (-856.953) (-857.356) -- 0:00:33
835000 -- (-856.577) (-858.807) (-863.612) [-856.553] * (-856.236) (-860.547) [-857.496] (-860.651) -- 0:00:33
Average standard deviation of split frequencies: 0.010584
836000 -- [-860.133] (-864.007) (-862.907) (-865.201) * (-858.388) (-862.450) [-856.929] (-859.207) -- 0:00:32
837000 -- (-867.454) (-860.675) (-854.234) [-856.741] * (-860.367) (-861.481) (-864.563) [-859.271] -- 0:00:32
838000 -- [-864.386] (-860.076) (-856.734) (-866.825) * (-862.265) (-857.405) [-860.690] (-857.040) -- 0:00:32
839000 -- (-856.336) [-858.773] (-866.789) (-861.770) * (-860.992) (-859.312) [-857.500] (-865.238) -- 0:00:32
840000 -- (-865.945) (-856.937) [-856.848] (-861.884) * (-857.904) (-860.529) [-859.070] (-859.508) -- 0:00:32
Average standard deviation of split frequencies: 0.010611
841000 -- (-861.700) (-861.717) (-859.020) [-859.599] * (-861.209) (-856.939) (-861.389) [-854.016] -- 0:00:31
842000 -- (-863.241) [-858.195] (-857.478) (-861.710) * (-863.761) (-858.436) [-861.411] (-862.487) -- 0:00:31
843000 -- [-866.168] (-864.494) (-858.517) (-861.668) * (-860.512) [-859.815] (-865.389) (-858.788) -- 0:00:31
844000 -- (-860.111) (-863.229) [-856.263] (-861.108) * [-858.113] (-855.595) (-860.213) (-858.377) -- 0:00:31
845000 -- (-854.227) [-857.298] (-864.747) (-859.920) * (-860.361) (-855.455) (-862.221) [-862.349] -- 0:00:31
Average standard deviation of split frequencies: 0.011059
846000 -- [-855.783] (-857.551) (-863.097) (-859.645) * [-856.282] (-858.757) (-861.081) (-854.152) -- 0:00:30
847000 -- (-858.747) (-861.415) [-855.618] (-856.427) * [-855.199] (-864.745) (-859.026) (-861.879) -- 0:00:30
848000 -- [-854.306] (-856.814) (-857.387) (-860.847) * [-853.417] (-865.448) (-865.889) (-863.775) -- 0:00:30
849000 -- (-853.686) (-855.824) (-864.821) [-867.634] * (-860.139) (-860.251) [-857.741] (-861.351) -- 0:00:30
850000 -- (-864.858) (-863.449) [-864.054] (-856.728) * (-863.697) (-861.474) [-854.804] (-860.503) -- 0:00:30
Average standard deviation of split frequencies: 0.011552
851000 -- (-865.669) (-856.093) (-856.722) [-859.385] * [-858.644] (-858.206) (-861.924) (-863.371) -- 0:00:29
852000 -- (-866.348) (-857.758) (-858.841) [-856.184] * (-857.491) [-866.447] (-863.001) (-866.971) -- 0:00:29
853000 -- (-856.947) [-862.231] (-868.938) (-865.134) * (-863.607) [-858.845] (-863.940) (-860.878) -- 0:00:29
854000 -- (-858.932) (-866.656) [-859.515] (-857.866) * (-863.695) (-860.339) [-858.595] (-858.380) -- 0:00:29
855000 -- (-864.924) (-859.378) (-858.817) [-859.431] * (-859.961) (-859.858) (-859.897) [-859.841] -- 0:00:29
Average standard deviation of split frequencies: 0.011819
856000 -- (-858.571) (-861.089) (-858.234) [-856.567] * [-857.694] (-860.916) (-866.105) (-869.432) -- 0:00:28
857000 -- (-862.721) (-854.915) (-855.044) [-857.517] * [-859.787] (-860.739) (-863.232) (-865.859) -- 0:00:28
858000 -- (-859.163) (-858.080) (-857.834) [-856.441] * [-859.366] (-865.968) (-860.764) (-868.924) -- 0:00:28
859000 -- [-855.599] (-860.464) (-853.843) (-864.257) * (-855.003) [-858.673] (-858.475) (-861.428) -- 0:00:28
860000 -- (-855.857) [-857.427] (-857.313) (-857.244) * (-863.194) (-866.858) (-857.021) [-861.536] -- 0:00:28
Average standard deviation of split frequencies: 0.011207
861000 -- (-857.316) (-865.990) [-859.482] (-859.077) * (-861.127) (-861.975) (-855.038) [-861.843] -- 0:00:27
862000 -- (-857.037) (-853.629) [-854.868] (-854.971) * [-863.839] (-856.275) (-860.571) (-864.092) -- 0:00:27
863000 -- (-865.659) (-866.185) [-854.424] (-861.380) * (-866.337) (-854.994) (-862.645) [-858.094] -- 0:00:27
864000 -- (-856.381) [-858.736] (-860.836) (-872.597) * [-859.863] (-857.362) (-870.529) (-862.299) -- 0:00:27
865000 -- (-857.502) (-862.239) [-860.079] (-856.976) * (-864.190) [-858.405] (-868.122) (-861.630) -- 0:00:27
Average standard deviation of split frequencies: 0.010761
866000 -- (-857.996) (-859.979) [-868.437] (-861.444) * [-861.449] (-861.257) (-856.880) (-858.873) -- 0:00:26
867000 -- (-869.928) (-859.947) [-857.572] (-857.998) * [-860.325] (-862.957) (-859.132) (-866.102) -- 0:00:26
868000 -- (-860.114) [-858.569] (-863.618) (-857.994) * (-861.454) (-856.847) [-856.613] (-857.981) -- 0:00:26
869000 -- (-860.224) [-854.350] (-860.064) (-870.330) * [-862.928] (-864.519) (-863.956) (-858.375) -- 0:00:26
870000 -- (-864.849) [-859.346] (-864.948) (-858.977) * [-860.616] (-856.155) (-855.974) (-870.125) -- 0:00:26
Average standard deviation of split frequencies: 0.011037
871000 -- (-871.098) [-855.219] (-865.370) (-854.641) * (-864.469) (-860.741) (-860.650) [-859.005] -- 0:00:25
872000 -- [-858.863] (-859.073) (-861.745) (-857.055) * (-862.744) (-860.708) [-855.066] (-858.113) -- 0:00:25
873000 -- [-857.076] (-865.927) (-871.581) (-865.966) * (-856.207) (-859.042) (-854.143) [-862.830] -- 0:00:25
874000 -- (-859.851) (-866.758) (-859.266) [-862.028] * [-860.823] (-858.062) (-857.642) (-859.432) -- 0:00:25
875000 -- (-857.150) [-855.625] (-856.707) (-865.738) * (-867.111) [-857.961] (-865.344) (-856.221) -- 0:00:25
Average standard deviation of split frequencies: 0.011135
876000 -- (-864.443) (-863.435) [-859.308] (-855.759) * [-857.961] (-858.557) (-856.528) (-860.397) -- 0:00:24
877000 -- [-857.828] (-859.382) (-864.499) (-861.861) * (-856.585) [-866.525] (-861.237) (-866.271) -- 0:00:24
878000 -- (-857.787) (-860.979) (-863.735) [-857.306] * (-858.068) [-854.582] (-857.535) (-860.426) -- 0:00:24
879000 -- (-860.118) [-860.116] (-863.652) (-864.268) * (-862.724) [-851.997] (-859.447) (-861.933) -- 0:00:24
880000 -- (-858.378) (-854.819) [-857.153] (-858.920) * (-864.315) [-866.153] (-856.551) (-861.936) -- 0:00:24
Average standard deviation of split frequencies: 0.011323
881000 -- [-858.773] (-861.369) (-864.576) (-860.168) * [-864.860] (-855.717) (-860.865) (-863.748) -- 0:00:23
882000 -- (-866.448) [-862.995] (-859.961) (-852.426) * [-855.257] (-860.948) (-862.554) (-858.488) -- 0:00:23
883000 -- (-856.462) (-861.425) (-856.911) [-854.817] * [-853.219] (-860.694) (-867.098) (-862.195) -- 0:00:23
884000 -- [-859.055] (-860.408) (-866.454) (-860.306) * (-860.285) [-859.671] (-868.221) (-857.990) -- 0:00:23
885000 -- [-856.625] (-864.178) (-860.719) (-861.757) * (-859.251) (-859.794) (-861.387) [-863.780] -- 0:00:23
Average standard deviation of split frequencies: 0.011542
886000 -- (-861.582) (-861.659) [-857.853] (-861.497) * (-857.942) [-856.424] (-867.796) (-863.667) -- 0:00:22
887000 -- (-860.860) (-859.543) (-854.871) [-857.589] * (-862.779) (-858.270) [-852.517] (-859.510) -- 0:00:22
888000 -- [-861.295] (-858.704) (-857.621) (-867.585) * (-859.072) (-854.504) [-852.126] (-860.150) -- 0:00:22
889000 -- (-869.491) (-854.398) [-858.777] (-859.559) * (-859.717) [-856.751] (-859.361) (-858.986) -- 0:00:22
890000 -- (-862.947) (-857.264) (-872.920) [-859.377] * (-856.632) (-861.266) [-858.820] (-859.163) -- 0:00:22
Average standard deviation of split frequencies: 0.011318
891000 -- (-865.372) (-858.215) [-858.184] (-855.603) * (-856.083) (-860.616) [-858.583] (-859.890) -- 0:00:21
892000 -- (-860.361) (-860.081) [-860.531] (-859.157) * (-857.269) (-863.388) [-864.951] (-866.873) -- 0:00:21
893000 -- (-859.948) [-856.473] (-856.161) (-855.916) * [-863.397] (-859.347) (-862.903) (-866.479) -- 0:00:21
894000 -- (-867.412) (-867.178) [-864.776] (-858.316) * (-861.426) (-863.567) [-863.561] (-855.143) -- 0:00:21
895000 -- (-858.928) (-866.561) [-855.294] (-859.754) * [-857.170] (-859.799) (-858.684) (-854.744) -- 0:00:21
Average standard deviation of split frequencies: 0.011008
896000 -- (-854.981) (-868.583) (-860.441) [-860.435] * (-861.304) (-858.014) (-861.071) [-865.690] -- 0:00:20
897000 -- (-859.380) (-860.372) (-862.724) [-864.187] * (-864.313) (-860.023) [-856.522] (-861.670) -- 0:00:20
898000 -- [-860.135] (-856.146) (-857.259) (-863.924) * (-858.072) [-860.119] (-859.978) (-869.453) -- 0:00:20
899000 -- (-870.249) (-865.555) [-862.971] (-857.816) * (-859.773) [-858.975] (-860.418) (-861.815) -- 0:00:20
900000 -- [-860.560] (-856.866) (-865.370) (-862.798) * (-862.088) [-861.286] (-858.757) (-869.504) -- 0:00:20
Average standard deviation of split frequencies: 0.010871
901000 -- (-859.635) [-858.212] (-859.641) (-856.501) * [-855.017] (-862.389) (-859.418) (-862.616) -- 0:00:19
902000 -- [-853.375] (-861.719) (-854.826) (-856.453) * [-856.104] (-863.900) (-859.875) (-860.844) -- 0:00:19
903000 -- (-859.822) (-859.746) (-857.666) [-857.969] * (-867.346) [-856.497] (-857.661) (-862.720) -- 0:00:19
904000 -- (-856.645) (-857.584) (-858.763) [-861.333] * (-859.862) (-859.796) [-857.609] (-861.669) -- 0:00:19
905000 -- (-861.080) (-860.455) [-860.631] (-860.159) * (-864.949) [-855.985] (-856.577) (-855.710) -- 0:00:19
Average standard deviation of split frequencies: 0.010486
906000 -- [-859.860] (-862.268) (-856.849) (-855.965) * [-862.769] (-855.040) (-854.962) (-862.131) -- 0:00:18
907000 -- (-855.720) (-856.437) (-861.824) [-856.468] * (-859.407) (-858.025) (-864.694) [-854.873] -- 0:00:18
908000 -- (-854.975) [-859.891] (-859.251) (-863.984) * (-860.627) (-863.090) [-856.448] (-864.436) -- 0:00:18
909000 -- [-853.621] (-860.698) (-856.205) (-858.057) * (-858.769) [-855.441] (-869.436) (-858.830) -- 0:00:18
910000 -- (-851.341) [-852.834] (-853.965) (-863.367) * [-856.432] (-857.640) (-861.841) (-858.576) -- 0:00:18
Average standard deviation of split frequencies: 0.010433
911000 -- [-856.846] (-853.769) (-861.533) (-866.977) * (-854.955) (-862.293) (-858.957) [-856.888] -- 0:00:17
912000 -- (-857.892) (-861.708) (-863.737) [-858.247] * [-859.673] (-867.895) (-863.884) (-853.128) -- 0:00:17
913000 -- (-857.283) [-862.176] (-864.996) (-866.838) * (-860.308) (-867.823) (-862.199) [-857.857] -- 0:00:17
914000 -- (-858.499) (-865.235) [-857.040] (-865.554) * (-864.184) (-858.272) [-858.124] (-856.080) -- 0:00:17
915000 -- (-862.026) (-863.516) (-859.496) [-868.601] * [-860.558] (-856.951) (-860.865) (-860.486) -- 0:00:17
Average standard deviation of split frequencies: 0.010016
916000 -- (-861.503) (-855.700) (-862.823) [-861.688] * (-864.048) (-860.567) [-852.684] (-865.100) -- 0:00:16
917000 -- (-860.827) (-857.695) (-853.280) [-856.837] * (-863.301) (-860.864) [-858.043] (-863.182) -- 0:00:16
918000 -- (-863.714) [-855.818] (-855.050) (-857.974) * (-865.690) (-855.538) [-865.997] (-864.970) -- 0:00:16
919000 -- (-856.801) [-857.626] (-862.061) (-864.603) * (-860.864) (-868.433) (-859.953) [-858.865] -- 0:00:16
920000 -- (-860.952) (-857.819) [-858.101] (-869.438) * (-855.685) [-855.926] (-855.988) (-859.395) -- 0:00:16
Average standard deviation of split frequencies: 0.009847
921000 -- [-860.556] (-859.833) (-856.387) (-867.353) * (-862.812) (-861.261) [-854.495] (-869.653) -- 0:00:15
922000 -- (-869.897) [-860.348] (-858.288) (-860.224) * (-859.535) (-869.480) (-860.696) [-856.883] -- 0:00:15
923000 -- (-860.951) (-854.344) [-855.669] (-864.287) * (-857.585) [-862.631] (-859.032) (-866.360) -- 0:00:15
924000 -- [-861.233] (-860.546) (-857.985) (-858.067) * (-862.976) (-867.264) (-857.257) [-857.015] -- 0:00:15
925000 -- (-867.399) (-853.536) (-856.878) [-857.077] * (-862.336) [-859.804] (-862.751) (-871.088) -- 0:00:15
Average standard deviation of split frequencies: 0.009790
926000 -- [-858.480] (-861.447) (-855.604) (-854.202) * (-867.679) [-857.866] (-866.742) (-861.778) -- 0:00:14
927000 -- (-862.288) (-867.682) (-862.096) [-862.064] * [-859.571] (-858.926) (-865.498) (-867.229) -- 0:00:14
928000 -- (-862.030) (-854.497) [-861.241] (-865.684) * (-852.731) (-855.462) [-857.129] (-860.401) -- 0:00:14
929000 -- (-864.129) [-858.785] (-859.936) (-859.315) * (-863.516) (-860.690) (-865.914) [-859.206] -- 0:00:14
930000 -- [-852.386] (-861.965) (-862.826) (-857.843) * (-861.270) (-863.695) [-859.967] (-857.222) -- 0:00:14
Average standard deviation of split frequencies: 0.009585
931000 -- (-868.114) (-858.545) [-854.590] (-858.684) * (-855.289) [-862.169] (-857.634) (-857.638) -- 0:00:13
932000 -- (-859.486) (-861.990) [-861.953] (-864.355) * (-859.163) [-862.245] (-862.618) (-856.564) -- 0:00:13
933000 -- [-861.832] (-864.931) (-851.039) (-857.184) * [-863.963] (-857.666) (-857.851) (-856.936) -- 0:00:13
934000 -- (-864.785) [-856.382] (-859.442) (-862.361) * (-863.711) [-858.833] (-865.939) (-866.253) -- 0:00:13
935000 -- (-861.778) [-860.350] (-856.731) (-860.338) * (-862.541) [-858.582] (-861.998) (-857.975) -- 0:00:13
Average standard deviation of split frequencies: 0.009065
936000 -- (-856.289) (-861.910) (-867.873) [-851.899] * (-861.619) (-854.304) [-854.780] (-852.302) -- 0:00:12
937000 -- (-864.383) (-858.044) [-866.647] (-860.007) * [-852.894] (-864.274) (-859.457) (-861.166) -- 0:00:12
938000 -- (-858.963) (-860.353) (-861.351) [-857.293] * (-865.978) (-859.420) (-867.458) [-857.893] -- 0:00:12
939000 -- [-856.388] (-859.583) (-860.870) (-855.508) * (-864.615) [-859.371] (-854.428) (-863.204) -- 0:00:12
940000 -- (-857.122) (-858.845) (-867.518) [-853.907] * (-860.871) (-858.037) [-857.634] (-858.087) -- 0:00:12
Average standard deviation of split frequencies: 0.009329
941000 -- (-858.419) (-866.493) [-869.622] (-861.943) * (-862.080) (-866.895) [-852.002] (-856.170) -- 0:00:11
942000 -- (-861.251) (-865.807) (-858.726) [-860.966] * (-861.898) (-866.544) [-863.218] (-862.896) -- 0:00:11
943000 -- (-856.425) [-860.373] (-864.412) (-863.182) * (-858.908) (-864.009) (-863.621) [-861.852] -- 0:00:11
944000 -- (-869.304) [-858.048] (-871.864) (-867.041) * [-857.629] (-869.928) (-856.523) (-867.426) -- 0:00:11
945000 -- (-857.226) [-855.841] (-864.017) (-855.378) * (-863.043) (-857.831) (-854.677) [-863.081] -- 0:00:11
Average standard deviation of split frequencies: 0.009736
946000 -- (-862.146) (-866.129) [-854.995] (-862.191) * [-855.486] (-873.581) (-862.883) (-862.725) -- 0:00:10
947000 -- [-859.341] (-862.689) (-861.078) (-859.875) * (-858.131) [-863.528] (-865.462) (-859.054) -- 0:00:10
948000 -- (-857.841) [-861.906] (-866.144) (-853.829) * (-854.934) (-876.274) (-863.191) [-858.678] -- 0:00:10
949000 -- (-866.228) (-859.796) (-868.292) [-855.004] * [-857.501] (-867.572) (-859.579) (-861.843) -- 0:00:10
950000 -- (-859.174) (-860.009) (-861.161) [-858.296] * [-863.952] (-862.795) (-868.838) (-859.094) -- 0:00:10
Average standard deviation of split frequencies: 0.009765
951000 -- (-858.596) (-858.152) [-855.066] (-857.717) * (-860.012) [-855.551] (-869.056) (-859.066) -- 0:00:09
952000 -- [-858.064] (-857.334) (-855.879) (-861.741) * (-857.223) (-864.454) (-857.773) [-860.975] -- 0:00:09
953000 -- [-857.720] (-855.346) (-861.005) (-860.562) * (-863.541) (-861.052) (-856.390) [-862.944] -- 0:00:09
954000 -- (-861.845) (-854.199) (-858.558) [-854.822] * [-861.790] (-861.133) (-869.714) (-859.672) -- 0:00:09
955000 -- [-852.698] (-861.336) (-859.516) (-858.842) * [-857.033] (-860.603) (-861.553) (-860.906) -- 0:00:09
Average standard deviation of split frequencies: 0.009862
956000 -- [-862.436] (-862.545) (-855.501) (-858.050) * (-861.613) (-864.002) [-855.214] (-858.149) -- 0:00:08
957000 -- (-856.787) (-870.911) [-866.177] (-856.486) * (-867.544) (-857.320) (-856.056) [-854.173] -- 0:00:08
958000 -- [-858.633] (-859.369) (-860.051) (-860.364) * (-862.843) (-862.143) [-859.100] (-862.205) -- 0:00:08
959000 -- [-865.800] (-860.677) (-863.761) (-863.598) * (-853.327) (-865.715) [-861.582] (-858.849) -- 0:00:08
960000 -- (-862.357) (-868.775) [-854.450] (-858.382) * (-872.819) (-860.870) (-857.698) [-855.148] -- 0:00:08
Average standard deviation of split frequencies: 0.009663
961000 -- (-860.728) (-867.092) [-863.286] (-855.662) * (-857.836) (-861.175) [-857.495] (-860.034) -- 0:00:07
962000 -- (-860.957) (-864.781) (-871.118) [-866.519] * (-855.813) (-862.654) (-859.815) [-854.292] -- 0:00:07
963000 -- (-859.096) (-862.089) (-858.297) [-858.274] * (-861.460) [-857.374] (-867.930) (-857.955) -- 0:00:07
964000 -- (-862.205) [-860.569] (-862.299) (-862.619) * (-867.933) (-857.434) (-864.655) [-859.922] -- 0:00:07
965000 -- (-864.709) (-857.702) (-856.469) [-857.010] * (-863.643) [-857.727] (-852.988) (-863.014) -- 0:00:07
Average standard deviation of split frequencies: 0.009610
966000 -- [-857.589] (-876.874) (-860.508) (-862.542) * (-862.755) [-854.865] (-869.399) (-855.137) -- 0:00:06
967000 -- (-860.410) (-861.048) [-860.735] (-856.223) * (-867.714) [-856.924] (-867.733) (-858.485) -- 0:00:06
968000 -- (-859.795) (-866.366) [-866.557] (-862.029) * (-863.739) [-863.791] (-853.990) (-859.518) -- 0:00:06
969000 -- (-865.593) (-873.780) (-855.553) [-853.917] * (-860.775) (-864.272) (-859.274) [-853.729] -- 0:00:06
970000 -- [-856.192] (-864.689) (-869.555) (-860.260) * [-858.985] (-858.857) (-858.696) (-865.780) -- 0:00:06
Average standard deviation of split frequencies: 0.009414
971000 -- (-867.354) (-867.941) [-857.289] (-866.587) * (-864.369) (-854.154) [-857.556] (-862.444) -- 0:00:05
972000 -- [-853.866] (-862.752) (-853.292) (-865.460) * [-860.612] (-863.334) (-859.939) (-863.606) -- 0:00:05
973000 -- [-858.459] (-863.625) (-864.435) (-862.392) * (-854.681) [-854.921] (-859.193) (-860.163) -- 0:00:05
974000 -- (-863.653) [-866.551] (-857.814) (-861.765) * (-856.205) [-858.942] (-858.418) (-855.507) -- 0:00:05
975000 -- (-857.234) (-860.378) (-858.940) [-854.398] * (-859.146) [-856.424] (-861.174) (-861.194) -- 0:00:05
Average standard deviation of split frequencies: 0.009140
976000 -- (-855.186) (-859.494) (-858.897) [-855.860] * [-857.124] (-860.063) (-864.473) (-859.506) -- 0:00:04
977000 -- (-862.463) (-863.973) [-861.883] (-868.482) * (-861.639) (-853.949) [-862.687] (-855.958) -- 0:00:04
978000 -- (-852.723) (-860.657) [-853.326] (-860.328) * (-857.975) (-862.426) [-854.991] (-856.575) -- 0:00:04
979000 -- (-859.485) (-869.959) [-859.604] (-859.084) * (-854.786) [-853.939] (-860.900) (-859.310) -- 0:00:04
980000 -- [-856.680] (-865.044) (-861.697) (-859.704) * (-864.314) (-861.618) [-863.428] (-858.078) -- 0:00:04
Average standard deviation of split frequencies: 0.009577
981000 -- (-859.799) [-860.232] (-855.775) (-869.955) * (-858.598) (-855.251) [-856.544] (-859.648) -- 0:00:03
982000 -- (-861.256) [-857.592] (-865.632) (-863.249) * [-855.963] (-857.840) (-856.044) (-857.002) -- 0:00:03
983000 -- [-855.558] (-860.416) (-872.306) (-859.571) * (-860.402) (-857.800) [-860.726] (-856.556) -- 0:00:03
984000 -- (-855.146) (-859.563) [-854.965] (-858.329) * (-862.409) (-856.350) (-858.546) [-858.099] -- 0:00:03
985000 -- (-863.775) [-860.778] (-863.736) (-858.728) * (-864.740) [-855.457] (-860.794) (-858.392) -- 0:00:03
Average standard deviation of split frequencies: 0.009525
986000 -- (-861.277) (-860.647) (-863.049) [-859.813] * (-865.394) (-858.628) (-860.273) [-854.439] -- 0:00:02
987000 -- (-865.628) (-862.386) (-862.448) [-858.306] * (-855.147) (-857.581) (-861.511) [-854.650] -- 0:00:02
988000 -- (-861.581) [-856.497] (-856.201) (-856.657) * (-864.879) (-856.918) (-858.525) [-856.701] -- 0:00:02
989000 -- [-856.972] (-865.371) (-862.145) (-862.258) * (-866.520) (-864.370) (-857.866) [-856.315] -- 0:00:02
990000 -- (-862.350) (-863.444) [-863.086] (-858.898) * (-860.360) [-864.096] (-859.358) (-856.692) -- 0:00:02
Average standard deviation of split frequencies: 0.008968
991000 -- (-859.317) (-863.495) (-865.735) [-866.522] * (-858.184) (-858.565) (-857.347) [-866.178] -- 0:00:01
992000 -- [-861.277] (-860.939) (-862.125) (-855.550) * (-856.330) (-857.333) [-855.779] (-862.185) -- 0:00:01
993000 -- (-853.817) [-858.869] (-856.139) (-866.733) * (-861.698) (-866.504) [-854.111] (-870.663) -- 0:00:01
994000 -- (-857.375) [-863.300] (-859.391) (-866.478) * (-863.254) [-855.755] (-859.794) (-862.012) -- 0:00:01
995000 -- (-857.513) (-865.592) (-856.492) [-861.512] * (-861.592) [-860.656] (-861.589) (-855.240) -- 0:00:01
Average standard deviation of split frequencies: 0.008774
996000 -- (-860.454) (-860.927) [-863.533] (-867.922) * [-855.820] (-858.866) (-858.973) (-865.561) -- 0:00:00
997000 -- (-861.944) (-864.556) [-852.975] (-856.687) * (-857.708) [-865.495] (-862.835) (-857.490) -- 0:00:00
998000 -- (-866.593) (-864.687) [-860.086] (-852.746) * (-859.990) (-858.638) (-867.229) [-856.435] -- 0:00:00
999000 -- (-862.031) (-867.869) (-855.660) [-863.635] * [-858.749] (-864.983) (-859.743) (-863.813) -- 0:00:00
1000000 -- (-876.159) (-857.801) [-865.178] (-855.341) * (-863.487) (-860.127) (-858.741) [-855.106] -- 0:00:00
Average standard deviation of split frequencies: 0.009096
Analysis completed in 3 mins 20 seconds
Analysis used 200.04 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -848.70
Likelihood of best state for "cold" chain of run 2 was -848.50
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
68.7 % ( 59 %) Dirichlet(Revmat{all})
83.4 % ( 74 %) Slider(Revmat{all})
32.7 % ( 25 %) Dirichlet(Pi{all})
33.0 % ( 33 %) Slider(Pi{all})
79.6 % ( 53 %) Multiplier(Alpha{1,2})
74.6 % ( 53 %) Multiplier(Alpha{3})
89.8 % ( 85 %) Slider(Pinvar{all})
37.2 % ( 40 %) ExtSPR(Tau{all},V{all})
25.1 % ( 23 %) ExtTBR(Tau{all},V{all})
40.4 % ( 36 %) NNI(Tau{all},V{all})
40.1 % ( 34 %) ParsSPR(Tau{all},V{all})
27.1 % ( 26 %) Multiplier(V{all})
51.4 % ( 45 %) Nodeslider(V{all})
26.5 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
68.0 % ( 54 %) Dirichlet(Revmat{all})
82.9 % ( 81 %) Slider(Revmat{all})
32.3 % ( 17 %) Dirichlet(Pi{all})
33.6 % ( 30 %) Slider(Pi{all})
79.3 % ( 68 %) Multiplier(Alpha{1,2})
74.0 % ( 43 %) Multiplier(Alpha{3})
89.7 % ( 78 %) Slider(Pinvar{all})
37.2 % ( 37 %) ExtSPR(Tau{all},V{all})
25.1 % ( 27 %) ExtTBR(Tau{all},V{all})
40.3 % ( 35 %) NNI(Tau{all},V{all})
40.5 % ( 42 %) ParsSPR(Tau{all},V{all})
27.1 % ( 24 %) Multiplier(V{all})
51.6 % ( 54 %) Nodeslider(V{all})
26.7 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.76 0.57 0.41
2 | 166833 0.78 0.59
3 | 166667 166865 0.80
4 | 166219 166741 166675
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.77 0.57 0.42
2 | 167099 0.79 0.60
3 | 166339 167651 0.80
4 | 166124 166735 166052
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -856.79
|2 1 2 |
| 1 |
| 1 2 |
| 1 2 2 122 2 1 |
|12 22 1 1 22 22222 12 2 2 |
| 2 22 1 112 1 1 2 |
| 1* 1 1 11 2 11 2 122* 12 1 2|
| *2 2 1 1 1 2 12 21 1 |
| 1 1 1 22 1 1 21 1 11 1 1 1 *2 |
| 2 1 1 1 2 1 |
| 2 1 2 1 1 1|
| 22 2 1 2 1 |
| 1 2 1 2 2 2 2 |
| |
| 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -860.35
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -854.97 -866.31
2 -854.96 -866.16
--------------------------------------
TOTAL -854.97 -866.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.093203 0.000358 0.058858 0.131155 0.090837 1347.16 1424.08 1.000
r(A<->C){all} 0.082698 0.001753 0.015341 0.167786 0.076230 677.63 754.93 1.002
r(A<->G){all} 0.253154 0.005514 0.122308 0.407673 0.247810 340.57 371.16 1.000
r(A<->T){all} 0.082169 0.001618 0.014997 0.161858 0.075938 595.54 642.39 1.001
r(C<->G){all} 0.043326 0.001472 0.000018 0.118620 0.032519 467.44 515.63 1.003
r(C<->T){all} 0.390746 0.006680 0.231735 0.543070 0.388783 454.16 539.93 1.000
r(G<->T){all} 0.147908 0.003503 0.037087 0.260888 0.141226 590.27 620.87 1.007
pi(A){all} 0.295606 0.000421 0.256404 0.335086 0.294951 1199.82 1325.62 1.000
pi(C){all} 0.225250 0.000345 0.189409 0.262090 0.224890 1248.34 1254.17 1.000
pi(G){all} 0.193895 0.000330 0.157420 0.228435 0.193361 980.79 1184.40 1.000
pi(T){all} 0.285249 0.000404 0.248145 0.325299 0.284923 1177.44 1200.22 1.000
alpha{1,2} 0.703206 0.615702 0.000198 2.241400 0.441514 1152.55 1212.30 1.000
alpha{3} 1.324228 1.223212 0.000646 3.485764 1.019498 1202.04 1314.42 1.000
pinvar{all} 0.371197 0.041543 0.004650 0.708667 0.368601 727.96 808.22 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- .**.....
10 -- .....**.
11 -- .**..**.
12 -- ....*..*
13 -- .**.****
14 -- ...**..*
15 -- .**.***.
16 -- .**..***
17 -- ...*...*
18 -- .******.
19 -- .***.**.
20 -- ...**...
21 -- .***.***
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 3002 1.000000 0.000000 1.000000 1.000000 2
10 3002 1.000000 0.000000 1.000000 1.000000 2
11 2936 0.978015 0.005653 0.974017 0.982012 2
12 637 0.212192 0.011777 0.203864 0.220520 2
13 622 0.207195 0.004711 0.203864 0.210526 2
14 619 0.206196 0.007066 0.201199 0.211193 2
15 616 0.205197 0.011306 0.197202 0.213191 2
16 596 0.198534 0.017901 0.185876 0.211193 2
17 594 0.197868 0.001884 0.196536 0.199201 2
18 583 0.194204 0.009893 0.187209 0.201199 2
19 567 0.188874 0.025910 0.170553 0.207195 2
20 564 0.187875 0.020728 0.173218 0.202532 2
21 557 0.185543 0.001413 0.184544 0.186542 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.005203 0.000010 0.000356 0.011143 0.004598 1.000 2
length{all}[2] 0.010736 0.000026 0.002167 0.020712 0.010121 1.003 2
length{all}[3] 0.012045 0.000030 0.003481 0.023542 0.011137 1.000 2
length{all}[4] 0.001733 0.000003 0.000000 0.005240 0.001201 1.000 2
length{all}[5] 0.001723 0.000003 0.000001 0.005181 0.001199 1.000 2
length{all}[6] 0.001747 0.000003 0.000000 0.005279 0.001233 1.000 2
length{all}[7] 0.001699 0.000003 0.000001 0.005012 0.001170 1.000 2
length{all}[8] 0.001735 0.000003 0.000000 0.005361 0.001170 1.000 2
length{all}[9] 0.023565 0.000078 0.008414 0.041291 0.022353 1.000 2
length{all}[10] 0.020437 0.000053 0.008141 0.034535 0.019415 1.000 2
length{all}[11] 0.009319 0.000024 0.001418 0.019119 0.008440 1.000 2
length{all}[12] 0.001784 0.000003 0.000001 0.005237 0.001275 1.004 2
length{all}[13] 0.001688 0.000003 0.000000 0.005022 0.001167 1.000 2
length{all}[14] 0.001808 0.000003 0.000001 0.005081 0.001315 0.999 2
length{all}[15] 0.001694 0.000003 0.000001 0.005269 0.001130 0.998 2
length{all}[16] 0.001687 0.000003 0.000001 0.005381 0.001095 0.998 2
length{all}[17] 0.001539 0.000002 0.000000 0.004513 0.001095 0.998 2
length{all}[18] 0.001678 0.000003 0.000004 0.004818 0.001164 1.001 2
length{all}[19] 0.001677 0.000003 0.000003 0.004935 0.001184 1.004 2
length{all}[20] 0.001811 0.000003 0.000002 0.005580 0.001260 0.998 2
length{all}[21] 0.001743 0.000003 0.000002 0.005249 0.001155 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009096
Maximum standard deviation of split frequencies = 0.025910
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
+------------------------------------------------------------------------ C8 (8)
|
| /------------------------ C2 (2)
| /----------100----------+
| | \------------------------ C3 (3)
\-----------98----------+
| /------------------------ C6 (6)
\----------100----------+
\------------------------ C7 (7)
Phylogram (based on average branch lengths):
/-------- C1 (1)
|
|-- C4 (4)
|
|-- C5 (5)
|
+-- C8 (8)
|
| /----------------- C2 (2)
| /--------------------------------------+
| | \------------------- C3 (3)
\-------------+
| /-- C6 (6)
\---------------------------------+
\-- C7 (7)
|-------| 0.005 expected changes per site
Calculating tree probabilities...
Credible sets of trees (55 trees sampled):
50 % credible set contains 8 trees
90 % credible set contains 14 trees
95 % credible set contains 15 trees
99 % credible set contains 30 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Thu Oct 20 00:46:21 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=8, Len=153
C1 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C2 MKLLLLLSILSFSSAAPTTYRASQAAKVLIHTTEKVTLNNQRTHSYTKWS
C3 MKLLLLLSILSFSSAAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C4 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C5 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C6 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C7 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C8 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
*********:*** :***************:************:*****.
C1 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C2 VCSTGWNTYTNTMVVVNGRWVETAKPPKPTAVAIPTFPYEPRSEKPGFGS
C3 VCSTGWNTYTNTMVVVNGRWVETTKPPRPTAIAIPTFPYEPRSEKPGFGS
C4 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C5 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C6 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C7 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C8 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
***********************:***.***.****.*** *********
C1 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C2 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWST
C3 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHQTFAVTTFRWST
C4 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C5 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C6 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C7 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C8 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
***********:***.**** *****************:*******:**:
C1 PLN
C2 PSN
C3 PSN
C4 PSN
C5 PSN
C6 PSN
C7 PSN
C8 PSN
* *
-- Starting log on Thu Oct 20 01:04:35 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/codeml,175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 459 sites
reading seq# 2 C2 459 sites
reading seq# 3 C3 459 sites
reading seq# 4 C4 459 sites
reading seq# 5 C5 459 sites
reading seq# 6 C6 459 sites
reading seq# 7 C7 459 sites
reading seq# 8 C8 459 sitesns = 8 ls = 459
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Sequences read..
Counting site patterns.. 0:00
Compressing, 79 patterns at 153 / 153 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 79 patterns at 153 / 153 sites (100.0%), 0:00
Counting codons..
224 bytes for distance
77104 bytes for conP
6952 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 4, 5, 8, ((2, 3), (6, 7))); MP score: 35
154208 bytes for conP, adjusted
0.038554 0.088534 0.057492 0.048498 0.016117 0.080897 0.099295 0.107204 0.075400 0.043744 0.106596 0.300000 0.532019 0.502225
ntime & nrate & np: 11 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.028226
np = 14
lnL0 = -921.166060
Iterating by ming2
Initial: fx= 921.166060
x= 0.03855 0.08853 0.05749 0.04850 0.01612 0.08090 0.09929 0.10720 0.07540 0.04374 0.10660 0.30000 0.53202 0.50223
1 h-m-p 0.0000 0.0003 370.9721 +++ 881.910178 m 0.0003 20 | 1/14
2 h-m-p 0.0000 0.0000 2398.5391 ++ 879.313069 m 0.0000 37 | 2/14
3 h-m-p 0.0000 0.0000 6154.5620 ++ 874.840776 m 0.0000 54 | 3/14
4 h-m-p 0.0000 0.0000 85313.8000 ++ 864.051648 m 0.0000 71 | 4/14
5 h-m-p 0.0000 0.0001 369.8108 ++ 860.739533 m 0.0001 88 | 5/14
6 h-m-p 0.0002 0.0120 49.9834 ++YCYCCC 852.003638 5 0.0066 115 | 5/14
7 h-m-p 0.0003 0.0015 374.4905 YCC 846.735277 2 0.0007 135 | 5/14
8 h-m-p 0.0007 0.0035 66.0728 YCCCCC 845.058365 5 0.0014 161 | 5/14
9 h-m-p 0.0016 0.0102 55.8786 CYCC 843.928632 3 0.0017 183 | 5/14
10 h-m-p 0.0047 0.0237 12.2501 +YCYCCC 842.310284 5 0.0149 209 | 5/14
11 h-m-p 0.0102 0.0509 3.1842 ++ 841.058800 m 0.0509 226 | 6/14
12 h-m-p 0.1040 0.5202 0.6241 CYCCC 839.221166 4 0.1941 250 | 5/14
13 h-m-p 0.0030 0.0149 18.1016 CCCCC 838.439235 4 0.0051 283 | 5/14
14 h-m-p 0.0417 0.2087 0.6380 ++ 837.976126 m 0.2087 300 | 6/14
15 h-m-p 0.0825 0.5021 1.2922 YCCC 836.520698 3 0.1393 331 | 6/14
16 h-m-p 0.5560 2.7798 0.2691 YCCCC 834.030945 4 1.3927 355 | 5/14
17 h-m-p 0.1177 0.5887 1.9341 CYC 833.963246 2 0.0263 383 | 5/14
18 h-m-p 0.1044 0.9597 0.4863 +CYC 833.121329 2 0.4296 404 | 5/14
19 h-m-p 0.5682 7.5326 0.3677 +YCYC 831.689352 3 1.7150 435 | 5/14
20 h-m-p 0.3198 1.5990 0.2531 ++ 830.893858 m 1.5990 461 | 6/14
21 h-m-p 0.8172 4.0858 0.3873 CCC 830.664979 2 0.8987 491 | 6/14
22 h-m-p 1.0594 7.1600 0.3285 YCC 830.560569 2 0.6511 519 | 6/14
23 h-m-p 0.9347 8.0000 0.2288 CYC 830.473816 2 1.1213 547 | 6/14
24 h-m-p 1.6000 8.0000 0.0893 CYC 830.463895 2 1.6865 575 | 6/14
25 h-m-p 1.6000 8.0000 0.0064 CC 830.463477 1 1.2898 602 | 6/14
26 h-m-p 1.6000 8.0000 0.0004 C 830.463454 0 1.2909 627 | 6/14
27 h-m-p 1.6000 8.0000 0.0002 C 830.463453 0 1.3426 652 | 6/14
28 h-m-p 1.6000 8.0000 0.0001 Y 830.463453 0 1.1798 677 | 6/14
29 h-m-p 1.6000 8.0000 0.0000 C 830.463453 0 1.6982 702 | 6/14
30 h-m-p 1.6000 8.0000 0.0000 C 830.463453 0 1.6000 727 | 6/14
31 h-m-p 1.6000 8.0000 0.0000 -C 830.463453 0 0.1589 753 | 6/14
32 h-m-p 0.1795 8.0000 0.0000 ---------------.. | 6/14
33 h-m-p 0.0160 8.0000 0.0001 --------Y 830.463453 0 0.0000 824
Out..
lnL = -830.463453
825 lfun, 2475 eigenQcodon, 18150 P(t)
end of tree file.
Time used: 0:06
Model 2: PositiveSelection
TREE # 1
(1, 4, 5, 8, ((2, 3), (6, 7))); MP score: 35
0.066121 0.036741 0.069214 0.070470 0.098619 0.069284 0.098568 0.010574 0.083208 0.087897 0.056793 3.825368 1.478903 0.175733 0.322742 1.395836
ntime & nrate & np: 11 3 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.377910
np = 16
lnL0 = -890.837768
Iterating by ming2
Initial: fx= 890.837768
x= 0.06612 0.03674 0.06921 0.07047 0.09862 0.06928 0.09857 0.01057 0.08321 0.08790 0.05679 3.82537 1.47890 0.17573 0.32274 1.39584
1 h-m-p 0.0000 0.0003 436.6798 +++ 859.663175 m 0.0003 22 | 1/16
2 h-m-p 0.0000 0.0001 684.1606 ++ 844.984982 m 0.0001 41 | 2/16
3 h-m-p 0.0000 0.0000 5353.2417 ++ 839.420369 m 0.0000 60 | 3/16
4 h-m-p 0.0000 0.0000 1126.5669 ++ 839.035973 m 0.0000 79 | 4/16
5 h-m-p 0.0000 0.0001 406.4017 ++ 835.678261 m 0.0001 98 | 5/16
6 h-m-p 0.0004 0.0043 23.0404 YCCC 835.499637 3 0.0006 122 | 5/16
7 h-m-p 0.0033 0.0226 4.5824 YC 835.468983 1 0.0018 142 | 5/16
8 h-m-p 0.0009 0.0403 8.8416 ++CYCCC 834.807392 4 0.0191 170 | 5/16
9 h-m-p 0.0003 0.0016 116.7030 YCCC 834.483724 3 0.0007 194 | 5/16
10 h-m-p 0.0412 0.2278 2.1039 +YCYCCC 832.833908 5 0.1206 222 | 5/16
11 h-m-p 0.0135 0.0675 4.1439 +YYCCC 831.523708 4 0.0461 248 | 5/16
12 h-m-p 0.1403 0.8755 1.3614 +YYCC 830.192941 3 0.5071 272 | 5/16
13 h-m-p 1.6000 8.0000 0.3149 YCCC 830.100406 3 1.1264 296 | 5/16
14 h-m-p 0.8051 8.0000 0.4406 +YCCC 829.945485 3 2.3670 332 | 5/16
15 h-m-p 1.0232 7.2036 1.0193 YYCC 829.840296 3 0.7982 366 | 5/16
16 h-m-p 1.3717 8.0000 0.5931 CCC 829.765536 2 1.0547 389 | 5/16
17 h-m-p 1.6000 8.0000 0.3005 CCC 829.742774 2 1.6337 423 | 5/16
18 h-m-p 1.3730 8.0000 0.3576 CC 829.732573 1 0.5120 455 | 5/16
19 h-m-p 0.4136 8.0000 0.4427 YC 829.726561 1 0.7259 486 | 5/16
20 h-m-p 1.4862 8.0000 0.2162 CCC 829.721316 2 1.2069 520 | 5/16
21 h-m-p 1.6000 8.0000 0.1565 CC 829.719135 1 1.4420 552 | 5/16
22 h-m-p 1.6000 8.0000 0.0239 YC 829.718843 1 0.8633 583 | 5/16
23 h-m-p 1.5182 8.0000 0.0136 Y 829.718796 0 1.2038 613 | 5/16
24 h-m-p 1.6000 8.0000 0.0032 +C 829.718751 0 6.5626 644 | 5/16
25 h-m-p 1.4322 8.0000 0.0147 ++ 829.718541 m 8.0000 674 | 5/16
26 h-m-p 1.3624 8.0000 0.0866 ++ 829.717128 m 8.0000 704 | 5/16
27 h-m-p 1.6000 8.0000 0.3942 YC 829.715974 1 2.6540 735 | 5/16
28 h-m-p 1.6000 8.0000 0.1563 CC 829.715629 1 2.2414 767 | 5/16
29 h-m-p 0.9227 8.0000 0.3797 +YC 829.715405 1 2.4220 799 | 5/16
30 h-m-p 1.6000 8.0000 0.3320 C 829.715298 0 1.6000 829 | 5/16
31 h-m-p 1.1733 8.0000 0.4528 YC 829.715235 1 2.3594 860 | 5/16
32 h-m-p 1.6000 8.0000 0.3522 C 829.715212 0 2.2392 890 | 5/16
33 h-m-p 1.6000 8.0000 0.3399 Y 829.715202 0 2.6550 920 | 5/16
34 h-m-p 1.6000 8.0000 0.3523 C 829.715197 0 2.4387 950 | 5/16
35 h-m-p 1.6000 8.0000 0.3481 Y 829.715196 0 2.6355 980 | 5/16
36 h-m-p 1.6000 8.0000 0.3493 C 829.715195 0 2.4647 1010 | 5/16
37 h-m-p 1.6000 8.0000 0.3480 Y 829.715195 0 2.6476 1040 | 5/16
38 h-m-p 1.6000 8.0000 0.3499 C 829.715194 0 2.4850 1070 | 5/16
39 h-m-p 1.6000 8.0000 0.3527 Y 829.715194 0 2.6426 1100 | 5/16
40 h-m-p 1.6000 8.0000 0.3499 C 829.715194 0 2.4876 1130 | 5/16
41 h-m-p 1.6000 8.0000 0.3542 Y 829.715194 0 2.6277 1160 | 5/16
42 h-m-p 1.6000 8.0000 0.3768 Y 829.715194 0 2.6687 1190 | 5/16
43 h-m-p 1.6000 8.0000 0.0971 C 829.715194 0 1.3537 1220 | 5/16
44 h-m-p 0.3105 8.0000 0.4233 +C 829.715194 0 1.8884 1251 | 5/16
45 h-m-p 1.6000 8.0000 0.2468 C 829.715194 0 2.3483 1281 | 5/16
46 h-m-p 1.6000 8.0000 0.1103 C 829.715194 0 1.6000 1311 | 5/16
47 h-m-p 0.0278 8.0000 6.3438 --Y 829.715194 0 0.0004 1343 | 5/16
48 h-m-p 1.6000 8.0000 0.0010 ---------------Y 829.715194 0 0.0000 1377 | 5/16
49 h-m-p 0.0160 8.0000 0.0026 -------------.. | 5/16
50 h-m-p 0.0160 8.0000 0.0002 -Y 829.715194 0 0.0005 1449
Out..
lnL = -829.715194
1450 lfun, 5800 eigenQcodon, 47850 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -834.020452 S = -784.118141 -56.349757
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 79 patterns 0:23
did 20 / 79 patterns 0:23
did 30 / 79 patterns 0:23
did 40 / 79 patterns 0:23
did 50 / 79 patterns 0:23
did 60 / 79 patterns 0:23
did 70 / 79 patterns 0:23
did 79 / 79 patterns 0:24end of tree file.
Time used: 0:24
Model 7: beta
TREE # 1
(1, 4, 5, 8, ((2, 3), (6, 7))); MP score: 35
0.087869 0.017935 0.096119 0.087353 0.100392 0.107221 0.086750 0.023404 0.040399 0.054612 0.107909 3.928513 0.936208 1.127065
ntime & nrate & np: 11 1 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 5.135124
np = 14
lnL0 = -898.525547
Iterating by ming2
Initial: fx= 898.525547
x= 0.08787 0.01794 0.09612 0.08735 0.10039 0.10722 0.08675 0.02340 0.04040 0.05461 0.10791 3.92851 0.93621 1.12707
1 h-m-p 0.0000 0.0001 359.6235 ++ 882.233888 m 0.0001 19 | 1/14
2 h-m-p 0.0000 0.0000 3763.6557 ++ 854.505859 m 0.0000 36 | 2/14
3 h-m-p 0.0000 0.0000 8249.4201 ++ 837.782944 m 0.0000 53 | 3/14
4 h-m-p 0.0000 0.0000 1098.8256 ++ 834.841442 m 0.0000 70 | 4/14
5 h-m-p 0.0000 0.0001 136.2820 ++ 832.731474 m 0.0001 87 | 5/14
6 h-m-p 0.0001 0.0016 38.6202 +YCYCCC 831.945485 5 0.0007 113 | 5/14
7 h-m-p 0.0020 0.0102 10.6751 CCC 831.898300 2 0.0008 134 | 5/14
8 h-m-p 0.0017 0.0087 4.4464 CC 831.893870 1 0.0004 153 | 5/14
9 h-m-p 0.0019 0.6757 0.9049 +++YYC 831.655692 2 0.0968 175 | 5/14
10 h-m-p 0.0953 0.9935 0.9188 YCCCC 831.305380 4 0.2013 208 | 5/14
11 h-m-p 0.2018 1.0091 0.7934 YYC 831.155472 2 0.1509 236 | 5/14
12 h-m-p 0.3471 3.8116 0.3449 +YYC 831.069051 2 1.1044 265 | 5/14
13 h-m-p 0.0413 0.2066 4.5909 CYCYC 830.957313 4 0.0927 298 | 5/14
14 h-m-p 0.0937 0.4683 1.2558 +YYYYCYCYC 830.711772 8 0.3981 326 | 5/14
15 h-m-p 0.0007 0.0035 25.4266 ++ 830.599441 m 0.0035 343 | 5/14
16 h-m-p -0.0000 -0.0000 0.0708
h-m-p: -2.28367111e-17 -1.14183556e-16 7.08136888e-02 830.599441
.. | 5/14
17 h-m-p 0.0000 0.0011 26.0648 ++CCCC 830.526760 3 0.0002 391 | 5/14
18 h-m-p 0.0002 0.0035 25.8721 CCC 830.491293 2 0.0002 412 | 5/14
19 h-m-p 0.0007 0.0183 6.8704 YC 830.483972 1 0.0004 430 | 5/14
20 h-m-p 0.0160 8.0000 0.6974 --C 830.483909 0 0.0003 449 | 5/14
21 h-m-p 0.0020 0.9805 0.1692 C 830.483898 0 0.0008 475 | 5/14
22 h-m-p 0.0026 1.3240 0.1784 C 830.483866 0 0.0034 501 | 5/14
23 h-m-p 0.0010 0.5063 1.5213 +++YCCC 830.476520 3 0.0674 535 | 5/14
24 h-m-p 0.0001 0.0006 259.2155 YYCY 830.473749 3 0.0000 556 | 5/14
25 h-m-p 0.0007 0.0037 1.2112 --C 830.473749 0 0.0000 575 | 5/14
26 h-m-p 0.0019 0.9547 0.0481 +++++ 830.472871 m 0.9547 595 | 6/14
27 h-m-p 0.1310 8.0000 0.3509 CYC 830.472628 2 0.0201 625 | 5/14
28 h-m-p 0.0000 0.0012 32166.0482 ---C 830.472626 0 0.0000 653 | 5/14
29 h-m-p 0.0298 8.0000 0.0535 +Y 830.472597 0 0.1911 671 | 5/14
30 h-m-p 0.2617 1.3085 0.0060 ---------------.. | 5/14
31 h-m-p 0.0000 0.0000 31.9094 --- | 5/14
32 h-m-p 0.0000 0.0000 31.9094 ---
Out..
lnL = -830.472597
765 lfun, 8415 eigenQcodon, 84150 P(t)
end of tree file.
Time used: 0:53
Model 8: beta&w>1
TREE # 1
(1, 4, 5, 8, ((2, 3), (6, 7))); MP score: 35
0.037327 0.063580 0.056444 0.035719 0.094629 0.026620 0.034383 0.013714 0.106965 0.055523 0.049556 3.811673 0.900000 1.123853 1.587655 1.300000
ntime & nrate & np: 11 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.939171
np = 16
lnL0 = -880.678869
Iterating by ming2
Initial: fx= 880.678869
x= 0.03733 0.06358 0.05644 0.03572 0.09463 0.02662 0.03438 0.01371 0.10696 0.05552 0.04956 3.81167 0.90000 1.12385 1.58766 1.30000
1 h-m-p 0.0000 0.0003 468.9466 +++ 847.652746 m 0.0003 38 | 1/16
2 h-m-p 0.0000 0.0001 540.5000 ++ 838.396652 m 0.0001 73 | 2/16
3 h-m-p 0.0000 0.0000 2568509.5112 ++ 835.453272 m 0.0000 107 | 3/16
4 h-m-p 0.0000 0.0000 363.6525 ++ 835.404225 m 0.0000 140 | 4/16
5 h-m-p 0.0000 0.0000 1203.3821 ++ 834.204698 m 0.0000 172 | 5/16
6 h-m-p 0.0001 0.0017 47.4456 ++YYCCC 833.394615 4 0.0006 211 | 5/16
7 h-m-p 0.0045 0.0227 5.5223 YCCC 833.290544 3 0.0030 246 | 5/16
8 h-m-p 0.0010 0.0062 16.3564 ++ 832.736708 m 0.0062 276 | 5/16
9 h-m-p 0.0020 0.0098 4.4844 YCCC 832.705415 3 0.0012 311 | 5/16
10 h-m-p 0.0007 0.0801 6.9888 ++CCC 832.284286 2 0.0115 347 | 5/16
11 h-m-p 0.0464 0.7875 1.7298 ++
QuantileBeta(0.15, 0.00500, 2.18386) = 1.205242e-160 2000 rounds
YCCC 830.621038 3 0.5736 384 | 5/16
12 h-m-p 0.1198 0.5991 0.5681 YCCCC 830.390053 4 0.2813 421 | 5/16
13 h-m-p 0.1929 0.9646 0.4917 CCCCC 830.122081 4 0.2504 459 | 5/16
14 h-m-p 1.3613 8.0000 0.0904 CCC 830.102225 2 1.2341 493 | 5/16
15 h-m-p 0.7563 8.0000 0.1476 +CCC 830.058013 2 3.9993 528 | 5/16
16 h-m-p 0.1983 0.9914 1.0480 CYCCC 830.021697 4 0.3137 565 | 5/16
17 h-m-p 0.4661 2.3306 0.4678 CYCCC 829.960420 4 0.7876 602 | 5/16
18 h-m-p 0.7273 3.6367 0.2200 YC 829.932950 1 0.3572 633 | 5/16
19 h-m-p 0.2913 5.9952 0.2697 +CCCC 829.900571 3 1.3609 670 | 5/16
20 h-m-p 1.1357 8.0000 0.3232 CCCC 829.871323 3 1.4151 706 | 5/16
21 h-m-p 1.6000 8.0000 0.2258 CYC 829.852957 2 1.4952 739 | 5/16
22 h-m-p 0.3875 1.9560 0.8713 YCCCCC 829.836986 5 0.5205 778 | 5/16
23 h-m-p 1.6000 8.0000 0.2422 CCC 829.826538 2 1.9999 812 | 5/16
24 h-m-p 1.6000 8.0000 0.1208 YC 829.822037 1 0.6754 843 | 5/16
25 h-m-p 0.2471 8.0000 0.3302 +YCCC 829.810992 3 1.9000 879 | 5/16
26 h-m-p 1.6000 8.0000 0.1965 CCC 829.804977 2 1.2336 913 | 5/16
27 h-m-p 0.6291 8.0000 0.3853 YCCC 829.796331 3 1.2806 948 | 5/16
28 h-m-p 1.6000 8.0000 0.1969 YCC 829.783619 2 2.8928 981 | 5/16
29 h-m-p 1.5567 8.0000 0.3660 YCCC 829.762614 3 2.7796 1016 | 5/16
30 h-m-p 1.6000 8.0000 0.4670 CCC 829.749691 2 2.4473 1050 | 5/16
31 h-m-p 1.6000 8.0000 0.6584 YC 829.740088 1 2.7681 1081 | 5/16
32 h-m-p 1.6000 8.0000 0.8413 CC 829.735323 1 1.8066 1113 | 5/16
33 h-m-p 1.4223 8.0000 1.0687 YC 829.730321 1 3.3918 1144 | 5/16
34 h-m-p 1.6000 8.0000 1.5105 CC 829.727022 1 2.4215 1176 | 5/16
35 h-m-p 1.6000 8.0000 2.0733 YC 829.724859 1 3.3670 1207 | 5/16
36 h-m-p 1.6000 8.0000 2.9098 YC 829.723339 1 2.6275 1238 | 5/16
37 h-m-p 1.6000 8.0000 4.5909 YC 829.722237 1 2.7986 1269 | 5/16
38 h-m-p 1.6000 8.0000 6.0925 YC 829.721472 1 2.9775 1300 | 5/16
39 h-m-p 1.1518 5.7588 8.7052 +YC 829.720907 1 3.1567 1332 | 5/16
40 h-m-p 0.3455 1.7277 13.1111 ++ 829.720597 m 1.7277 1362 | 6/16
41 h-m-p 0.2515 1.3350 38.7583 ---------------.. | 6/16
42 h-m-p 0.0005 0.2333 0.1146 Y 829.720596 0 0.0002 1434 | 6/16
43 h-m-p 0.0006 0.2995 0.1276 C 829.720595 0 0.0002 1463 | 6/16
44 h-m-p 0.0015 0.7637 0.0543 C 829.720594 0 0.0004 1492 | 6/16
45 h-m-p 0.0114 5.6875 0.0165 -C 829.720594 0 0.0007 1522 | 6/16
46 h-m-p 0.0160 8.0000 0.0075 --C 829.720594 0 0.0004 1553 | 6/16
47 h-m-p 0.0160 8.0000 0.0041 Y 829.720594 0 0.0027 1582 | 6/16
48 h-m-p 0.0160 8.0000 0.0218 C 829.720594 0 0.0063 1611 | 6/16
49 h-m-p 0.0160 8.0000 0.3176 ++Y 829.720497 0 0.2127 1642 | 6/16
50 h-m-p 1.6000 8.0000 0.0313 ++ 829.719873 m 8.0000 1671 | 6/16
51 h-m-p 0.1743 8.0000 1.4384 +CC 829.718226 1 0.9615 1703 | 6/16
52 h-m-p 1.6000 8.0000 0.0369 ++ 829.717606 m 8.0000 1732 | 6/16
53 h-m-p 0.2828 8.0000 1.0442 +Y 829.716406 0 1.1314 1762 | 6/16
54 h-m-p 1.6000 8.0000 0.0790 YC 829.716351 1 1.0545 1792 | 6/16
55 h-m-p 1.6000 8.0000 0.0176 Y 829.716349 0 1.0501 1821 | 6/16
56 h-m-p 1.6000 8.0000 0.0013 C 829.716349 0 1.3580 1850 | 6/16
57 h-m-p 1.6000 8.0000 0.0003 Y 829.716349 0 1.0462 1879 | 6/16
58 h-m-p 1.6000 8.0000 0.0000 C 829.716349 0 1.6000 1908 | 6/16
59 h-m-p 1.6000 8.0000 0.0000 C 829.716349 0 1.6000 1937 | 6/16
60 h-m-p 1.6000 8.0000 0.0000 C 829.716349 0 0.4000 1966 | 6/16
61 h-m-p 0.0160 8.0000 0.7106 -----C 829.716349 0 0.0000 2000 | 6/16
62 h-m-p 1.6000 8.0000 0.0000 --------------Y 829.716349 0 0.0000 2043 | 6/16
63 h-m-p 0.0160 8.0000 0.0000 ------------Y 829.716349 0 0.0000 2084
Out..
lnL = -829.716349
2085 lfun, 25020 eigenQcodon, 252285 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -833.559911 S = -784.117883 -69.592385
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 79 patterns 2:23
did 20 / 79 patterns 2:23
did 30 / 79 patterns 2:23
did 40 / 79 patterns 2:24
did 50 / 79 patterns 2:24
did 60 / 79 patterns 2:24
did 70 / 79 patterns 2:24
did 79 / 79 patterns 2:24end of tree file.
Time used: 2:24
The loglikelihoods for models M1, M2, M7 and M8 are -830.463453 -829.715194 -830.472597 -829.716349 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWGVCSTGWNTYT
175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSAAPTTYRASQAAKVLIHTTEKVTLNNQRTHSYTKWSVCSTGWNTYT
183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSAAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWGVCSTGWNTYT
SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWGVCSTGWNTYT
TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWGVCSTGWNTYT
TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWGVCSTGWNTYT
TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWGVCSTGWNTYT
TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWGVCSTGWNTYT
*********:*** :***************:************:*****.**********
LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 NTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHV
175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 NTMVVVNGRWVETAKPPKPTAVAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHV
183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 NTMVVVNGRWVETTKPPRPTAIAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHV
SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 NTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHV
TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 NTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHV
TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 NTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGSHFDYGRIEYESVLCAVFEHV
TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 NTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGSHFDYGRIEYESVLCAVFEHV
TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 NTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHV
*************:***.***.****.*** ********************:***.****
LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 INDIAKIAAQLAQTQRRHHTFAVTTFKWSSPLN
175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 SNDIAKIAAQLAQTQRRHHTFAVTTFKWSTPSN
183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 SNDIAKIAAQLAQTQRRHQTFAVTTFRWSTPSN
SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 INDIAKIAAQLAQTQRRHHTFAVTTFKWSSPSN
TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 INDIAKIAAQLAQTQRRHHTFAVTTFKWSSPSN
TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 SNDIAKIAAQLAQTQRRHHTFAVTTFKWSSPSN
TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 SNDIAKIAAQLAQTQRRHHTFAVTTFKWSSPSN
TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 INDIAKIAAQLAQTQRRHHTFAVTTFKWSSPSN
*****************:*******:**:* *
>LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCCTCTTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACATACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAAGACCAACAGCCTTTGCCATTCCAACATTTCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCATTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTTAAAT >175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCTTCTGCAGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTCATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACACACTCATACACAAAATGGAGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAAAACCAACAGCCGTTGCTATTCCAACATTCCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGACTACGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCAGTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAGACACAGCGACGACATCACACTTTCGCTGTGACGACTTTTAAGTGGTCTACTCCTTCAAAT >183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCTTCTGCAGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACACACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAACCAAACCGCCAAGACCCACAGCCATTGCTATTCCAACATTCCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGACTATGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCAGTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAGACACAGCGACGACATCAGACTTTCGCTGTGACTACTTTTAGGTGGTCTACTCCTTCAAAT >SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCCTCTTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACATACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAAGACCAACAGCCTTTGCTATTCCAACATTTCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCATTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTCAAAT >TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCCTCTTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACATACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAAGACCAACAGCCTTTGCTATTCCAACATTTCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCATTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTCAAAT >TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTTTTAGCTTTTCCTATTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTACACCACTGAAAAAGTCACTCTAAATAACCAGAGAACACACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAGAACCAACAGCCATTGCTATTCCAACAGTCCCATACGAGCTTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTGTCTTGTGTGCTGTATTTGAGCATGTCAGTAATGACATTGCAAAAATTGCTGCCCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTCAAAT >TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTTTTAGCTTTTCCTATTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTACACCACTGAAAAAGTCACTCTAAATAACCAGAGAACACACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAGAACCAACAGCCATTGCTATTCCAACAGTCCCATACGAGCTTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTGTCTTGTGTGCTGTATTTGAGCATGTCAGTAATGACATTGCAAAAATTGCTGCCCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTCAAAT >TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCCTCTTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACATACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAAGACCAACAGCCTTTGCTATTCCAACATTTCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCATTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTCAAAT
>LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWGVCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSSPLN >175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSAAPTTYRASQAAKVLIHTTEKVTLNNQRTHSYTKWSVCSTGWNTYTNTMVVVNGRWVETAKPPKPTAVAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSTPSN >183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSAAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWGVCSTGWNTYTNTMVVVNGRWVETTKPPRPTAIAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHQTFAVTTFRWSTPSN >SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWGVCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSSPSN >TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWGVCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSSPSN >TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWGVCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGSHFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSSPSN >TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWGVCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGSHFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSSPSN >TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWGVCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGSHFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSSPSN
Reading sequence file /data//pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/codeml/fasta/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1
Found 8 sequences of length 459
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 3.0%
Found 24 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 4
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 22 polymorphic sites
**p-Value(s)**
----------
NSS: 1.17e-01 (1000 permutations)
Max Chi^2: 3.64e-01 (1000 permutations)
PHI (Permutation): 1.07e-01 (1000 permutations)
PHI (Normal): 4.66e-02
#NEXUS
[ID: 5249122880]
begin taxa;
dimensions ntax=8;
taxlabels
LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10
183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10
SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
end;
begin trees;
translate
1 LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
2 175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
3 183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
4 SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
5 TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10,
6 TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10,
7 TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10,
8 TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:4.597509e-03,4:1.200894e-03,5:1.199150e-03,8:1.170376e-03,((2:1.012076e-02,3:1.113663e-02)1.000:2.235336e-02,(6:1.233199e-03,7:1.169708e-03)1.000:1.941529e-02)0.978:8.440445e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:4.597509e-03,4:1.200894e-03,5:1.199150e-03,8:1.170376e-03,((2:1.012076e-02,3:1.113663e-02):2.235336e-02,(6:1.233199e-03,7:1.169708e-03):1.941529e-02):8.440445e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -854.97 -866.31
2 -854.96 -866.16
--------------------------------------
TOTAL -854.97 -866.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.093203 0.000358 0.058858 0.131155 0.090837 1347.16 1424.08 1.000
r(A<->C){all} 0.082698 0.001753 0.015341 0.167786 0.076230 677.63 754.93 1.002
r(A<->G){all} 0.253154 0.005514 0.122308 0.407673 0.247810 340.57 371.16 1.000
r(A<->T){all} 0.082169 0.001618 0.014997 0.161858 0.075938 595.54 642.39 1.001
r(C<->G){all} 0.043326 0.001472 0.000018 0.118620 0.032519 467.44 515.63 1.003
r(C<->T){all} 0.390746 0.006680 0.231735 0.543070 0.388783 454.16 539.93 1.000
r(G<->T){all} 0.147908 0.003503 0.037087 0.260888 0.141226 590.27 620.87 1.007
pi(A){all} 0.295606 0.000421 0.256404 0.335086 0.294951 1199.82 1325.62 1.000
pi(C){all} 0.225250 0.000345 0.189409 0.262090 0.224890 1248.34 1254.17 1.000
pi(G){all} 0.193895 0.000330 0.157420 0.228435 0.193361 980.79 1184.40 1.000
pi(T){all} 0.285249 0.000404 0.248145 0.325299 0.284923 1177.44 1200.22 1.000
alpha{1,2} 0.703206 0.615702 0.000198 2.241400 0.441514 1152.55 1212.30 1.000
alpha{3} 1.324228 1.223212 0.000646 3.485764 1.019498 1202.04 1314.42 1.000
pinvar{all} 0.371197 0.041543 0.004650 0.708667 0.368601 727.96 808.22 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 8 ls = 153
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 7 5 5 7 7 6 | Ser TCT 6 5 5 6 6 5 | Tyr TAT 4 2 4 4 4 4 | Cys TGT 1 1 1 1 1 1
TTC 1 2 2 1 1 1 | TCC 2 1 1 2 2 2 | TAC 4 4 3 4 4 4 | TGC 1 1 1 1 1 1
Leu TTA 2 1 1 1 1 1 | TCA 1 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 2 2 2 2 2 1 | His CAT 3 3 2 3 3 3 | Arg CGT 2 1 1 2 2 2
CTC 0 0 0 0 0 0 | CCC 0 0 1 0 0 0 | CAC 1 3 2 1 1 2 | CGC 0 0 0 0 0 0
CTA 2 2 2 2 2 2 | CCA 6 6 5 6 6 6 | Gln CAA 3 2 2 3 3 3 | CGA 0 2 2 0 0 0
CTG 1 1 1 1 1 1 | CCG 1 1 1 1 1 1 | CAG 2 3 4 2 2 2 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 7 6 7 7 7 7 | Thr ACT 5 6 7 5 5 5 | Asn AAT 4 4 4 4 4 4 | Ser AGT 3 5 4 3 3 4
ATC 1 1 1 1 1 0 | ACC 2 2 3 2 2 2 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 9 9 9 9 9 9 | Lys AAA 7 8 7 7 7 7 | Arg AGA 4 2 3 4 4 3
Met ATG 2 2 2 2 2 2 | ACG 2 2 1 2 2 2 | AAG 1 1 0 1 1 1 | AGG 1 1 2 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 4 3 3 3 3 | Ala GCT 7 8 8 8 8 7 | Asp GAT 1 0 0 1 1 1 | Gly GGT 4 3 4 4 4 4
GTC 2 2 2 2 2 4 | GCC 4 3 2 3 3 4 | GAC 1 2 2 1 1 1 | GGC 1 1 1 1 1 1
GTA 1 1 1 1 1 2 | GCA 3 4 4 3 3 2 | Glu GAA 3 3 3 3 3 4 | GGA 1 1 1 1 1 1
GTG 3 3 3 3 3 3 | GCG 0 0 0 0 0 0 | GAG 4 4 4 4 4 4 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------
Phe TTT 6 7 | Ser TCT 5 6 | Tyr TAT 4 4 | Cys TGT 1 1
TTC 1 1 | TCC 2 2 | TAC 4 4 | TGC 1 1
Leu TTA 1 1 | TCA 2 2 | *** TAA 0 0 | *** TGA 0 0
TTG 3 3 | TCG 0 0 | TAG 0 0 | Trp TGG 4 4
----------------------------------------------------------------------
Leu CTT 3 3 | Pro CCT 1 2 | His CAT 3 3 | Arg CGT 2 2
CTC 0 0 | CCC 0 0 | CAC 2 1 | CGC 0 0
CTA 2 2 | CCA 6 6 | Gln CAA 3 3 | CGA 0 0
CTG 1 1 | CCG 1 1 | CAG 2 2 | CGG 1 1
----------------------------------------------------------------------
Ile ATT 7 7 | Thr ACT 5 5 | Asn AAT 4 4 | Ser AGT 4 3
ATC 0 1 | ACC 2 2 | AAC 3 3 | AGC 1 1
ATA 0 0 | ACA 9 9 | Lys AAA 7 7 | Arg AGA 3 4
Met ATG 2 2 | ACG 2 2 | AAG 1 1 | AGG 1 1
----------------------------------------------------------------------
Val GTT 3 3 | Ala GCT 7 8 | Asp GAT 1 1 | Gly GGT 4 4
GTC 4 2 | GCC 4 3 | GAC 1 1 | GGC 1 1
GTA 2 1 | GCA 2 3 | Glu GAA 4 3 | GGA 1 1
GTG 3 3 | GCG 0 0 | GAG 4 4 | GGG 0 0
----------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.23529 C:0.17647 A:0.33987 G:0.24837
position 2: T:0.24837 C:0.32680 A:0.26797 G:0.15686
position 3: T:0.40523 C:0.15686 A:0.27451 G:0.16340
Average T:0.29630 C:0.22004 A:0.29412 G:0.18954
#2: C2
position 1: T:0.20261 C:0.19608 A:0.34641 G:0.25490
position 2: T:0.23529 C:0.33333 A:0.27451 G:0.15686
position 3: T:0.37908 C:0.16993 A:0.28105 G:0.16993
Average T:0.27233 C:0.23312 A:0.30065 G:0.19390
#3: C3
position 1: T:0.20915 C:0.18954 A:0.35294 G:0.24837
position 2: T:0.23529 C:0.33333 A:0.26144 G:0.16993
position 3: T:0.39216 C:0.16340 A:0.27451 G:0.16993
Average T:0.27887 C:0.22876 A:0.29630 G:0.19608
#4: C4
position 1: T:0.23529 C:0.17647 A:0.33987 G:0.24837
position 2: T:0.24183 C:0.33333 A:0.26797 G:0.15686
position 3: T:0.41176 C:0.15033 A:0.27451 G:0.16340
Average T:0.29630 C:0.22004 A:0.29412 G:0.18954
#5: C5
position 1: T:0.23529 C:0.17647 A:0.33987 G:0.24837
position 2: T:0.24183 C:0.33333 A:0.26797 G:0.15686
position 3: T:0.41176 C:0.15033 A:0.27451 G:0.16340
Average T:0.29630 C:0.22004 A:0.29412 G:0.18954
#6: C6
position 1: T:0.22222 C:0.17647 A:0.33333 G:0.26797
position 2: T:0.24837 C:0.31373 A:0.28105 G:0.15686
position 3: T:0.39216 C:0.16993 A:0.27451 G:0.16340
Average T:0.28758 C:0.22004 A:0.29630 G:0.19608
#7: C7
position 1: T:0.22222 C:0.17647 A:0.33333 G:0.26797
position 2: T:0.24837 C:0.31373 A:0.28105 G:0.15686
position 3: T:0.39216 C:0.16993 A:0.27451 G:0.16340
Average T:0.28758 C:0.22004 A:0.29630 G:0.19608
#8: C8
position 1: T:0.23529 C:0.17647 A:0.33987 G:0.24837
position 2: T:0.24183 C:0.33333 A:0.26797 G:0.15686
position 3: T:0.41176 C:0.15033 A:0.27451 G:0.16340
Average T:0.29630 C:0.22004 A:0.29412 G:0.18954
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 50 | Ser S TCT 44 | Tyr Y TAT 30 | Cys C TGT 8
TTC 10 | TCC 14 | TAC 31 | TGC 8
Leu L TTA 9 | TCA 15 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 0 | TAG 0 | Trp W TGG 32
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 14 | His H CAT 23 | Arg R CGT 14
CTC 0 | CCC 1 | CAC 13 | CGC 0
CTA 16 | CCA 47 | Gln Q CAA 22 | CGA 4
CTG 8 | CCG 8 | CAG 19 | CGG 8
------------------------------------------------------------------------------
Ile I ATT 55 | Thr T ACT 43 | Asn N AAT 32 | Ser S AGT 29
ATC 6 | ACC 17 | AAC 24 | AGC 8
ATA 0 | ACA 72 | Lys K AAA 57 | Arg R AGA 27
Met M ATG 16 | ACG 15 | AAG 7 | AGG 9
------------------------------------------------------------------------------
Val V GTT 25 | Ala A GCT 61 | Asp D GAT 6 | Gly G GGT 31
GTC 20 | GCC 26 | GAC 10 | GGC 8
GTA 10 | GCA 24 | Glu E GAA 26 | GGA 8
GTG 24 | GCG 0 | GAG 32 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.22467 C:0.18056 A:0.34069 G:0.25408
position 2: T:0.24265 C:0.32761 A:0.27124 G:0.15850
position 3: T:0.39951 C:0.16013 A:0.27533 G:0.16503
Average T:0.28894 C:0.22277 A:0.29575 G:0.19254
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 4, 5, 8, ((2, 3), (6, 7))); MP score: 35
lnL(ntime: 11 np: 14): -830.463453 +0.000000
9..1 9..4 9..5 9..8 9..10 10..11 11..2 11..3 10..12 12..6 12..7
0.013484 0.000004 0.000004 0.000004 0.029295 0.078625 0.033909 0.037006 0.069171 0.000004 0.000004 3.825368 0.581697 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.261511
(1: 0.013484, 4: 0.000004, 5: 0.000004, 8: 0.000004, ((2: 0.033909, 3: 0.037006): 0.078625, (6: 0.000004, 7: 0.000004): 0.069171): 0.029295);
(C1: 0.013484, C4: 0.000004, C5: 0.000004, C8: 0.000004, ((C2: 0.033909, C3: 0.037006): 0.078625, (C6: 0.000004, C7: 0.000004): 0.069171): 0.029295);
Detailed output identifying parameters
kappa (ts/tv) = 3.82537
MLEs of dN/dS (w) for site classes (K=2)
p: 0.58170 0.41830
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.013 341.4 117.6 0.4183 0.0033 0.0079 1.1 0.9
9..4 0.000 341.4 117.6 0.4183 0.0000 0.0000 0.0 0.0
9..5 0.000 341.4 117.6 0.4183 0.0000 0.0000 0.0 0.0
9..8 0.000 341.4 117.6 0.4183 0.0000 0.0000 0.0 0.0
9..10 0.029 341.4 117.6 0.4183 0.0072 0.0172 2.5 2.0
10..11 0.079 341.4 117.6 0.4183 0.0193 0.0462 6.6 5.4
11..2 0.034 341.4 117.6 0.4183 0.0083 0.0199 2.8 2.3
11..3 0.037 341.4 117.6 0.4183 0.0091 0.0217 3.1 2.6
10..12 0.069 341.4 117.6 0.4183 0.0170 0.0406 5.8 4.8
12..6 0.000 341.4 117.6 0.4183 0.0000 0.0000 0.0 0.0
12..7 0.000 341.4 117.6 0.4183 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 4, 5, 8, ((2, 3), (6, 7))); MP score: 35
lnL(ntime: 11 np: 16): -829.715194 +0.000000
9..1 9..4 9..5 9..8 9..10 10..11 11..2 11..3 10..12 12..6 12..7
0.013478 0.000004 0.000004 0.000004 0.028680 0.082478 0.032171 0.038947 0.071230 0.000004 0.000004 3.928513 0.963606 0.000000 0.307889 5.250668
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.267005
(1: 0.013478, 4: 0.000004, 5: 0.000004, 8: 0.000004, ((2: 0.032171, 3: 0.038947): 0.082478, (6: 0.000004, 7: 0.000004): 0.071230): 0.028680);
(C1: 0.013478, C4: 0.000004, C5: 0.000004, C8: 0.000004, ((C2: 0.032171, C3: 0.038947): 0.082478, (C6: 0.000004, C7: 0.000004): 0.071230): 0.028680);
Detailed output identifying parameters
kappa (ts/tv) = 3.92851
MLEs of dN/dS (w) for site classes (K=3)
p: 0.96361 0.00000 0.03639
w: 0.30789 1.00000 5.25067
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.013 341.1 117.9 0.4878 0.0035 0.0073 1.2 0.9
9..4 0.000 341.1 117.9 0.4878 0.0000 0.0000 0.0 0.0
9..5 0.000 341.1 117.9 0.4878 0.0000 0.0000 0.0 0.0
9..8 0.000 341.1 117.9 0.4878 0.0000 0.0000 0.0 0.0
9..10 0.029 341.1 117.9 0.4878 0.0075 0.0154 2.6 1.8
10..11 0.082 341.1 117.9 0.4878 0.0217 0.0444 7.4 5.2
11..2 0.032 341.1 117.9 0.4878 0.0084 0.0173 2.9 2.0
11..3 0.039 341.1 117.9 0.4878 0.0102 0.0210 3.5 2.5
10..12 0.071 341.1 117.9 0.4878 0.0187 0.0383 6.4 4.5
12..6 0.000 341.1 117.9 0.4878 0.0000 0.0000 0.0 0.0
12..7 0.000 341.1 117.9 0.4878 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
78 R 0.980* 5.153
82 F 0.736 3.944
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
78 R 0.835 4.336 +- 2.825
82 F 0.587 3.160 +- 2.792
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.271 0.291 0.246 0.134 0.045 0.010 0.002 0.000 0.000 0.000
w2: 0.174 0.157 0.139 0.122 0.104 0.087 0.072 0.058 0.048 0.039
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.002
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.013
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.008 0.047
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.002 0.007 0.029 0.100
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003 0.007 0.018 0.059 0.130
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.004 0.009 0.017 0.032 0.077 0.129
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.002 0.005 0.010 0.016 0.026 0.037 0.078 0.122
sum of density on p0-p1 = 1.000000
Time used: 0:24
Model 7: beta (10 categories)
TREE # 1: (1, 4, 5, 8, ((2, 3), (6, 7))); MP score: 35
check convergence..
lnL(ntime: 11 np: 14): -830.472597 +0.000000
9..1 9..4 9..5 9..8 9..10 10..11 11..2 11..3 10..12 12..6 12..7
0.013474 0.000004 0.000004 0.000004 0.029239 0.078485 0.033840 0.037001 0.069083 0.000004 0.000004 3.811673 0.005003 0.006314
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.261142
(1: 0.013474, 4: 0.000004, 5: 0.000004, 8: 0.000004, ((2: 0.033840, 3: 0.037001): 0.078485, (6: 0.000004, 7: 0.000004): 0.069083): 0.029239);
(C1: 0.013474, C4: 0.000004, C5: 0.000004, C8: 0.000004, ((C2: 0.033840, C3: 0.037001): 0.078485, (C6: 0.000004, C7: 0.000004): 0.069083): 0.029239);
Detailed output identifying parameters
kappa (ts/tv) = 3.81167
Parameters in M7 (beta):
p = 0.00500 q = 0.00631
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.05357 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.013 341.4 117.6 0.4054 0.0033 0.0081 1.1 0.9
9..4 0.000 341.4 117.6 0.4054 0.0000 0.0000 0.0 0.0
9..5 0.000 341.4 117.6 0.4054 0.0000 0.0000 0.0 0.0
9..8 0.000 341.4 117.6 0.4054 0.0000 0.0000 0.0 0.0
9..10 0.029 341.4 117.6 0.4054 0.0071 0.0175 2.4 2.1
10..11 0.078 341.4 117.6 0.4054 0.0190 0.0469 6.5 5.5
11..2 0.034 341.4 117.6 0.4054 0.0082 0.0202 2.8 2.4
11..3 0.037 341.4 117.6 0.4054 0.0090 0.0221 3.1 2.6
10..12 0.069 341.4 117.6 0.4054 0.0167 0.0413 5.7 4.9
12..6 0.000 341.4 117.6 0.4054 0.0000 0.0000 0.0 0.0
12..7 0.000 341.4 117.6 0.4054 0.0000 0.0000 0.0 0.0
Time used: 0:53
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 4, 5, 8, ((2, 3), (6, 7))); MP score: 35
lnL(ntime: 11 np: 16): -829.716349 +0.000000
9..1 9..4 9..5 9..8 9..10 10..11 11..2 11..3 10..12 12..6 12..7
0.013479 0.000004 0.000004 0.000004 0.028687 0.082478 0.032181 0.038940 0.071226 0.000004 0.000004 3.928870 0.963770 44.199766 99.000000 5.259557
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.267010
(1: 0.013479, 4: 0.000004, 5: 0.000004, 8: 0.000004, ((2: 0.032181, 3: 0.038940): 0.082478, (6: 0.000004, 7: 0.000004): 0.071226): 0.028687);
(C1: 0.013479, C4: 0.000004, C5: 0.000004, C8: 0.000004, ((C2: 0.032181, C3: 0.038940): 0.082478, (C6: 0.000004, C7: 0.000004): 0.071226): 0.028687);
Detailed output identifying parameters
kappa (ts/tv) = 3.92887
Parameters in M8 (beta&w>1):
p0 = 0.96377 p = 44.19977 q = 99.00000
(p1 = 0.03623) w = 5.25956
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09638 0.09638 0.09638 0.09638 0.09638 0.09638 0.09638 0.09638 0.09638 0.09638 0.03623
w: 0.24691 0.26876 0.28213 0.29302 0.30292 0.31263 0.32278 0.33421 0.34870 0.37345 5.25956
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.013 341.1 117.9 0.4879 0.0035 0.0073 1.2 0.9
9..4 0.000 341.1 117.9 0.4879 0.0000 0.0000 0.0 0.0
9..5 0.000 341.1 117.9 0.4879 0.0000 0.0000 0.0 0.0
9..8 0.000 341.1 117.9 0.4879 0.0000 0.0000 0.0 0.0
9..10 0.029 341.1 117.9 0.4879 0.0075 0.0154 2.6 1.8
10..11 0.082 341.1 117.9 0.4879 0.0217 0.0444 7.4 5.2
11..2 0.032 341.1 117.9 0.4879 0.0084 0.0173 2.9 2.0
11..3 0.039 341.1 117.9 0.4879 0.0102 0.0210 3.5 2.5
10..12 0.071 341.1 117.9 0.4879 0.0187 0.0383 6.4 4.5
12..6 0.000 341.1 117.9 0.4879 0.0000 0.0000 0.0 0.0
12..7 0.000 341.1 117.9 0.4879 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
78 R 0.979* 5.158
82 F 0.732 3.934
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
78 R 0.894 4.100 +- 2.595
82 F 0.680 3.203 +- 2.670
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.003 0.020 0.070 0.189 0.719
p : 0.145 0.189 0.191 0.160 0.117 0.079 0.051 0.033 0.021 0.014
q : 0.008 0.036 0.052 0.073 0.093 0.113 0.131 0.149 0.166 0.180
ws: 0.200 0.176 0.150 0.127 0.104 0.081 0.060 0.045 0.033 0.024
Time used: 2:24
Model 1: NearlyNeutral -830.463453 Model 2: PositiveSelection -829.715194 Model 7: beta -830.472597 Model 8: beta&w>1 -829.716349 Model 2 vs 1 1.496518 Model 8 vs 7 1.512496
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
