--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1137.57 -1148.79
2 -1137.58 -1149.81
--------------------------------------
TOTAL -1137.57 -1149.42
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.055752 0.000133 0.034925 0.078134 0.054568 1143.17 1257.78 1.000
r(A<->C){all} 0.134661 0.003567 0.030913 0.254384 0.127570 469.02 611.46 1.000
r(A<->G){all} 0.176013 0.004119 0.052163 0.293553 0.169420 470.02 561.53 1.001
r(A<->T){all} 0.059485 0.001406 0.000033 0.131165 0.053183 452.37 534.03 1.001
r(C<->G){all} 0.084981 0.002880 0.000173 0.191168 0.075875 491.64 509.57 1.000
r(C<->T){all} 0.344982 0.006469 0.199141 0.502817 0.338709 678.52 681.85 1.001
r(G<->T){all} 0.199877 0.004387 0.075444 0.327170 0.195841 495.83 614.45 1.001
pi(A){all} 0.251697 0.000276 0.219531 0.284867 0.251695 938.93 1164.32 1.000
pi(C){all} 0.225184 0.000243 0.195861 0.256535 0.224815 1150.03 1211.36 1.000
pi(G){all} 0.209728 0.000231 0.181366 0.240873 0.209306 961.35 1159.48 1.000
pi(T){all} 0.313391 0.000313 0.280244 0.347870 0.313146 1067.31 1136.26 1.000
alpha{1,2} 0.879031 0.888504 0.000174 2.826837 0.567818 983.33 1110.22 1.000
alpha{3} 1.396129 1.276684 0.002101 3.552859 1.091005 1302.26 1310.03 1.000
pinvar{all} 0.332767 0.046524 0.000028 0.714439 0.314464 634.58 660.52 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -1099.165277
Model 2: PositiveSelection -1090.897125
Model 7: beta -1099.202669
Model 8: beta&w>1 -1090.897766
Model 2 vs 1 16.536304
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.999** 23.848
2 S 0.997** 23.800
4 E 0.999** 23.847
8 L 0.998** 23.825
10 Q 0.998** 23.805
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.981* 8.928 +- 1.866
2 S 0.952* 8.697 +- 2.291
4 E 0.969* 8.834 +- 2.063
8 L 0.958* 8.746 +- 2.215
10 Q 0.956* 8.734 +- 2.232
13 E 0.545 5.170 +- 4.406
172 V 0.535 5.087 +- 4.410
Model 8 vs 7 16.609806
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.999** 23.844
2 S 0.997** 23.793
4 E 0.999** 23.844
8 L 0.998** 23.820
10 Q 0.997** 23.799
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.993** 8.959 +- 1.668
2 S 0.975* 8.818 +- 1.985
4 E 0.984* 8.894 +- 1.829
8 L 0.978* 8.844 +- 1.936
10 Q 0.978* 8.840 +- 1.942
13 E 0.604 5.597 +- 4.407
156 I 0.522 4.871 +- 4.466
172 V 0.594 5.512 +- 4.420
-- Starting log on Thu Oct 20 00:46:27 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=8, Len=229
C1 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C2 MSNGDNSTIPTDVVIQHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C3 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C4 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C5 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C6 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C7 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C8 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
.*.*** * *::**********************************
C1 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C2 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C3 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
C4 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
C5 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
C6 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C7 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C8 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
*************************************:************
C1 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C2 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C3 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C4 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C5 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C6 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C7 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C8 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
**************************************************
C1 TLLVEGIKIATGVQVNQLPTYITVVKPSTTIVYQRAGRSLNTRSNTGWAF
C2 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C3 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C4 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C5 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C6 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C7 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C8 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
********:***************.*************************
C1 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C2 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C3 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C4 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C5 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C6 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C7 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C8 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
*****************************
-- Starting log on Thu Oct 20 00:47:02 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=997, Nseq=8, Len=229
C1 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C2 MSNGDNSTIPTDVVIQHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C3 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C4 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C5 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C6 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C7 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C8 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
.*.*** * *::**********************************
C1 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C2 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C3 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
C4 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
C5 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
C6 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C7 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C8 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
*************************************:************
C1 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C2 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C3 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C4 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C5 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C6 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C7 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C8 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
**************************************************
C1 TLLVEGIKIATGVQVNQLPTYITVVKPSTTIVYQRAGRSLNTRSNTGWAF
C2 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C3 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C4 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C5 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C6 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C7 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C8 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
********:***************.*************************
C1 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C2 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C3 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C4 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C5 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C6 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C7 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C8 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
*****************************
-- Starting log on Thu Oct 20 00:54:01 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/gapped_alignment/codeml,175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 687 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666227246
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 387537157
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5401703558
Seed = 563528414
Swapseed = 1666227246
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 15 unique site patterns
Division 2 has 11 unique site patterns
Division 3 has 17 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1313.593730 -- 29.153684
Chain 2 -- -1306.792191 -- 29.153684
Chain 3 -- -1306.142125 -- 29.153684
Chain 4 -- -1306.042308 -- 29.153684
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1313.803563 -- 29.153684
Chain 2 -- -1305.361167 -- 29.153684
Chain 3 -- -1306.141780 -- 29.153684
Chain 4 -- -1278.756898 -- 29.153684
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1313.594] (-1306.792) (-1306.142) (-1306.042) * [-1313.804] (-1305.361) (-1306.142) (-1278.757)
1000 -- (-1145.406) (-1151.766) [-1146.070] (-1148.983) * (-1152.128) (-1154.940) (-1144.994) [-1146.691] -- 0:00:00
2000 -- (-1148.203) (-1153.901) (-1147.616) [-1149.007] * (-1146.394) [-1145.014] (-1143.738) (-1154.650) -- 0:00:00
3000 -- (-1145.574) (-1145.427) [-1144.206] (-1152.945) * (-1143.891) (-1143.217) [-1144.308] (-1141.957) -- 0:00:00
4000 -- [-1144.870] (-1144.223) (-1143.554) (-1145.878) * (-1154.885) (-1145.063) (-1144.182) [-1144.430] -- 0:04:09
5000 -- [-1139.866] (-1149.161) (-1140.888) (-1141.588) * [-1143.359] (-1142.029) (-1149.860) (-1150.084) -- 0:03:19
Average standard deviation of split frequencies: 0.087297
6000 -- [-1140.934] (-1143.854) (-1147.463) (-1143.865) * [-1139.321] (-1145.215) (-1146.343) (-1139.218) -- 0:02:45
7000 -- (-1141.724) [-1142.335] (-1143.684) (-1149.201) * [-1146.575] (-1140.905) (-1137.178) (-1144.963) -- 0:02:21
8000 -- (-1142.141) [-1141.764] (-1147.921) (-1140.363) * (-1148.980) (-1142.590) (-1139.953) [-1148.502] -- 0:02:04
9000 -- [-1138.046] (-1146.640) (-1143.090) (-1151.154) * [-1145.717] (-1142.698) (-1139.931) (-1147.253) -- 0:03:40
10000 -- [-1136.822] (-1150.472) (-1147.386) (-1138.135) * (-1146.736) [-1142.617] (-1145.717) (-1148.643) -- 0:03:18
Average standard deviation of split frequencies: 0.066291
11000 -- (-1144.992) (-1143.930) [-1144.092] (-1143.771) * (-1145.654) [-1141.138] (-1147.226) (-1146.902) -- 0:02:59
12000 -- [-1144.221] (-1152.934) (-1142.389) (-1137.480) * (-1143.063) (-1145.790) (-1147.758) [-1147.132] -- 0:02:44
13000 -- (-1145.080) (-1145.636) [-1139.510] (-1141.353) * [-1144.165] (-1145.131) (-1145.991) (-1140.248) -- 0:02:31
14000 -- [-1140.668] (-1141.018) (-1145.071) (-1140.767) * [-1140.297] (-1145.520) (-1144.312) (-1140.019) -- 0:03:31
15000 -- (-1143.343) (-1149.719) (-1142.977) [-1137.575] * (-1160.064) (-1147.172) [-1150.753] (-1139.254) -- 0:03:17
Average standard deviation of split frequencies: 0.029463
16000 -- (-1146.218) [-1142.419] (-1139.704) (-1136.124) * (-1141.970) [-1138.535] (-1143.978) (-1138.147) -- 0:03:04
17000 -- (-1145.470) (-1143.419) [-1140.548] (-1145.279) * (-1146.846) (-1144.848) [-1146.017] (-1146.263) -- 0:02:53
18000 -- (-1138.420) (-1138.924) (-1141.065) [-1137.703] * [-1144.220] (-1148.258) (-1142.344) (-1137.842) -- 0:02:43
19000 -- [-1147.497] (-1145.323) (-1151.951) (-1140.021) * (-1138.806) (-1150.082) [-1138.472] (-1139.834) -- 0:03:26
20000 -- (-1143.642) (-1144.953) (-1153.133) [-1135.905] * (-1144.537) (-1150.461) (-1145.955) [-1138.359] -- 0:03:16
Average standard deviation of split frequencies: 0.028512
21000 -- (-1151.326) (-1139.302) (-1147.371) [-1135.880] * (-1144.550) [-1143.844] (-1149.806) (-1150.377) -- 0:03:06
22000 -- (-1145.253) (-1145.478) (-1143.986) [-1142.292] * (-1142.926) (-1150.442) (-1147.497) [-1138.729] -- 0:02:57
23000 -- (-1141.337) [-1139.562] (-1138.879) (-1144.608) * [-1143.074] (-1138.894) (-1143.044) (-1146.675) -- 0:02:49
24000 -- (-1146.113) (-1149.270) (-1140.752) [-1137.824] * [-1142.081] (-1143.459) (-1147.764) (-1145.501) -- 0:03:23
25000 -- [-1147.559] (-1143.258) (-1148.353) (-1146.589) * (-1145.145) (-1151.436) (-1150.931) [-1143.191] -- 0:03:15
Average standard deviation of split frequencies: 0.037657
26000 -- (-1147.656) (-1148.411) [-1141.972] (-1139.686) * [-1140.772] (-1141.094) (-1151.278) (-1144.634) -- 0:03:07
27000 -- (-1139.509) [-1139.951] (-1138.925) (-1151.887) * (-1143.567) (-1150.562) [-1143.491] (-1139.740) -- 0:03:00
28000 -- (-1141.618) (-1146.663) [-1134.661] (-1143.733) * (-1142.885) (-1140.065) [-1141.437] (-1144.172) -- 0:02:53
29000 -- (-1139.446) (-1145.934) (-1142.255) [-1141.506] * (-1152.843) (-1133.758) (-1150.264) [-1141.103] -- 0:03:20
30000 -- (-1140.463) (-1153.749) [-1138.267] (-1144.583) * [-1147.373] (-1145.041) (-1139.752) (-1147.523) -- 0:03:14
Average standard deviation of split frequencies: 0.039021
31000 -- (-1145.071) [-1139.234] (-1144.414) (-1152.162) * (-1145.546) [-1141.483] (-1143.584) (-1143.343) -- 0:03:07
32000 -- (-1138.547) [-1138.755] (-1140.047) (-1146.320) * (-1142.171) [-1142.560] (-1141.110) (-1146.154) -- 0:03:01
33000 -- (-1143.592) (-1148.469) (-1148.370) [-1154.358] * (-1146.181) (-1142.778) [-1140.447] (-1148.604) -- 0:02:55
34000 -- (-1142.645) (-1145.289) (-1139.004) [-1143.985] * (-1142.548) [-1152.209] (-1138.370) (-1148.608) -- 0:03:18
35000 -- (-1149.978) (-1151.273) [-1136.661] (-1143.862) * (-1149.264) [-1142.571] (-1134.942) (-1147.114) -- 0:03:13
Average standard deviation of split frequencies: 0.031226
36000 -- (-1138.602) [-1145.574] (-1141.915) (-1149.347) * [-1134.269] (-1144.547) (-1135.846) (-1143.759) -- 0:03:07
37000 -- (-1145.913) (-1140.195) [-1142.166] (-1141.004) * [-1143.011] (-1145.041) (-1141.485) (-1151.259) -- 0:03:02
38000 -- (-1141.161) (-1147.271) [-1143.334] (-1145.861) * (-1139.557) [-1136.211] (-1145.961) (-1147.142) -- 0:02:57
39000 -- [-1144.952] (-1146.457) (-1139.680) (-1148.030) * (-1144.753) (-1138.916) [-1141.390] (-1145.583) -- 0:03:17
40000 -- [-1141.599] (-1147.527) (-1143.367) (-1146.243) * (-1142.588) (-1146.497) [-1140.193] (-1148.830) -- 0:03:12
Average standard deviation of split frequencies: 0.036559
41000 -- (-1140.570) (-1145.439) [-1141.544] (-1139.129) * (-1137.759) [-1139.880] (-1146.364) (-1144.914) -- 0:03:07
42000 -- [-1142.807] (-1144.095) (-1148.442) (-1141.463) * [-1137.050] (-1141.023) (-1137.295) (-1156.166) -- 0:03:02
43000 -- (-1145.434) (-1141.258) [-1146.337] (-1141.758) * (-1145.561) [-1135.598] (-1141.539) (-1142.850) -- 0:02:58
44000 -- (-1140.809) (-1137.382) [-1142.608] (-1142.256) * (-1142.074) (-1141.646) [-1144.645] (-1145.399) -- 0:03:15
45000 -- (-1150.525) (-1142.827) (-1141.979) [-1146.277] * (-1143.422) [-1142.909] (-1144.028) (-1147.123) -- 0:03:11
Average standard deviation of split frequencies: 0.035474
46000 -- [-1139.728] (-1142.770) (-1140.868) (-1142.112) * (-1142.891) (-1142.071) [-1139.124] (-1146.299) -- 0:03:06
47000 -- (-1144.081) (-1142.570) (-1138.887) [-1143.147] * (-1154.548) [-1148.354] (-1141.636) (-1147.273) -- 0:03:02
48000 -- (-1145.731) (-1149.456) (-1143.262) [-1150.060] * (-1139.237) (-1148.278) [-1141.686] (-1142.117) -- 0:02:58
49000 -- [-1137.714] (-1147.556) (-1139.887) (-1146.112) * (-1140.018) (-1154.580) [-1137.606] (-1141.973) -- 0:03:14
50000 -- (-1148.367) [-1139.088] (-1146.903) (-1143.916) * (-1139.476) [-1146.054] (-1142.624) (-1144.573) -- 0:03:10
Average standard deviation of split frequencies: 0.025049
51000 -- (-1136.841) [-1139.046] (-1143.524) (-1145.445) * (-1138.915) [-1143.341] (-1143.275) (-1145.543) -- 0:03:06
52000 -- (-1138.035) (-1140.413) (-1140.165) [-1142.524] * [-1144.123] (-1143.426) (-1139.320) (-1144.599) -- 0:03:02
53000 -- (-1136.075) (-1145.186) [-1137.151] (-1145.464) * (-1153.941) (-1142.014) [-1143.074] (-1153.491) -- 0:03:16
54000 -- [-1145.279] (-1139.473) (-1149.019) (-1147.161) * (-1145.883) (-1141.054) [-1140.064] (-1153.041) -- 0:03:12
55000 -- (-1147.617) [-1145.679] (-1138.850) (-1145.565) * (-1147.831) (-1147.388) (-1136.787) [-1144.305] -- 0:03:09
Average standard deviation of split frequencies: 0.029139
56000 -- (-1153.986) (-1140.338) (-1145.592) [-1135.532] * (-1147.882) (-1145.474) [-1145.197] (-1144.219) -- 0:03:05
57000 -- (-1144.609) (-1146.784) (-1149.377) [-1138.847] * [-1144.298] (-1140.078) (-1140.575) (-1141.801) -- 0:03:01
58000 -- (-1139.477) [-1137.879] (-1150.859) (-1140.735) * (-1143.381) (-1144.682) [-1140.900] (-1140.432) -- 0:03:14
59000 -- (-1143.759) (-1138.870) [-1138.772] (-1140.863) * [-1143.666] (-1146.925) (-1140.073) (-1151.118) -- 0:03:11
60000 -- (-1151.253) [-1144.646] (-1138.396) (-1140.615) * [-1142.871] (-1150.862) (-1144.082) (-1149.308) -- 0:03:08
Average standard deviation of split frequencies: 0.029886
61000 -- (-1149.801) (-1138.360) [-1141.179] (-1138.786) * (-1145.205) [-1148.427] (-1139.217) (-1143.616) -- 0:03:04
62000 -- [-1144.294] (-1141.496) (-1139.838) (-1134.423) * (-1144.021) [-1141.579] (-1140.992) (-1146.312) -- 0:03:01
63000 -- [-1142.694] (-1144.235) (-1140.030) (-1140.990) * (-1147.250) (-1151.780) (-1137.136) [-1145.010] -- 0:03:13
64000 -- (-1143.892) (-1151.012) (-1141.743) [-1139.968] * [-1144.570] (-1147.126) (-1148.205) (-1141.191) -- 0:03:10
65000 -- (-1145.806) (-1144.865) (-1143.437) [-1138.583] * (-1140.287) [-1145.315] (-1145.804) (-1144.650) -- 0:03:07
Average standard deviation of split frequencies: 0.027471
66000 -- [-1139.155] (-1145.598) (-1147.445) (-1148.862) * [-1140.065] (-1151.333) (-1143.938) (-1144.307) -- 0:03:03
67000 -- [-1143.981] (-1143.746) (-1142.222) (-1144.461) * [-1140.513] (-1150.467) (-1140.210) (-1145.278) -- 0:03:01
68000 -- [-1143.969] (-1141.763) (-1137.573) (-1137.693) * (-1151.830) (-1143.802) [-1141.004] (-1146.927) -- 0:03:11
69000 -- (-1139.896) (-1148.843) [-1141.287] (-1138.531) * (-1138.872) (-1146.797) (-1141.449) [-1138.312] -- 0:03:08
70000 -- (-1149.528) (-1140.366) (-1149.359) [-1143.645] * [-1137.283] (-1144.577) (-1147.694) (-1152.970) -- 0:03:06
Average standard deviation of split frequencies: 0.028736
71000 -- (-1146.978) (-1139.555) (-1140.356) [-1137.781] * (-1141.285) (-1143.656) (-1142.950) [-1136.483] -- 0:03:03
72000 -- (-1150.943) [-1145.890] (-1139.015) (-1149.339) * (-1138.821) (-1147.709) (-1148.313) [-1141.204] -- 0:03:00
73000 -- (-1149.574) (-1144.805) (-1142.756) [-1140.461] * (-1143.475) [-1151.777] (-1140.168) (-1142.267) -- 0:03:10
74000 -- (-1143.170) [-1148.120] (-1146.468) (-1141.359) * [-1145.049] (-1152.852) (-1148.125) (-1145.008) -- 0:03:07
75000 -- (-1145.508) (-1138.735) (-1136.970) [-1139.488] * [-1142.805] (-1153.444) (-1148.728) (-1134.165) -- 0:03:05
Average standard deviation of split frequencies: 0.032922
76000 -- (-1149.362) (-1142.106) (-1142.021) [-1139.763] * (-1143.323) (-1153.336) (-1154.059) [-1141.758] -- 0:03:02
77000 -- (-1147.456) [-1146.076] (-1144.596) (-1137.313) * [-1139.730] (-1155.669) (-1148.339) (-1138.417) -- 0:02:59
78000 -- (-1142.163) [-1137.361] (-1145.026) (-1149.829) * (-1143.187) [-1144.670] (-1145.339) (-1140.177) -- 0:03:09
79000 -- (-1142.072) (-1144.295) (-1143.192) [-1137.686] * (-1148.307) (-1141.140) [-1143.341] (-1136.923) -- 0:03:06
80000 -- [-1141.960] (-1142.715) (-1139.629) (-1145.650) * (-1144.789) [-1151.208] (-1149.589) (-1145.988) -- 0:03:04
Average standard deviation of split frequencies: 0.029219
81000 -- (-1150.148) (-1140.840) [-1137.958] (-1143.503) * [-1139.850] (-1149.121) (-1145.284) (-1140.831) -- 0:03:01
82000 -- [-1141.018] (-1150.516) (-1145.440) (-1142.377) * [-1144.753] (-1158.497) (-1146.331) (-1143.181) -- 0:02:59
83000 -- (-1144.194) [-1146.351] (-1144.359) (-1138.161) * (-1146.670) (-1146.631) (-1139.337) [-1142.124] -- 0:03:07
84000 -- (-1145.806) (-1142.888) (-1145.585) [-1140.673] * (-1148.055) [-1138.549] (-1149.209) (-1155.576) -- 0:03:05
85000 -- (-1139.366) (-1146.247) [-1146.559] (-1143.504) * (-1150.042) (-1136.602) (-1147.683) [-1136.598] -- 0:03:03
Average standard deviation of split frequencies: 0.030780
86000 -- [-1144.339] (-1151.456) (-1147.125) (-1147.585) * (-1136.989) [-1143.671] (-1139.958) (-1141.126) -- 0:03:00
87000 -- (-1143.310) (-1142.682) (-1141.591) [-1137.541] * [-1144.324] (-1137.191) (-1142.950) (-1145.353) -- 0:02:58
88000 -- (-1138.833) [-1150.345] (-1148.894) (-1136.449) * (-1144.488) [-1143.716] (-1152.374) (-1134.999) -- 0:03:06
89000 -- [-1137.159] (-1157.800) (-1140.125) (-1146.576) * [-1152.479] (-1146.952) (-1143.329) (-1137.132) -- 0:03:04
90000 -- (-1142.404) [-1142.744] (-1150.240) (-1143.483) * (-1147.478) [-1140.341] (-1143.475) (-1137.624) -- 0:03:02
Average standard deviation of split frequencies: 0.020797
91000 -- (-1148.450) (-1148.103) (-1139.566) [-1138.272] * (-1141.877) (-1142.537) [-1137.752] (-1141.700) -- 0:02:59
92000 -- [-1135.883] (-1148.986) (-1144.940) (-1144.792) * (-1136.905) (-1140.945) [-1143.023] (-1149.542) -- 0:03:07
93000 -- (-1149.157) (-1139.110) [-1144.949] (-1141.845) * (-1141.907) [-1148.757] (-1145.627) (-1138.682) -- 0:03:05
94000 -- [-1137.202] (-1148.170) (-1139.264) (-1141.930) * (-1149.071) (-1147.859) [-1138.572] (-1142.799) -- 0:03:03
95000 -- (-1139.714) (-1138.205) (-1146.897) [-1138.729] * (-1136.996) (-1145.820) [-1141.740] (-1142.119) -- 0:03:01
Average standard deviation of split frequencies: 0.021530
96000 -- (-1140.194) (-1145.916) (-1145.591) [-1137.757] * (-1145.134) (-1143.854) (-1145.166) [-1137.339] -- 0:02:58
97000 -- (-1140.048) (-1144.442) [-1141.731] (-1144.405) * (-1144.709) (-1138.063) [-1145.924] (-1143.259) -- 0:03:06
98000 -- (-1141.801) (-1140.071) [-1140.877] (-1141.977) * (-1148.748) (-1146.437) [-1147.243] (-1142.576) -- 0:03:04
99000 -- [-1138.220] (-1145.625) (-1145.657) (-1142.954) * (-1142.751) [-1146.632] (-1141.714) (-1148.397) -- 0:03:02
100000 -- (-1138.344) (-1141.701) [-1146.531] (-1143.883) * (-1147.054) (-1152.340) (-1141.952) [-1136.269] -- 0:03:00
Average standard deviation of split frequencies: 0.020172
101000 -- (-1141.010) (-1147.803) [-1142.947] (-1138.681) * (-1141.220) (-1139.336) (-1147.158) [-1145.586] -- 0:02:58
102000 -- [-1137.844] (-1144.880) (-1147.237) (-1138.599) * (-1136.327) (-1145.364) (-1139.376) [-1135.938] -- 0:03:04
103000 -- [-1139.877] (-1139.452) (-1146.225) (-1140.762) * (-1142.388) [-1140.080] (-1146.382) (-1138.542) -- 0:03:02
104000 -- (-1153.355) (-1144.182) (-1140.898) [-1144.982] * [-1144.997] (-1144.875) (-1142.202) (-1142.658) -- 0:03:00
105000 -- (-1146.074) (-1153.186) (-1148.018) [-1139.488] * (-1146.543) [-1145.900] (-1138.606) (-1139.796) -- 0:02:59
Average standard deviation of split frequencies: 0.019157
106000 -- [-1142.798] (-1147.156) (-1147.561) (-1139.206) * (-1146.910) (-1139.629) [-1142.799] (-1146.319) -- 0:02:57
107000 -- [-1145.417] (-1149.234) (-1147.855) (-1142.379) * (-1149.526) (-1140.005) [-1140.002] (-1143.821) -- 0:03:03
108000 -- [-1138.838] (-1143.259) (-1145.381) (-1139.208) * (-1145.218) [-1142.874] (-1138.969) (-1148.261) -- 0:03:01
109000 -- (-1138.512) [-1136.518] (-1141.908) (-1145.314) * [-1142.555] (-1145.245) (-1138.490) (-1143.354) -- 0:02:59
110000 -- (-1145.671) [-1147.050] (-1138.121) (-1144.205) * (-1148.603) (-1138.586) (-1143.167) [-1138.227] -- 0:02:58
Average standard deviation of split frequencies: 0.019988
111000 -- (-1141.835) (-1153.918) (-1141.408) [-1146.367] * (-1141.802) (-1137.153) (-1152.557) [-1139.253] -- 0:02:56
112000 -- (-1141.543) (-1142.525) [-1138.094] (-1138.154) * (-1137.874) (-1141.392) (-1140.487) [-1139.863] -- 0:03:02
113000 -- (-1144.778) [-1137.971] (-1143.942) (-1143.632) * [-1143.859] (-1146.357) (-1138.202) (-1137.050) -- 0:03:00
114000 -- [-1139.430] (-1141.734) (-1146.247) (-1148.591) * (-1144.261) [-1144.250] (-1144.883) (-1136.349) -- 0:02:58
115000 -- (-1143.123) (-1145.974) [-1139.580] (-1138.804) * [-1138.068] (-1145.205) (-1144.018) (-1141.333) -- 0:02:57
Average standard deviation of split frequencies: 0.019381
116000 -- (-1145.451) (-1146.628) [-1137.378] (-1139.338) * (-1141.376) (-1145.014) [-1140.514] (-1142.460) -- 0:02:55
117000 -- (-1143.404) [-1144.289] (-1137.397) (-1143.489) * [-1140.517] (-1136.634) (-1145.438) (-1143.917) -- 0:03:01
118000 -- (-1143.536) [-1146.151] (-1145.270) (-1147.197) * (-1143.145) (-1142.187) [-1142.387] (-1143.632) -- 0:02:59
119000 -- (-1138.750) (-1139.608) (-1143.325) [-1140.789] * [-1137.694] (-1143.366) (-1150.467) (-1143.289) -- 0:02:57
120000 -- (-1138.934) [-1142.401] (-1154.994) (-1138.973) * (-1150.234) (-1143.379) (-1144.711) [-1146.490] -- 0:02:56
Average standard deviation of split frequencies: 0.016829
121000 -- (-1145.133) (-1140.105) (-1141.792) [-1138.959] * (-1146.183) (-1143.981) [-1143.520] (-1145.856) -- 0:02:54
122000 -- (-1147.155) [-1139.693] (-1140.735) (-1146.927) * (-1143.969) (-1139.650) (-1145.039) [-1140.929] -- 0:02:59
123000 -- (-1145.974) (-1147.050) [-1142.934] (-1140.954) * (-1144.290) [-1143.014] (-1140.088) (-1148.971) -- 0:02:58
124000 -- [-1141.600] (-1139.605) (-1146.710) (-1148.064) * (-1146.818) (-1147.605) (-1139.593) [-1147.379] -- 0:02:56
125000 -- (-1143.778) (-1143.400) (-1147.377) [-1149.755] * (-1139.551) (-1159.523) [-1137.680] (-1148.491) -- 0:02:55
Average standard deviation of split frequencies: 0.017555
126000 -- [-1139.571] (-1150.549) (-1145.661) (-1154.908) * (-1148.615) (-1156.541) [-1139.543] (-1149.580) -- 0:02:53
127000 -- (-1146.773) (-1141.045) (-1145.940) [-1147.976] * (-1144.492) (-1146.705) [-1136.688] (-1153.470) -- 0:02:58
128000 -- (-1144.892) [-1141.239] (-1145.440) (-1144.321) * (-1146.247) (-1151.577) [-1137.950] (-1146.613) -- 0:02:57
129000 -- (-1145.603) (-1146.489) (-1143.340) [-1144.472] * (-1153.159) (-1149.208) (-1145.144) [-1148.876] -- 0:02:55
130000 -- (-1155.833) [-1137.775] (-1137.985) (-1134.510) * (-1147.101) (-1141.148) (-1149.995) [-1146.658] -- 0:02:54
Average standard deviation of split frequencies: 0.017761
131000 -- (-1143.750) [-1139.062] (-1151.023) (-1137.709) * [-1141.572] (-1157.501) (-1145.131) (-1142.598) -- 0:02:52
132000 -- (-1142.723) [-1139.868] (-1141.089) (-1143.415) * (-1144.109) (-1152.360) (-1141.644) [-1135.702] -- 0:02:57
133000 -- (-1153.111) [-1140.078] (-1144.539) (-1145.735) * (-1145.188) (-1149.650) (-1140.086) [-1140.002] -- 0:02:56
134000 -- (-1144.258) [-1134.559] (-1142.031) (-1142.345) * (-1148.510) (-1141.494) [-1134.515] (-1141.353) -- 0:02:54
135000 -- (-1144.938) [-1144.046] (-1139.113) (-1144.004) * (-1143.116) [-1139.939] (-1144.446) (-1147.063) -- 0:02:53
Average standard deviation of split frequencies: 0.017064
136000 -- (-1147.340) (-1155.602) (-1138.141) [-1141.964] * (-1140.140) (-1143.841) (-1139.559) [-1140.871] -- 0:02:51
137000 -- (-1154.110) [-1143.288] (-1142.860) (-1144.335) * (-1150.433) (-1144.453) (-1146.448) [-1142.726] -- 0:02:56
138000 -- (-1151.002) (-1144.070) (-1144.455) [-1146.488] * (-1143.273) (-1141.963) (-1144.259) [-1145.092] -- 0:02:54
139000 -- (-1152.202) [-1141.692] (-1141.854) (-1138.354) * (-1144.451) (-1142.352) (-1138.667) [-1141.329] -- 0:02:53
140000 -- (-1143.933) (-1139.297) (-1142.828) [-1136.471] * (-1146.779) [-1142.626] (-1145.682) (-1145.508) -- 0:02:52
Average standard deviation of split frequencies: 0.019592
141000 -- (-1147.211) [-1139.672] (-1148.512) (-1140.653) * (-1146.001) [-1140.331] (-1140.604) (-1139.960) -- 0:02:50
142000 -- [-1143.497] (-1150.356) (-1150.713) (-1139.484) * (-1146.966) [-1154.155] (-1142.337) (-1144.564) -- 0:02:55
143000 -- (-1150.387) (-1150.751) [-1145.736] (-1141.132) * (-1139.340) [-1139.990] (-1146.091) (-1138.912) -- 0:02:53
144000 -- [-1143.277] (-1138.518) (-1143.362) (-1152.432) * (-1144.032) (-1140.940) (-1144.635) [-1146.669] -- 0:02:52
145000 -- (-1139.809) (-1146.202) (-1145.742) [-1138.995] * (-1140.934) (-1143.870) [-1138.354] (-1142.654) -- 0:02:51
Average standard deviation of split frequencies: 0.019124
146000 -- (-1138.656) (-1151.301) [-1136.615] (-1143.690) * (-1150.658) (-1141.863) (-1145.796) [-1147.052] -- 0:02:55
147000 -- (-1142.275) (-1143.912) (-1148.156) [-1142.542] * (-1161.086) (-1136.879) [-1144.532] (-1147.387) -- 0:02:54
148000 -- (-1150.049) [-1141.996] (-1140.034) (-1150.277) * (-1146.538) (-1142.714) [-1142.423] (-1141.930) -- 0:02:52
149000 -- (-1145.203) (-1141.184) (-1144.784) [-1139.874] * (-1143.871) (-1141.716) (-1142.351) [-1141.849] -- 0:02:51
150000 -- (-1157.845) (-1140.868) [-1142.254] (-1143.611) * (-1145.324) (-1149.727) (-1143.093) [-1141.099] -- 0:02:50
Average standard deviation of split frequencies: 0.020698
151000 -- (-1140.420) (-1142.650) [-1145.686] (-1146.218) * (-1144.487) (-1136.556) (-1143.223) [-1142.121] -- 0:02:54
152000 -- (-1143.100) (-1140.043) (-1146.603) [-1144.231] * (-1144.036) [-1142.956] (-1140.093) (-1142.368) -- 0:02:52
153000 -- (-1140.573) (-1144.427) [-1140.789] (-1149.504) * (-1145.175) (-1135.531) (-1141.843) [-1140.442] -- 0:02:51
154000 -- (-1138.283) (-1149.440) (-1135.291) [-1140.641] * (-1141.487) (-1147.285) (-1139.395) [-1140.353] -- 0:02:50
155000 -- (-1141.057) (-1146.278) (-1140.652) [-1142.416] * [-1140.383] (-1142.835) (-1141.664) (-1138.498) -- 0:02:49
Average standard deviation of split frequencies: 0.020920
156000 -- [-1147.505] (-1147.240) (-1140.715) (-1145.677) * (-1149.388) (-1148.757) (-1140.451) [-1137.475] -- 0:02:53
157000 -- (-1142.652) (-1142.208) (-1141.022) [-1137.891] * (-1147.037) (-1140.640) [-1141.013] (-1153.960) -- 0:02:51
158000 -- (-1151.421) (-1144.094) (-1141.937) [-1143.579] * (-1141.401) [-1147.311] (-1141.657) (-1142.274) -- 0:02:50
159000 -- (-1146.879) (-1144.326) (-1140.732) [-1139.911] * (-1136.939) [-1143.926] (-1149.906) (-1152.544) -- 0:02:49
160000 -- (-1146.576) (-1144.358) [-1145.268] (-1147.678) * (-1150.960) (-1141.568) (-1137.116) [-1137.534] -- 0:02:48
Average standard deviation of split frequencies: 0.020313
161000 -- (-1148.861) (-1140.639) (-1139.000) [-1147.818] * (-1149.069) (-1143.143) [-1142.698] (-1143.124) -- 0:02:51
162000 -- (-1139.369) (-1144.223) (-1144.777) [-1143.793] * (-1139.950) [-1137.093] (-1146.682) (-1139.745) -- 0:02:50
163000 -- [-1139.793] (-1140.377) (-1145.738) (-1146.246) * [-1143.517] (-1141.734) (-1146.038) (-1142.189) -- 0:02:49
164000 -- (-1144.236) [-1140.460] (-1140.304) (-1143.622) * [-1145.926] (-1143.689) (-1146.715) (-1141.230) -- 0:02:48
165000 -- (-1146.154) (-1143.328) (-1147.208) [-1141.336] * (-1144.731) [-1138.261] (-1145.331) (-1150.974) -- 0:02:47
Average standard deviation of split frequencies: 0.019660
166000 -- (-1144.210) (-1142.203) [-1140.690] (-1146.649) * (-1140.139) (-1141.167) (-1152.405) [-1145.194] -- 0:02:50
167000 -- (-1150.051) (-1136.524) [-1142.761] (-1146.766) * (-1149.123) (-1144.400) [-1149.274] (-1145.170) -- 0:02:49
168000 -- (-1140.940) (-1151.676) [-1139.840] (-1144.537) * (-1142.879) (-1148.816) [-1142.502] (-1142.064) -- 0:02:48
169000 -- (-1146.869) (-1139.675) (-1141.785) [-1141.313] * (-1141.791) (-1142.229) (-1139.816) [-1138.906] -- 0:02:47
170000 -- (-1140.989) (-1143.598) (-1142.792) [-1138.304] * (-1144.886) [-1147.550] (-1145.271) (-1149.847) -- 0:02:46
Average standard deviation of split frequencies: 0.017423
171000 -- [-1147.197] (-1150.757) (-1146.436) (-1145.766) * (-1138.892) [-1136.608] (-1148.953) (-1139.806) -- 0:02:49
172000 -- [-1139.664] (-1142.842) (-1142.791) (-1138.340) * (-1148.732) [-1140.755] (-1140.470) (-1136.459) -- 0:02:48
173000 -- [-1141.296] (-1142.351) (-1146.280) (-1145.356) * (-1140.150) (-1140.920) (-1139.739) [-1145.123] -- 0:02:47
174000 -- (-1144.144) (-1149.005) (-1143.517) [-1141.453] * (-1141.537) (-1143.099) [-1135.750] (-1143.145) -- 0:02:46
175000 -- (-1143.835) (-1141.916) [-1145.160] (-1139.480) * (-1145.545) [-1137.509] (-1141.956) (-1143.463) -- 0:02:45
Average standard deviation of split frequencies: 0.018955
176000 -- [-1144.230] (-1144.777) (-1136.437) (-1155.068) * (-1140.946) [-1135.019] (-1138.447) (-1147.048) -- 0:02:48
177000 -- (-1150.157) (-1148.604) (-1140.464) [-1143.480] * (-1146.771) (-1137.774) [-1144.375] (-1150.416) -- 0:02:47
178000 -- (-1147.708) (-1140.799) [-1140.090] (-1138.786) * (-1145.142) (-1141.140) (-1149.995) [-1136.979] -- 0:02:46
179000 -- [-1136.297] (-1139.716) (-1137.013) (-1147.737) * (-1143.789) (-1143.754) (-1142.431) [-1137.269] -- 0:02:45
180000 -- (-1140.821) (-1142.738) [-1140.822] (-1137.977) * (-1138.005) (-1144.497) [-1134.830] (-1140.409) -- 0:02:44
Average standard deviation of split frequencies: 0.018867
181000 -- [-1145.708] (-1143.802) (-1144.669) (-1145.343) * (-1138.540) (-1155.497) (-1139.327) [-1140.019] -- 0:02:47
182000 -- (-1141.773) (-1149.128) (-1141.190) [-1143.001] * [-1138.676] (-1144.001) (-1141.426) (-1147.045) -- 0:02:46
183000 -- (-1140.537) (-1142.388) [-1140.508] (-1146.022) * (-1140.801) (-1142.243) [-1141.213] (-1141.926) -- 0:02:45
184000 -- (-1140.452) [-1145.380] (-1145.441) (-1138.241) * (-1145.632) (-1148.053) [-1139.764] (-1140.317) -- 0:02:44
185000 -- (-1156.707) [-1141.279] (-1146.136) (-1141.474) * (-1141.139) (-1138.422) [-1137.358] (-1140.554) -- 0:02:43
Average standard deviation of split frequencies: 0.018131
186000 -- [-1140.818] (-1138.212) (-1141.398) (-1142.165) * (-1145.160) (-1156.606) [-1142.815] (-1145.854) -- 0:02:46
187000 -- [-1142.911] (-1147.425) (-1136.156) (-1140.981) * (-1146.964) [-1139.904] (-1139.482) (-1151.563) -- 0:02:45
188000 -- (-1139.848) [-1139.334] (-1134.460) (-1143.835) * (-1142.953) [-1141.036] (-1145.847) (-1136.118) -- 0:02:44
189000 -- (-1144.163) (-1147.069) (-1143.895) [-1141.168] * (-1141.136) [-1146.127] (-1144.129) (-1142.346) -- 0:02:43
190000 -- (-1144.657) (-1137.074) (-1137.085) [-1145.496] * (-1146.196) (-1138.707) [-1138.537] (-1148.860) -- 0:02:42
Average standard deviation of split frequencies: 0.017307
191000 -- (-1140.798) (-1145.503) [-1140.886] (-1142.525) * (-1142.478) (-1150.506) (-1146.103) [-1136.966] -- 0:02:45
192000 -- (-1140.457) [-1143.764] (-1138.970) (-1137.031) * (-1142.875) (-1139.325) (-1148.582) [-1139.943] -- 0:02:44
193000 -- [-1145.153] (-1146.759) (-1144.931) (-1139.813) * (-1147.880) (-1141.382) [-1140.479] (-1141.179) -- 0:02:43
194000 -- (-1141.885) [-1142.043] (-1145.053) (-1146.885) * (-1140.965) [-1142.734] (-1145.768) (-1144.380) -- 0:02:42
195000 -- (-1145.353) (-1154.213) (-1139.133) [-1146.332] * (-1137.623) (-1143.747) [-1138.960] (-1145.796) -- 0:02:41
Average standard deviation of split frequencies: 0.014061
196000 -- (-1150.849) (-1146.044) [-1140.935] (-1137.631) * [-1138.191] (-1148.952) (-1139.594) (-1148.394) -- 0:02:44
197000 -- (-1144.339) (-1146.532) [-1136.913] (-1144.378) * (-1145.509) (-1143.822) [-1135.658] (-1144.729) -- 0:02:43
198000 -- [-1139.762] (-1144.973) (-1155.995) (-1144.428) * (-1153.019) (-1145.798) (-1148.147) [-1136.987] -- 0:02:42
199000 -- (-1140.196) (-1140.492) (-1148.698) [-1141.934] * [-1140.510] (-1140.200) (-1142.211) (-1143.073) -- 0:02:41
200000 -- (-1141.753) [-1146.908] (-1141.876) (-1139.100) * (-1145.250) (-1144.155) [-1137.151] (-1143.474) -- 0:02:40
Average standard deviation of split frequencies: 0.014637
201000 -- (-1153.680) (-1142.889) (-1149.369) [-1145.319] * [-1136.445] (-1147.873) (-1141.626) (-1140.273) -- 0:02:42
202000 -- (-1151.167) (-1152.492) (-1146.619) [-1141.987] * (-1140.514) (-1155.346) [-1137.133] (-1138.048) -- 0:02:41
203000 -- (-1140.427) (-1144.180) [-1139.660] (-1143.115) * (-1152.911) (-1141.112) [-1141.225] (-1151.093) -- 0:02:40
204000 -- [-1148.137] (-1136.695) (-1143.578) (-1142.613) * (-1140.187) [-1146.815] (-1139.750) (-1146.767) -- 0:02:39
205000 -- (-1157.321) (-1140.601) (-1145.227) [-1139.771] * [-1137.696] (-1144.741) (-1140.547) (-1142.491) -- 0:02:39
Average standard deviation of split frequencies: 0.013554
206000 -- (-1144.772) (-1139.567) (-1140.455) [-1140.379] * (-1147.612) (-1141.166) (-1142.476) [-1142.246] -- 0:02:41
207000 -- (-1137.886) (-1137.182) (-1151.774) [-1139.101] * [-1147.088] (-1140.776) (-1139.922) (-1139.434) -- 0:02:40
208000 -- (-1153.722) [-1144.495] (-1147.609) (-1145.994) * [-1143.247] (-1143.161) (-1147.880) (-1143.851) -- 0:02:39
209000 -- [-1141.845] (-1147.338) (-1141.956) (-1144.838) * (-1145.883) (-1144.416) (-1139.820) [-1148.654] -- 0:02:38
210000 -- [-1144.001] (-1153.515) (-1142.435) (-1145.379) * [-1149.738] (-1150.717) (-1142.287) (-1148.520) -- 0:02:41
Average standard deviation of split frequencies: 0.012910
211000 -- [-1138.589] (-1147.272) (-1143.028) (-1152.211) * (-1150.368) (-1140.219) [-1143.851] (-1143.004) -- 0:02:40
212000 -- [-1136.575] (-1141.247) (-1150.442) (-1142.353) * (-1141.363) (-1137.082) (-1141.943) [-1137.077] -- 0:02:39
213000 -- (-1139.183) (-1146.812) [-1138.600] (-1144.162) * (-1147.527) (-1138.079) [-1138.738] (-1142.534) -- 0:02:38
214000 -- (-1144.197) (-1146.961) [-1139.128] (-1141.262) * (-1139.463) [-1139.224] (-1140.427) (-1145.431) -- 0:02:37
215000 -- (-1149.595) [-1140.490] (-1141.520) (-1147.482) * [-1139.195] (-1149.257) (-1143.443) (-1145.832) -- 0:02:40
Average standard deviation of split frequencies: 0.012423
216000 -- (-1139.038) [-1146.136] (-1139.402) (-1140.624) * (-1147.826) (-1141.189) (-1149.503) [-1144.124] -- 0:02:39
217000 -- (-1146.957) (-1144.185) (-1145.357) [-1137.033] * (-1151.856) [-1136.849] (-1143.122) (-1143.694) -- 0:02:38
218000 -- [-1138.689] (-1146.324) (-1152.069) (-1147.800) * (-1143.771) (-1141.695) (-1144.054) [-1135.488] -- 0:02:37
219000 -- (-1138.626) (-1144.690) [-1139.715] (-1137.694) * (-1143.556) [-1142.617] (-1152.785) (-1148.476) -- 0:02:36
220000 -- (-1137.220) (-1145.970) [-1148.600] (-1136.853) * [-1139.076] (-1140.187) (-1140.310) (-1146.615) -- 0:02:39
Average standard deviation of split frequencies: 0.010681
221000 -- (-1150.625) (-1144.537) (-1141.603) [-1139.895] * (-1141.590) (-1145.961) [-1147.759] (-1143.583) -- 0:02:38
222000 -- (-1140.671) [-1137.098] (-1148.948) (-1144.850) * (-1139.766) [-1137.443] (-1144.707) (-1140.524) -- 0:02:37
223000 -- (-1138.512) (-1141.478) [-1146.281] (-1136.816) * (-1140.959) (-1145.560) (-1143.600) [-1136.475] -- 0:02:36
224000 -- (-1138.093) (-1144.240) [-1136.265] (-1156.116) * (-1150.603) (-1141.950) [-1143.922] (-1144.845) -- 0:02:35
225000 -- (-1145.240) (-1143.632) (-1147.079) [-1140.340] * (-1148.712) (-1146.425) (-1140.494) [-1138.879] -- 0:02:38
Average standard deviation of split frequencies: 0.010911
226000 -- (-1137.587) (-1145.261) (-1144.446) [-1141.834] * (-1140.644) (-1141.682) [-1144.963] (-1150.651) -- 0:02:37
227000 -- (-1142.691) (-1151.688) [-1141.946] (-1144.435) * (-1141.043) (-1149.467) [-1139.861] (-1141.523) -- 0:02:36
228000 -- (-1141.321) (-1144.737) [-1138.743] (-1135.246) * (-1141.579) (-1147.568) (-1145.281) [-1137.342] -- 0:02:35
229000 -- (-1145.378) (-1139.957) (-1140.946) [-1148.448] * (-1140.370) (-1143.984) [-1145.283] (-1144.781) -- 0:02:34
230000 -- (-1141.790) [-1142.292] (-1142.845) (-1141.156) * [-1144.065] (-1143.244) (-1138.039) (-1140.583) -- 0:02:37
Average standard deviation of split frequencies: 0.009747
231000 -- (-1137.421) [-1140.360] (-1140.451) (-1147.195) * (-1146.941) [-1146.742] (-1146.612) (-1147.438) -- 0:02:36
232000 -- [-1140.655] (-1143.341) (-1146.236) (-1139.420) * [-1140.188] (-1140.255) (-1145.364) (-1142.620) -- 0:02:35
233000 -- (-1146.525) (-1144.171) [-1143.405] (-1140.315) * (-1145.377) (-1143.001) [-1142.970] (-1142.594) -- 0:02:34
234000 -- [-1139.827] (-1145.618) (-1142.510) (-1140.580) * (-1142.902) (-1139.298) [-1143.530] (-1151.790) -- 0:02:33
235000 -- [-1136.191] (-1140.617) (-1144.671) (-1152.777) * [-1142.708] (-1141.709) (-1148.463) (-1143.187) -- 0:02:36
Average standard deviation of split frequencies: 0.009373
236000 -- (-1146.393) (-1148.864) (-1149.537) [-1145.372] * (-1144.610) (-1144.110) (-1150.531) [-1138.395] -- 0:02:35
237000 -- [-1146.485] (-1150.491) (-1148.071) (-1147.072) * (-1143.824) (-1143.635) (-1145.019) [-1143.241] -- 0:02:34
238000 -- (-1141.790) (-1145.238) [-1138.354] (-1150.057) * [-1137.898] (-1141.850) (-1154.034) (-1146.910) -- 0:02:33
239000 -- (-1143.829) (-1145.989) (-1141.178) [-1140.405] * [-1146.591] (-1143.080) (-1150.335) (-1152.762) -- 0:02:32
240000 -- [-1146.735] (-1141.967) (-1155.392) (-1142.820) * (-1142.281) [-1147.563] (-1149.009) (-1134.433) -- 0:02:35
Average standard deviation of split frequencies: 0.008739
241000 -- [-1143.000] (-1143.372) (-1153.512) (-1143.942) * (-1138.698) (-1147.175) (-1145.409) [-1142.997] -- 0:02:34
242000 -- [-1140.045] (-1149.584) (-1142.098) (-1145.367) * (-1157.905) (-1145.269) [-1140.128] (-1158.429) -- 0:02:33
243000 -- (-1138.389) [-1143.834] (-1143.691) (-1148.631) * (-1149.070) [-1142.193] (-1145.120) (-1140.773) -- 0:02:32
244000 -- (-1141.690) (-1145.092) (-1143.406) [-1143.476] * (-1143.242) [-1141.149] (-1143.699) (-1144.621) -- 0:02:31
245000 -- [-1139.367] (-1143.456) (-1144.289) (-1146.737) * (-1143.433) (-1145.646) [-1145.585] (-1137.870) -- 0:02:34
Average standard deviation of split frequencies: 0.008697
246000 -- (-1138.830) [-1140.183] (-1146.919) (-1150.605) * [-1144.165] (-1139.217) (-1152.393) (-1154.065) -- 0:02:33
247000 -- [-1139.647] (-1145.228) (-1144.818) (-1150.913) * [-1140.592] (-1145.881) (-1149.237) (-1143.757) -- 0:02:32
248000 -- (-1135.936) (-1145.865) [-1141.894] (-1148.948) * (-1147.699) (-1142.936) (-1145.972) [-1140.153] -- 0:02:31
249000 -- (-1137.481) (-1139.132) [-1145.614] (-1148.535) * (-1147.489) [-1141.819] (-1142.575) (-1142.910) -- 0:02:30
250000 -- (-1144.734) [-1143.605] (-1145.649) (-1143.159) * (-1138.368) (-1147.698) [-1138.645] (-1139.037) -- 0:02:33
Average standard deviation of split frequencies: 0.008535
251000 -- (-1138.404) [-1136.934] (-1138.928) (-1146.420) * (-1143.898) (-1148.237) [-1143.117] (-1144.759) -- 0:02:32
252000 -- [-1142.877] (-1148.793) (-1145.397) (-1144.676) * [-1139.627] (-1157.867) (-1151.159) (-1140.063) -- 0:02:31
253000 -- [-1140.858] (-1144.834) (-1139.629) (-1143.072) * (-1141.088) (-1147.381) [-1140.468] (-1139.540) -- 0:02:30
254000 -- (-1143.335) (-1141.402) (-1146.537) [-1140.045] * (-1145.051) (-1143.142) [-1140.867] (-1140.686) -- 0:02:29
255000 -- (-1153.184) [-1143.251] (-1145.757) (-1144.712) * (-1144.096) [-1141.357] (-1143.154) (-1140.115) -- 0:02:31
Average standard deviation of split frequencies: 0.009915
256000 -- (-1159.940) [-1143.444] (-1145.060) (-1155.671) * (-1155.135) (-1156.404) [-1141.884] (-1139.170) -- 0:02:31
257000 -- (-1153.446) (-1149.052) [-1138.492] (-1141.103) * (-1143.258) [-1142.580] (-1143.772) (-1150.023) -- 0:02:30
258000 -- (-1147.059) [-1143.262] (-1145.731) (-1138.935) * (-1141.205) (-1142.433) [-1141.199] (-1144.986) -- 0:02:29
259000 -- (-1139.101) [-1142.573] (-1140.704) (-1141.217) * (-1143.222) [-1137.699] (-1148.680) (-1146.625) -- 0:02:28
260000 -- (-1141.034) (-1147.722) (-1141.093) [-1133.610] * [-1145.547] (-1139.313) (-1161.397) (-1145.691) -- 0:02:30
Average standard deviation of split frequencies: 0.009599
261000 -- [-1141.654] (-1150.434) (-1140.954) (-1145.796) * (-1141.866) [-1141.338] (-1149.695) (-1144.194) -- 0:02:30
262000 -- (-1144.203) [-1145.214] (-1138.474) (-1145.504) * (-1155.755) [-1146.931] (-1143.547) (-1144.447) -- 0:02:29
263000 -- (-1141.260) (-1137.397) [-1143.024] (-1137.622) * [-1141.216] (-1149.095) (-1141.139) (-1138.586) -- 0:02:28
264000 -- (-1146.325) (-1140.469) [-1140.208] (-1140.562) * (-1145.450) (-1146.110) (-1153.302) [-1140.429] -- 0:02:27
265000 -- (-1152.488) (-1141.152) (-1145.276) [-1139.569] * (-1140.229) [-1137.164] (-1144.898) (-1146.296) -- 0:02:29
Average standard deviation of split frequencies: 0.009679
266000 -- (-1143.122) (-1149.539) (-1145.280) [-1138.953] * (-1144.059) [-1143.718] (-1144.619) (-1149.367) -- 0:02:29
267000 -- (-1149.811) (-1144.733) [-1140.625] (-1143.856) * [-1137.180] (-1135.376) (-1139.951) (-1144.397) -- 0:02:28
268000 -- (-1144.257) [-1140.709] (-1147.969) (-1147.384) * (-1141.829) (-1147.155) [-1141.587] (-1145.602) -- 0:02:27
269000 -- (-1146.612) (-1143.853) [-1136.446] (-1143.558) * (-1141.324) (-1139.333) [-1143.799] (-1160.616) -- 0:02:26
270000 -- (-1151.211) (-1141.700) [-1142.916] (-1143.224) * [-1143.408] (-1144.699) (-1142.406) (-1148.968) -- 0:02:28
Average standard deviation of split frequencies: 0.010718
271000 -- (-1153.615) [-1138.771] (-1139.314) (-1142.060) * [-1140.073] (-1145.890) (-1147.589) (-1141.299) -- 0:02:27
272000 -- (-1144.369) (-1141.450) (-1142.918) [-1144.037] * (-1139.507) (-1144.969) (-1139.918) [-1137.631] -- 0:02:27
273000 -- (-1142.619) (-1149.377) (-1146.016) [-1138.858] * (-1149.837) (-1140.544) (-1140.196) [-1144.717] -- 0:02:26
274000 -- (-1150.035) [-1145.931] (-1136.792) (-1144.996) * (-1144.220) [-1141.336] (-1145.926) (-1140.951) -- 0:02:25
275000 -- (-1148.530) (-1143.290) (-1135.712) [-1146.716] * [-1144.096] (-1137.576) (-1144.256) (-1143.461) -- 0:02:27
Average standard deviation of split frequencies: 0.010379
276000 -- (-1143.311) (-1139.827) [-1147.431] (-1141.820) * [-1143.453] (-1136.624) (-1138.395) (-1149.980) -- 0:02:26
277000 -- (-1151.915) (-1144.588) (-1139.198) [-1139.048] * [-1139.969] (-1139.798) (-1139.601) (-1149.667) -- 0:02:26
278000 -- (-1140.957) [-1137.481] (-1142.610) (-1147.521) * (-1142.101) [-1143.951] (-1134.866) (-1151.759) -- 0:02:25
279000 -- (-1142.247) (-1150.216) [-1142.755] (-1142.377) * (-1146.953) (-1141.657) (-1139.751) [-1138.315] -- 0:02:24
280000 -- (-1141.111) (-1144.845) [-1139.619] (-1139.987) * (-1151.011) (-1149.951) [-1137.990] (-1145.947) -- 0:02:26
Average standard deviation of split frequencies: 0.010207
281000 -- (-1136.683) (-1149.567) [-1144.498] (-1140.214) * (-1142.287) (-1149.642) (-1145.843) [-1145.514] -- 0:02:25
282000 -- (-1158.865) (-1139.434) (-1149.521) [-1142.364] * [-1145.235] (-1142.525) (-1142.215) (-1139.833) -- 0:02:25
283000 -- (-1144.361) (-1148.512) [-1139.207] (-1146.209) * [-1145.230] (-1139.009) (-1143.097) (-1140.128) -- 0:02:24
284000 -- [-1137.545] (-1161.297) (-1138.765) (-1143.034) * (-1153.355) (-1145.138) (-1140.570) [-1138.672] -- 0:02:23
285000 -- (-1151.990) [-1145.298] (-1148.771) (-1145.208) * [-1146.971] (-1141.806) (-1137.139) (-1144.982) -- 0:02:25
Average standard deviation of split frequencies: 0.009890
286000 -- (-1146.254) [-1145.865] (-1144.023) (-1148.458) * (-1146.303) [-1140.473] (-1142.229) (-1141.567) -- 0:02:24
287000 -- (-1141.310) (-1141.811) [-1144.447] (-1147.812) * (-1142.515) [-1142.266] (-1148.658) (-1146.500) -- 0:02:24
288000 -- [-1139.900] (-1145.837) (-1139.318) (-1140.338) * [-1139.000] (-1139.337) (-1139.763) (-1139.037) -- 0:02:23
289000 -- (-1142.639) [-1141.367] (-1138.469) (-1146.562) * (-1142.329) (-1139.009) (-1143.621) [-1140.199] -- 0:02:22
290000 -- (-1141.287) (-1153.637) (-1143.491) [-1145.431] * (-1137.758) [-1143.216] (-1146.882) (-1150.352) -- 0:02:24
Average standard deviation of split frequencies: 0.008982
291000 -- (-1146.406) (-1150.736) [-1138.797] (-1141.875) * (-1143.475) (-1146.168) [-1144.363] (-1142.034) -- 0:02:23
292000 -- [-1141.680] (-1144.380) (-1137.399) (-1144.463) * [-1146.334] (-1146.790) (-1140.279) (-1141.061) -- 0:02:23
293000 -- (-1141.003) [-1137.916] (-1142.035) (-1144.591) * (-1141.072) (-1144.327) [-1138.126] (-1147.406) -- 0:02:22
294000 -- [-1136.242] (-1152.144) (-1151.081) (-1146.541) * (-1150.941) (-1149.062) (-1140.118) [-1145.948] -- 0:02:21
295000 -- (-1147.250) (-1139.303) (-1150.229) [-1141.449] * (-1143.121) (-1142.822) [-1142.900] (-1135.564) -- 0:02:23
Average standard deviation of split frequencies: 0.010046
296000 -- (-1139.972) (-1144.321) (-1157.617) [-1150.323] * (-1155.828) (-1145.372) (-1148.300) [-1140.292] -- 0:02:22
297000 -- [-1138.353] (-1142.875) (-1148.983) (-1142.172) * (-1142.811) [-1143.890] (-1146.672) (-1142.285) -- 0:02:22
298000 -- (-1141.977) [-1140.343] (-1145.881) (-1141.434) * (-1141.350) (-1144.550) [-1144.422] (-1143.572) -- 0:02:21
299000 -- (-1149.166) (-1138.169) [-1146.569] (-1142.333) * (-1156.762) (-1146.715) [-1142.430] (-1148.318) -- 0:02:20
300000 -- (-1139.493) (-1143.070) (-1149.188) [-1141.174] * (-1148.040) [-1144.486] (-1142.278) (-1136.506) -- 0:02:22
Average standard deviation of split frequencies: 0.010493
301000 -- [-1142.588] (-1145.824) (-1147.279) (-1145.711) * (-1141.937) (-1144.064) [-1141.016] (-1144.353) -- 0:02:21
302000 -- (-1139.070) (-1152.187) (-1135.720) [-1140.301] * (-1147.347) (-1144.636) (-1147.829) [-1137.062] -- 0:02:20
303000 -- (-1145.583) [-1143.367] (-1139.421) (-1140.908) * (-1143.782) [-1139.928] (-1140.088) (-1140.017) -- 0:02:20
304000 -- (-1142.920) [-1142.476] (-1143.153) (-1150.068) * (-1137.141) (-1152.594) [-1135.786] (-1138.141) -- 0:02:19
305000 -- (-1140.968) [-1146.006] (-1144.260) (-1139.803) * (-1140.107) (-1141.531) (-1142.540) [-1143.216] -- 0:02:21
Average standard deviation of split frequencies: 0.011613
306000 -- (-1146.713) (-1143.066) (-1142.956) [-1141.752] * (-1138.497) (-1146.788) [-1142.531] (-1139.700) -- 0:02:20
307000 -- (-1146.897) (-1136.336) (-1140.578) [-1139.690] * (-1144.909) (-1156.838) (-1144.194) [-1139.444] -- 0:02:19
308000 -- (-1142.577) (-1141.928) [-1141.050] (-1142.619) * (-1141.796) [-1137.187] (-1143.267) (-1139.285) -- 0:02:19
309000 -- (-1145.970) [-1140.596] (-1140.059) (-1145.224) * (-1140.586) [-1138.907] (-1147.310) (-1138.680) -- 0:02:18
310000 -- [-1137.786] (-1137.314) (-1142.956) (-1151.416) * (-1145.771) (-1142.955) (-1153.224) [-1139.803] -- 0:02:20
Average standard deviation of split frequencies: 0.010738
311000 -- (-1140.391) (-1149.320) (-1139.222) [-1144.378] * [-1143.169] (-1142.537) (-1145.608) (-1141.585) -- 0:02:19
312000 -- (-1143.691) (-1139.600) [-1138.869] (-1149.706) * (-1140.797) [-1139.506] (-1138.005) (-1140.843) -- 0:02:18
313000 -- (-1143.644) (-1144.634) (-1146.665) [-1142.682] * [-1143.838] (-1148.154) (-1139.883) (-1147.842) -- 0:02:18
314000 -- (-1148.765) (-1144.753) [-1144.218] (-1143.734) * (-1151.697) (-1142.057) [-1142.429] (-1142.610) -- 0:02:17
315000 -- [-1140.676] (-1154.254) (-1148.883) (-1140.724) * (-1143.295) (-1140.910) [-1146.409] (-1136.968) -- 0:02:19
Average standard deviation of split frequencies: 0.009410
316000 -- [-1154.209] (-1148.464) (-1141.606) (-1148.019) * (-1146.593) [-1142.303] (-1140.834) (-1139.498) -- 0:02:18
317000 -- (-1142.545) (-1150.719) (-1141.205) [-1142.491] * (-1147.188) (-1143.061) [-1143.660] (-1143.020) -- 0:02:17
318000 -- (-1139.929) (-1139.905) (-1149.898) [-1143.016] * (-1139.072) (-1146.561) [-1142.603] (-1138.387) -- 0:02:17
319000 -- (-1136.806) (-1141.459) [-1143.767] (-1140.858) * (-1138.939) (-1140.418) [-1140.135] (-1143.437) -- 0:02:16
320000 -- (-1153.676) [-1135.378] (-1146.891) (-1140.146) * [-1140.855] (-1142.717) (-1157.574) (-1142.853) -- 0:02:18
Average standard deviation of split frequencies: 0.009273
321000 -- (-1144.025) (-1145.685) (-1144.445) [-1141.389] * (-1147.908) [-1141.956] (-1143.262) (-1139.907) -- 0:02:17
322000 -- (-1137.674) (-1146.224) (-1140.875) [-1140.845] * (-1146.163) [-1141.554] (-1140.554) (-1142.339) -- 0:02:16
323000 -- [-1139.644] (-1141.469) (-1144.314) (-1145.842) * [-1133.828] (-1145.978) (-1141.561) (-1144.539) -- 0:02:16
324000 -- (-1146.010) (-1141.982) (-1141.030) [-1145.081] * [-1141.487] (-1139.419) (-1146.853) (-1140.455) -- 0:02:15
325000 -- (-1144.173) (-1142.227) (-1148.749) [-1141.432] * [-1137.695] (-1146.359) (-1142.021) (-1136.441) -- 0:02:17
Average standard deviation of split frequencies: 0.009566
326000 -- (-1142.655) (-1143.377) [-1141.645] (-1138.716) * (-1147.462) (-1139.302) (-1139.171) [-1140.830] -- 0:02:16
327000 -- (-1142.881) (-1138.537) (-1146.231) [-1137.192] * (-1145.072) [-1137.659] (-1143.390) (-1141.362) -- 0:02:15
328000 -- [-1145.012] (-1141.625) (-1139.752) (-1143.706) * (-1158.352) [-1134.548] (-1144.181) (-1139.910) -- 0:02:15
329000 -- (-1141.188) [-1136.836] (-1137.907) (-1148.487) * (-1136.625) [-1146.753] (-1160.585) (-1152.693) -- 0:02:16
330000 -- (-1154.470) [-1140.780] (-1142.259) (-1154.811) * [-1144.347] (-1161.898) (-1143.430) (-1150.773) -- 0:02:16
Average standard deviation of split frequencies: 0.009650
331000 -- (-1150.659) [-1146.666] (-1139.646) (-1147.466) * [-1138.413] (-1141.136) (-1145.606) (-1145.341) -- 0:02:15
332000 -- (-1145.172) [-1148.942] (-1140.605) (-1149.401) * [-1136.603] (-1139.743) (-1144.436) (-1141.336) -- 0:02:14
333000 -- [-1147.411] (-1145.558) (-1143.681) (-1147.462) * (-1142.804) [-1144.757] (-1146.049) (-1140.225) -- 0:02:14
334000 -- (-1140.356) (-1146.292) [-1142.224] (-1151.385) * (-1141.634) (-1144.961) (-1141.912) [-1144.960] -- 0:02:15
335000 -- (-1147.640) [-1142.102] (-1136.559) (-1138.093) * (-1142.491) (-1140.929) [-1140.872] (-1138.168) -- 0:02:14
Average standard deviation of split frequencies: 0.009713
336000 -- (-1135.491) [-1141.242] (-1147.948) (-1141.269) * (-1134.012) (-1139.629) (-1142.632) [-1139.609] -- 0:02:14
337000 -- (-1160.092) (-1145.876) [-1138.454] (-1143.994) * [-1135.174] (-1150.084) (-1147.359) (-1136.419) -- 0:02:13
338000 -- (-1145.506) (-1143.655) [-1137.365] (-1142.920) * [-1138.452] (-1141.257) (-1141.290) (-1141.977) -- 0:02:13
339000 -- (-1144.976) [-1144.140] (-1148.129) (-1145.612) * (-1138.439) (-1138.455) (-1141.425) [-1142.424] -- 0:02:14
340000 -- (-1142.278) (-1142.248) (-1148.497) [-1145.347] * (-1133.701) [-1144.037] (-1147.830) (-1141.143) -- 0:02:13
Average standard deviation of split frequencies: 0.010112
341000 -- (-1146.564) (-1142.590) [-1143.279] (-1146.455) * (-1150.283) [-1144.366] (-1143.991) (-1143.096) -- 0:02:13
342000 -- (-1138.042) [-1140.534] (-1144.272) (-1147.406) * (-1150.481) (-1143.237) [-1137.265] (-1141.211) -- 0:02:12
343000 -- (-1150.004) [-1146.307] (-1152.611) (-1145.508) * (-1139.847) [-1143.675] (-1143.145) (-1155.046) -- 0:02:12
344000 -- (-1144.323) (-1143.004) (-1145.314) [-1142.354] * (-1142.708) (-1139.726) [-1145.929] (-1137.577) -- 0:02:13
345000 -- [-1139.275] (-1146.939) (-1146.944) (-1142.878) * (-1148.121) (-1146.692) [-1143.910] (-1141.848) -- 0:02:12
Average standard deviation of split frequencies: 0.008489
346000 -- (-1149.021) (-1147.132) [-1140.937] (-1146.793) * (-1149.140) (-1142.852) [-1135.792] (-1144.192) -- 0:02:12
347000 -- [-1151.578] (-1141.373) (-1146.987) (-1150.098) * (-1147.295) (-1146.842) [-1140.815] (-1141.807) -- 0:02:11
348000 -- (-1139.347) (-1145.639) [-1139.982] (-1139.908) * (-1150.498) [-1140.727] (-1141.714) (-1144.396) -- 0:02:11
349000 -- (-1144.895) [-1143.413] (-1138.827) (-1146.109) * (-1145.233) (-1149.248) [-1138.631] (-1143.670) -- 0:02:12
350000 -- (-1138.763) [-1140.179] (-1147.803) (-1142.487) * [-1145.848] (-1149.579) (-1149.403) (-1143.799) -- 0:02:11
Average standard deviation of split frequencies: 0.008169
351000 -- (-1147.202) (-1160.090) [-1136.478] (-1141.147) * (-1147.997) (-1143.812) (-1144.072) [-1137.995] -- 0:02:11
352000 -- (-1146.378) (-1143.072) [-1142.963] (-1139.972) * (-1148.149) (-1154.808) [-1145.670] (-1140.694) -- 0:02:10
353000 -- (-1144.991) (-1147.095) [-1150.921] (-1142.879) * (-1146.453) (-1148.547) (-1143.981) [-1138.843] -- 0:02:10
354000 -- [-1145.905] (-1142.102) (-1159.986) (-1136.725) * (-1148.825) (-1151.760) (-1148.209) [-1143.989] -- 0:02:11
355000 -- (-1145.941) [-1140.867] (-1139.316) (-1144.170) * (-1146.924) [-1143.257] (-1135.777) (-1146.966) -- 0:02:10
Average standard deviation of split frequencies: 0.009371
356000 -- (-1153.220) (-1147.043) (-1139.479) [-1139.340] * [-1140.803] (-1144.136) (-1148.688) (-1145.967) -- 0:02:10
357000 -- (-1145.055) (-1145.851) (-1144.541) [-1141.982] * (-1141.689) (-1143.374) (-1146.527) [-1135.319] -- 0:02:09
358000 -- (-1146.817) (-1144.909) (-1145.120) [-1139.487] * (-1144.010) (-1143.593) (-1137.287) [-1141.432] -- 0:02:09
359000 -- (-1150.520) (-1135.927) (-1142.665) [-1141.819] * [-1137.937] (-1145.676) (-1139.552) (-1143.818) -- 0:02:10
360000 -- (-1144.867) [-1139.878] (-1150.375) (-1140.431) * [-1137.608] (-1153.365) (-1143.749) (-1138.540) -- 0:02:09
Average standard deviation of split frequencies: 0.008948
361000 -- (-1152.295) (-1140.947) (-1141.104) [-1143.745] * (-1143.989) [-1144.981] (-1142.076) (-1139.847) -- 0:02:09
362000 -- (-1141.165) [-1138.752] (-1140.944) (-1139.094) * (-1141.129) (-1142.441) (-1151.166) [-1139.417] -- 0:02:08
363000 -- (-1145.370) [-1145.314] (-1142.859) (-1138.231) * [-1142.696] (-1142.266) (-1146.581) (-1142.762) -- 0:02:08
364000 -- (-1151.007) (-1142.293) (-1137.280) [-1141.732] * [-1138.586] (-1141.532) (-1144.512) (-1145.503) -- 0:02:09
365000 -- [-1145.023] (-1149.188) (-1143.541) (-1135.064) * (-1147.613) [-1137.879] (-1137.866) (-1154.979) -- 0:02:08
Average standard deviation of split frequencies: 0.008421
366000 -- (-1147.925) (-1144.962) [-1141.289] (-1144.252) * (-1147.644) [-1142.556] (-1139.971) (-1140.278) -- 0:02:08
367000 -- [-1144.428] (-1146.312) (-1140.361) (-1149.317) * (-1149.112) (-1143.280) (-1147.150) [-1143.141] -- 0:02:07
368000 -- (-1149.188) (-1138.377) [-1145.443] (-1138.771) * (-1145.901) [-1136.761] (-1144.401) (-1147.624) -- 0:02:07
369000 -- (-1153.375) (-1146.434) [-1142.977] (-1141.893) * (-1142.356) (-1151.898) [-1140.381] (-1146.465) -- 0:02:08
370000 -- [-1142.898] (-1151.576) (-1143.369) (-1146.127) * (-1146.914) (-1146.268) [-1139.676] (-1147.660) -- 0:02:07
Average standard deviation of split frequencies: 0.008413
371000 -- (-1138.969) (-1141.704) (-1146.974) [-1144.046] * [-1141.328] (-1139.991) (-1141.934) (-1137.618) -- 0:02:07
372000 -- [-1140.898] (-1148.134) (-1142.064) (-1146.494) * (-1146.757) (-1151.758) [-1139.474] (-1145.011) -- 0:02:06
373000 -- (-1146.893) (-1139.926) (-1155.840) [-1138.931] * (-1148.915) (-1143.663) [-1140.670] (-1139.464) -- 0:02:06
374000 -- (-1140.494) (-1144.587) [-1139.607] (-1147.003) * (-1142.451) (-1144.584) [-1143.429] (-1153.405) -- 0:02:07
375000 -- (-1147.039) (-1145.682) (-1137.249) [-1149.812] * (-1139.419) (-1142.388) (-1146.772) [-1153.521] -- 0:02:06
Average standard deviation of split frequencies: 0.008198
376000 -- (-1147.213) [-1144.099] (-1140.790) (-1142.164) * [-1139.972] (-1142.932) (-1139.424) (-1138.419) -- 0:02:06
377000 -- (-1147.019) (-1145.398) (-1143.893) [-1142.009] * (-1142.721) [-1146.081] (-1142.567) (-1141.502) -- 0:02:05
378000 -- [-1141.245] (-1139.688) (-1141.285) (-1151.935) * [-1144.919] (-1150.601) (-1139.861) (-1145.823) -- 0:02:05
379000 -- (-1140.165) [-1141.694] (-1140.229) (-1136.624) * (-1138.527) (-1135.718) (-1146.485) [-1139.690] -- 0:02:06
380000 -- (-1148.997) (-1142.512) (-1144.609) [-1133.621] * (-1139.761) (-1143.861) [-1140.773] (-1140.082) -- 0:02:05
Average standard deviation of split frequencies: 0.008764
381000 -- (-1146.933) (-1139.048) [-1146.920] (-1142.164) * (-1141.115) (-1137.648) (-1140.266) [-1141.729] -- 0:02:05
382000 -- (-1149.235) [-1138.914] (-1155.008) (-1140.500) * [-1142.402] (-1141.873) (-1135.735) (-1149.813) -- 0:02:04
383000 -- (-1148.883) [-1139.382] (-1136.649) (-1144.070) * [-1141.684] (-1146.172) (-1144.965) (-1153.695) -- 0:02:04
384000 -- (-1145.840) (-1139.302) (-1149.027) [-1138.932] * [-1144.708] (-1140.127) (-1149.477) (-1149.469) -- 0:02:05
385000 -- (-1140.109) [-1134.578] (-1142.365) (-1141.706) * [-1136.566] (-1135.062) (-1150.922) (-1145.895) -- 0:02:04
Average standard deviation of split frequencies: 0.008643
386000 -- (-1140.830) (-1143.977) [-1141.254] (-1139.983) * (-1142.065) (-1141.968) (-1140.002) [-1144.920] -- 0:02:04
387000 -- (-1147.605) [-1138.173] (-1148.585) (-1141.823) * (-1148.833) (-1138.410) [-1141.962] (-1146.653) -- 0:02:03
388000 -- (-1142.177) (-1139.030) (-1144.050) [-1142.202] * (-1146.594) [-1146.780] (-1142.202) (-1147.525) -- 0:02:03
389000 -- [-1143.725] (-1139.190) (-1146.776) (-1137.808) * (-1144.085) (-1146.516) [-1149.956] (-1144.359) -- 0:02:04
390000 -- (-1147.813) (-1152.377) (-1142.445) [-1141.147] * (-1142.252) [-1145.044] (-1143.380) (-1137.087) -- 0:02:03
Average standard deviation of split frequencies: 0.008447
391000 -- (-1140.450) (-1136.483) (-1139.789) [-1139.066] * [-1143.731] (-1144.238) (-1141.330) (-1145.195) -- 0:02:03
392000 -- (-1135.710) (-1144.339) (-1146.430) [-1138.746] * [-1143.914] (-1145.701) (-1148.948) (-1142.244) -- 0:02:02
393000 -- (-1142.538) (-1137.162) (-1142.771) [-1143.174] * [-1142.953] (-1141.800) (-1142.647) (-1145.737) -- 0:02:02
394000 -- [-1147.383] (-1138.410) (-1140.343) (-1145.610) * (-1146.624) [-1145.884] (-1148.251) (-1148.961) -- 0:02:03
395000 -- [-1138.001] (-1135.788) (-1147.815) (-1141.492) * (-1147.311) [-1134.659] (-1141.559) (-1144.085) -- 0:02:02
Average standard deviation of split frequencies: 0.008608
396000 -- (-1141.032) (-1137.512) (-1145.295) [-1139.883] * (-1160.308) [-1149.877] (-1140.375) (-1145.605) -- 0:02:02
397000 -- [-1146.942] (-1142.456) (-1141.546) (-1141.020) * [-1143.430] (-1147.254) (-1154.446) (-1136.645) -- 0:02:01
398000 -- [-1145.626] (-1141.944) (-1146.546) (-1140.109) * (-1139.656) (-1156.900) [-1145.287] (-1139.817) -- 0:02:01
399000 -- (-1142.141) (-1143.876) [-1144.505] (-1136.102) * [-1141.980] (-1149.442) (-1145.140) (-1142.616) -- 0:02:02
400000 -- (-1138.838) (-1147.754) [-1142.062] (-1142.346) * [-1144.104] (-1147.106) (-1143.239) (-1138.708) -- 0:02:01
Average standard deviation of split frequencies: 0.008869
401000 -- (-1146.135) (-1148.831) [-1139.027] (-1140.439) * (-1139.192) (-1145.834) (-1143.517) [-1144.108] -- 0:02:00
402000 -- [-1140.299] (-1146.144) (-1152.007) (-1146.884) * [-1141.006] (-1151.186) (-1146.119) (-1148.036) -- 0:02:00
403000 -- (-1138.812) (-1139.306) (-1139.161) [-1150.438] * [-1145.165] (-1140.833) (-1139.113) (-1140.667) -- 0:01:59
404000 -- (-1145.858) (-1136.675) (-1142.210) [-1144.985] * [-1134.485] (-1143.539) (-1140.806) (-1140.760) -- 0:02:00
405000 -- (-1145.841) (-1136.722) [-1144.305] (-1144.116) * (-1139.645) (-1141.890) (-1141.396) [-1140.773] -- 0:02:00
Average standard deviation of split frequencies: 0.008753
406000 -- (-1143.671) (-1147.716) [-1135.799] (-1145.445) * [-1142.268] (-1138.871) (-1150.817) (-1137.403) -- 0:01:59
407000 -- (-1149.744) [-1138.696] (-1145.847) (-1150.999) * (-1153.479) [-1141.071] (-1148.970) (-1145.832) -- 0:01:59
408000 -- (-1137.565) (-1144.588) [-1145.667] (-1148.026) * (-1146.963) [-1139.384] (-1143.929) (-1142.730) -- 0:01:58
409000 -- (-1142.710) [-1141.135] (-1143.675) (-1143.602) * (-1147.842) [-1143.455] (-1137.757) (-1145.884) -- 0:01:59
410000 -- (-1141.329) [-1136.372] (-1146.007) (-1142.607) * (-1144.893) (-1150.159) [-1140.242] (-1152.682) -- 0:01:59
Average standard deviation of split frequencies: 0.008565
411000 -- (-1139.702) (-1148.697) (-1149.252) [-1141.550] * [-1142.856] (-1148.490) (-1151.406) (-1147.328) -- 0:01:58
412000 -- (-1144.849) (-1143.210) [-1143.844] (-1141.376) * [-1135.610] (-1143.884) (-1146.955) (-1140.803) -- 0:01:58
413000 -- (-1147.290) [-1143.963] (-1141.522) (-1146.785) * [-1144.866] (-1144.480) (-1145.535) (-1141.910) -- 0:01:59
414000 -- (-1138.611) [-1143.135] (-1144.166) (-1135.935) * [-1138.787] (-1136.335) (-1138.299) (-1139.820) -- 0:01:58
415000 -- (-1152.188) (-1142.031) (-1139.188) [-1144.185] * (-1137.938) (-1148.312) (-1146.991) [-1139.883] -- 0:01:58
Average standard deviation of split frequencies: 0.008194
416000 -- (-1140.446) [-1136.934] (-1145.575) (-1142.174) * (-1144.700) (-1138.500) (-1144.899) [-1138.348] -- 0:01:57
417000 -- [-1147.162] (-1145.544) (-1143.490) (-1144.418) * (-1139.206) [-1142.242] (-1140.302) (-1150.276) -- 0:01:57
418000 -- (-1148.069) (-1136.117) [-1140.944] (-1145.347) * (-1141.393) (-1137.850) [-1138.850] (-1139.452) -- 0:01:58
419000 -- (-1143.488) (-1141.361) [-1143.511] (-1156.836) * (-1144.465) (-1139.863) (-1141.466) [-1146.547] -- 0:01:57
420000 -- (-1143.314) (-1143.214) [-1137.974] (-1145.515) * (-1136.921) (-1145.662) (-1141.745) [-1148.347] -- 0:01:57
Average standard deviation of split frequencies: 0.009310
421000 -- (-1139.873) [-1141.031] (-1141.847) (-1148.354) * (-1146.529) (-1139.022) [-1141.059] (-1146.230) -- 0:01:56
422000 -- [-1140.884] (-1142.006) (-1142.133) (-1138.650) * (-1140.338) (-1144.760) (-1142.859) [-1143.789] -- 0:01:56
423000 -- (-1143.209) (-1148.740) (-1141.559) [-1141.309] * (-1141.572) (-1152.185) (-1144.034) [-1141.192] -- 0:01:57
424000 -- (-1143.962) [-1141.182] (-1151.918) (-1145.012) * (-1138.704) [-1137.452] (-1148.956) (-1145.519) -- 0:01:56
425000 -- (-1141.333) (-1139.616) (-1138.572) [-1135.923] * (-1142.522) (-1144.111) [-1143.760] (-1136.105) -- 0:01:56
Average standard deviation of split frequencies: 0.009534
426000 -- (-1138.460) [-1140.485] (-1145.559) (-1139.724) * [-1142.328] (-1147.349) (-1144.169) (-1140.629) -- 0:01:55
427000 -- (-1141.258) [-1138.096] (-1149.588) (-1143.138) * (-1137.466) (-1147.254) (-1143.394) [-1147.411] -- 0:01:55
428000 -- [-1143.222] (-1139.910) (-1143.816) (-1145.600) * (-1147.817) [-1150.186] (-1138.373) (-1143.261) -- 0:01:56
429000 -- (-1148.076) [-1139.679] (-1142.769) (-1143.234) * [-1140.292] (-1154.272) (-1143.596) (-1142.873) -- 0:01:55
430000 -- [-1142.313] (-1149.392) (-1143.851) (-1150.873) * (-1138.156) [-1141.693] (-1143.220) (-1145.997) -- 0:01:55
Average standard deviation of split frequencies: 0.009430
431000 -- (-1142.479) [-1143.854] (-1141.525) (-1140.239) * (-1144.002) [-1138.895] (-1144.760) (-1151.277) -- 0:01:54
432000 -- (-1146.535) [-1139.738] (-1136.488) (-1150.915) * (-1139.070) [-1140.756] (-1140.202) (-1146.071) -- 0:01:54
433000 -- (-1143.963) [-1138.230] (-1146.185) (-1151.271) * (-1137.446) (-1143.513) (-1149.430) [-1141.800] -- 0:01:55
434000 -- (-1144.258) (-1145.921) (-1146.060) [-1141.957] * (-1152.446) (-1152.415) (-1149.048) [-1136.656] -- 0:01:54
435000 -- (-1153.787) (-1149.753) (-1149.008) [-1142.328] * (-1148.590) [-1148.874] (-1143.895) (-1143.756) -- 0:01:54
Average standard deviation of split frequencies: 0.009731
436000 -- (-1142.406) (-1139.785) [-1144.793] (-1145.028) * (-1140.564) [-1148.568] (-1146.994) (-1141.597) -- 0:01:53
437000 -- (-1152.218) (-1144.779) (-1140.427) [-1139.039] * (-1150.998) (-1145.730) (-1144.035) [-1137.571] -- 0:01:53
438000 -- (-1143.338) (-1147.097) [-1138.817] (-1140.494) * (-1145.684) (-1151.913) [-1145.758] (-1142.445) -- 0:01:54
439000 -- [-1139.564] (-1148.123) (-1142.764) (-1143.401) * (-1145.509) (-1143.349) (-1142.472) [-1145.345] -- 0:01:53
440000 -- (-1146.678) [-1145.403] (-1140.668) (-1144.391) * (-1142.431) (-1141.391) (-1142.851) [-1135.569] -- 0:01:53
Average standard deviation of split frequencies: 0.009299
441000 -- [-1142.467] (-1149.279) (-1136.419) (-1144.392) * (-1146.680) (-1140.877) (-1141.254) [-1141.778] -- 0:01:52
442000 -- (-1144.494) (-1141.146) [-1141.748] (-1142.001) * (-1145.754) (-1144.567) (-1139.684) [-1138.742] -- 0:01:52
443000 -- (-1150.264) (-1141.932) [-1143.264] (-1141.606) * (-1150.360) [-1136.893] (-1143.589) (-1146.656) -- 0:01:53
444000 -- (-1148.623) [-1144.231] (-1145.944) (-1148.599) * (-1147.610) (-1143.875) [-1142.262] (-1136.902) -- 0:01:52
445000 -- (-1144.609) (-1144.406) (-1141.135) [-1145.883] * (-1140.014) (-1160.120) [-1137.354] (-1145.075) -- 0:01:52
Average standard deviation of split frequencies: 0.008293
446000 -- (-1140.513) (-1142.114) (-1140.680) [-1139.158] * (-1145.293) (-1138.801) [-1138.514] (-1144.773) -- 0:01:51
447000 -- [-1140.840] (-1153.950) (-1149.262) (-1149.541) * (-1155.583) (-1146.386) (-1138.241) [-1144.134] -- 0:01:51
448000 -- (-1145.486) [-1140.591] (-1137.968) (-1143.590) * (-1142.603) (-1140.646) (-1143.154) [-1150.955] -- 0:01:52
449000 -- (-1139.278) (-1140.542) [-1140.143] (-1145.858) * (-1146.546) [-1143.390] (-1143.486) (-1147.982) -- 0:01:51
450000 -- [-1147.279] (-1138.491) (-1144.224) (-1144.003) * (-1155.032) (-1147.087) [-1137.081] (-1144.036) -- 0:01:51
Average standard deviation of split frequencies: 0.008529
451000 -- (-1143.519) (-1141.617) (-1148.716) [-1133.834] * (-1146.342) [-1139.988] (-1140.217) (-1143.680) -- 0:01:50
452000 -- (-1143.575) (-1150.353) [-1138.233] (-1142.939) * (-1141.351) [-1141.733] (-1152.871) (-1142.224) -- 0:01:50
453000 -- [-1146.047] (-1145.897) (-1139.835) (-1141.754) * [-1139.848] (-1141.065) (-1140.085) (-1149.726) -- 0:01:51
454000 -- (-1145.897) (-1137.898) [-1143.464] (-1143.610) * [-1146.345] (-1144.046) (-1151.018) (-1153.829) -- 0:01:50
455000 -- (-1160.705) (-1141.624) [-1147.102] (-1137.612) * (-1139.055) [-1141.828] (-1142.019) (-1149.273) -- 0:01:50
Average standard deviation of split frequencies: 0.008509
456000 -- (-1137.825) (-1149.450) (-1149.237) [-1140.560] * (-1141.704) (-1141.571) [-1138.237] (-1145.947) -- 0:01:49
457000 -- [-1140.990] (-1140.622) (-1147.097) (-1145.375) * (-1139.443) (-1141.336) (-1139.174) [-1134.480] -- 0:01:49
458000 -- [-1142.655] (-1143.521) (-1147.581) (-1141.786) * [-1151.434] (-1146.428) (-1138.073) (-1147.739) -- 0:01:50
459000 -- (-1148.711) (-1155.360) (-1145.955) [-1145.535] * [-1144.284] (-1149.864) (-1138.481) (-1144.634) -- 0:01:49
460000 -- (-1141.198) [-1136.282] (-1151.460) (-1140.065) * (-1142.125) [-1141.942] (-1143.401) (-1145.016) -- 0:01:49
Average standard deviation of split frequencies: 0.008816
461000 -- (-1140.914) [-1140.972] (-1146.588) (-1145.931) * (-1144.296) (-1142.402) (-1143.498) [-1145.146] -- 0:01:48
462000 -- (-1158.581) (-1141.690) (-1148.312) [-1140.419] * (-1138.629) (-1146.227) [-1140.529] (-1143.321) -- 0:01:48
463000 -- (-1140.851) (-1137.759) (-1152.632) [-1139.821] * (-1144.399) (-1145.926) (-1144.674) [-1142.290] -- 0:01:49
464000 -- [-1136.252] (-1142.235) (-1147.956) (-1144.490) * (-1134.579) [-1148.251] (-1144.229) (-1138.686) -- 0:01:48
465000 -- (-1154.711) (-1143.768) [-1138.819] (-1141.201) * (-1143.327) [-1137.610] (-1141.762) (-1140.464) -- 0:01:48
Average standard deviation of split frequencies: 0.008404
466000 -- (-1138.150) (-1143.398) [-1141.182] (-1144.876) * (-1149.140) [-1139.845] (-1145.732) (-1138.762) -- 0:01:47
467000 -- (-1148.466) (-1140.643) (-1148.627) [-1143.554] * (-1140.304) [-1138.570] (-1137.342) (-1150.092) -- 0:01:47
468000 -- (-1142.959) (-1148.546) (-1147.372) [-1147.093] * (-1149.876) (-1141.063) (-1141.132) [-1137.333] -- 0:01:47
469000 -- (-1148.933) (-1151.455) (-1147.204) [-1138.124] * [-1141.106] (-1149.002) (-1143.847) (-1140.516) -- 0:01:47
470000 -- [-1138.533] (-1147.419) (-1143.592) (-1145.666) * [-1140.713] (-1144.025) (-1148.096) (-1137.549) -- 0:01:47
Average standard deviation of split frequencies: 0.007781
471000 -- [-1136.373] (-1147.740) (-1147.759) (-1143.038) * (-1148.068) [-1139.337] (-1138.995) (-1137.884) -- 0:01:46
472000 -- [-1139.617] (-1141.324) (-1143.541) (-1146.855) * (-1141.117) (-1147.771) (-1141.492) [-1150.445] -- 0:01:46
473000 -- (-1139.870) (-1142.082) (-1138.756) [-1154.889] * [-1144.306] (-1138.720) (-1139.277) (-1141.474) -- 0:01:46
474000 -- (-1138.992) (-1144.372) [-1137.919] (-1141.146) * (-1141.304) [-1146.685] (-1146.321) (-1149.340) -- 0:01:46
475000 -- (-1143.269) (-1154.160) (-1140.794) [-1138.869] * (-1149.375) (-1147.646) (-1146.285) [-1145.816] -- 0:01:46
Average standard deviation of split frequencies: 0.008304
476000 -- (-1140.132) (-1147.832) (-1142.211) [-1147.686] * [-1145.556] (-1143.660) (-1148.013) (-1151.622) -- 0:01:45
477000 -- [-1141.893] (-1143.894) (-1137.814) (-1143.033) * (-1144.783) (-1145.245) [-1140.777] (-1147.929) -- 0:01:46
478000 -- (-1147.193) [-1144.828] (-1144.236) (-1138.306) * (-1143.297) (-1146.829) [-1141.191] (-1147.031) -- 0:01:45
479000 -- [-1147.244] (-1143.804) (-1138.559) (-1141.269) * (-1145.265) [-1140.771] (-1144.172) (-1146.451) -- 0:01:45
480000 -- [-1139.399] (-1148.383) (-1148.745) (-1136.811) * (-1139.373) [-1145.947] (-1140.035) (-1145.365) -- 0:01:45
Average standard deviation of split frequencies: 0.009430
481000 -- [-1138.783] (-1146.241) (-1145.293) (-1140.890) * (-1141.406) (-1141.207) (-1143.019) [-1144.350] -- 0:01:44
482000 -- [-1139.112] (-1145.792) (-1142.188) (-1155.204) * [-1139.617] (-1140.725) (-1145.654) (-1156.449) -- 0:01:45
483000 -- [-1141.884] (-1138.092) (-1142.966) (-1151.084) * [-1141.215] (-1144.364) (-1145.235) (-1148.857) -- 0:01:44
484000 -- (-1141.260) [-1149.920] (-1151.192) (-1146.121) * (-1143.758) (-1140.213) [-1141.026] (-1143.502) -- 0:01:44
485000 -- (-1147.477) (-1139.872) [-1151.428] (-1150.180) * [-1141.551] (-1141.165) (-1144.516) (-1150.055) -- 0:01:44
Average standard deviation of split frequencies: 0.009476
486000 -- (-1145.780) (-1135.044) (-1143.413) [-1140.492] * (-1147.469) [-1142.347] (-1145.086) (-1138.820) -- 0:01:43
487000 -- (-1143.878) [-1142.668] (-1146.572) (-1135.824) * (-1146.764) (-1146.383) (-1149.754) [-1141.843] -- 0:01:44
488000 -- (-1145.662) [-1146.389] (-1144.992) (-1142.545) * (-1149.027) (-1140.418) [-1144.553] (-1148.141) -- 0:01:43
489000 -- (-1142.565) [-1143.124] (-1150.478) (-1141.020) * [-1143.000] (-1150.143) (-1142.704) (-1142.222) -- 0:01:43
490000 -- (-1138.551) [-1141.297] (-1148.501) (-1145.396) * (-1150.872) [-1140.803] (-1141.994) (-1142.039) -- 0:01:43
Average standard deviation of split frequencies: 0.009090
491000 -- (-1144.399) [-1135.191] (-1144.387) (-1147.067) * (-1141.815) (-1146.258) (-1140.627) [-1138.850] -- 0:01:42
492000 -- (-1143.591) (-1142.795) (-1141.752) [-1139.614] * (-1139.023) (-1148.280) (-1144.311) [-1142.159] -- 0:01:43
493000 -- (-1151.151) (-1141.322) (-1150.640) [-1142.298] * (-1144.908) [-1141.002] (-1140.616) (-1141.557) -- 0:01:42
494000 -- (-1139.295) (-1144.205) [-1142.633] (-1151.688) * (-1145.994) (-1143.479) [-1141.783] (-1149.259) -- 0:01:42
495000 -- [-1140.724] (-1144.147) (-1151.320) (-1139.738) * (-1146.087) (-1144.165) (-1149.928) [-1137.211] -- 0:01:42
Average standard deviation of split frequencies: 0.009723
496000 -- (-1139.020) (-1137.633) (-1140.449) [-1143.856] * (-1140.929) [-1137.851] (-1149.235) (-1140.841) -- 0:01:41
497000 -- [-1137.793] (-1151.252) (-1140.573) (-1147.710) * (-1151.115) (-1141.936) [-1139.661] (-1145.908) -- 0:01:42
498000 -- [-1138.696] (-1145.796) (-1150.723) (-1139.524) * (-1144.199) (-1145.687) [-1136.689] (-1148.566) -- 0:01:41
499000 -- (-1140.655) [-1146.945] (-1143.157) (-1146.845) * (-1147.567) (-1144.660) [-1141.919] (-1153.966) -- 0:01:41
500000 -- [-1142.891] (-1141.776) (-1140.962) (-1145.169) * (-1136.889) (-1136.911) (-1138.275) [-1141.689] -- 0:01:41
Average standard deviation of split frequencies: 0.009053
501000 -- (-1141.337) (-1141.484) (-1145.788) [-1140.543] * [-1144.245] (-1145.368) (-1138.452) (-1138.940) -- 0:01:40
502000 -- (-1138.986) (-1141.705) [-1142.340] (-1146.900) * (-1146.284) [-1136.339] (-1141.471) (-1142.010) -- 0:01:41
503000 -- [-1137.189] (-1134.599) (-1148.860) (-1146.380) * (-1138.622) (-1138.174) (-1149.275) [-1136.351] -- 0:01:40
504000 -- (-1137.497) (-1136.875) [-1137.260] (-1140.925) * (-1144.519) (-1149.817) [-1149.348] (-1137.351) -- 0:01:40
505000 -- (-1144.387) (-1146.494) (-1141.514) [-1142.743] * (-1144.930) (-1137.467) [-1140.976] (-1142.863) -- 0:01:39
Average standard deviation of split frequencies: 0.008313
506000 -- [-1140.347] (-1148.842) (-1142.566) (-1143.028) * (-1153.808) (-1136.842) [-1142.658] (-1141.491) -- 0:01:39
507000 -- (-1144.650) [-1146.512] (-1139.754) (-1145.012) * [-1137.487] (-1143.135) (-1147.438) (-1152.437) -- 0:01:40
508000 -- (-1138.426) (-1143.342) [-1139.969] (-1143.338) * (-1143.560) (-1144.804) (-1145.561) [-1136.807] -- 0:01:39
509000 -- (-1140.742) (-1134.469) (-1144.191) [-1145.317] * (-1141.226) (-1137.723) [-1139.965] (-1140.193) -- 0:01:39
510000 -- (-1137.002) (-1139.881) (-1142.276) [-1144.256] * (-1138.790) (-1142.895) (-1149.449) [-1149.856] -- 0:01:38
Average standard deviation of split frequencies: 0.008237
511000 -- (-1141.641) [-1147.477] (-1139.224) (-1143.920) * (-1145.674) (-1142.770) [-1138.773] (-1144.486) -- 0:01:38
512000 -- (-1147.505) (-1149.111) [-1136.503] (-1147.534) * (-1146.245) (-1142.948) (-1135.235) [-1141.924] -- 0:01:39
513000 -- (-1140.112) [-1149.006] (-1149.906) (-1138.952) * (-1139.760) [-1141.492] (-1139.643) (-1151.900) -- 0:01:38
514000 -- [-1137.743] (-1145.887) (-1150.418) (-1141.605) * [-1138.639] (-1143.519) (-1147.836) (-1151.007) -- 0:01:38
515000 -- (-1137.113) (-1152.759) [-1138.269] (-1146.060) * (-1140.337) [-1140.880] (-1144.031) (-1140.333) -- 0:01:37
Average standard deviation of split frequencies: 0.008292
516000 -- (-1143.856) (-1144.164) (-1139.147) [-1147.796] * (-1141.971) (-1144.908) [-1138.616] (-1145.228) -- 0:01:38
517000 -- (-1143.984) [-1144.335] (-1143.345) (-1148.851) * (-1139.228) (-1145.454) [-1139.413] (-1142.265) -- 0:01:38
518000 -- (-1160.628) [-1152.753] (-1149.263) (-1152.109) * (-1148.060) (-1141.571) [-1148.902] (-1141.983) -- 0:01:37
519000 -- [-1141.182] (-1152.514) (-1142.499) (-1145.553) * (-1141.980) [-1139.733] (-1144.661) (-1152.306) -- 0:01:37
520000 -- [-1141.945] (-1148.584) (-1141.286) (-1148.093) * (-1139.576) (-1146.428) (-1136.225) [-1156.600] -- 0:01:36
Average standard deviation of split frequencies: 0.007313
521000 -- (-1144.994) (-1147.541) (-1147.990) [-1140.643] * (-1142.742) (-1139.382) (-1146.252) [-1137.942] -- 0:01:37
522000 -- [-1140.564] (-1150.760) (-1140.274) (-1142.805) * (-1148.446) (-1139.991) [-1138.601] (-1158.117) -- 0:01:37
523000 -- (-1142.067) (-1144.892) [-1143.181] (-1141.421) * (-1154.532) [-1139.050] (-1144.344) (-1136.088) -- 0:01:36
524000 -- (-1143.457) (-1144.437) (-1140.152) [-1147.679] * [-1144.839] (-1138.796) (-1141.059) (-1142.703) -- 0:01:36
525000 -- (-1140.724) (-1148.689) [-1142.846] (-1143.319) * (-1141.374) (-1138.266) [-1136.160] (-1146.120) -- 0:01:35
Average standard deviation of split frequencies: 0.007514
526000 -- [-1147.238] (-1144.446) (-1150.176) (-1140.845) * (-1142.642) (-1147.139) [-1134.710] (-1143.675) -- 0:01:36
527000 -- (-1149.829) [-1142.048] (-1147.328) (-1146.386) * [-1144.759] (-1135.044) (-1140.750) (-1145.688) -- 0:01:36
528000 -- (-1140.687) (-1138.970) (-1144.610) [-1141.728] * [-1150.598] (-1141.107) (-1144.688) (-1143.915) -- 0:01:35
529000 -- (-1139.367) (-1144.944) [-1144.215] (-1144.699) * (-1144.930) [-1144.412] (-1151.861) (-1145.983) -- 0:01:35
530000 -- (-1139.826) (-1144.922) (-1143.387) [-1136.728] * (-1146.167) (-1141.906) (-1142.469) [-1142.078] -- 0:01:34
Average standard deviation of split frequencies: 0.007995
531000 -- [-1144.999] (-1146.037) (-1153.790) (-1142.612) * [-1137.064] (-1142.254) (-1145.948) (-1134.363) -- 0:01:35
532000 -- (-1148.338) [-1144.155] (-1144.826) (-1139.050) * (-1146.866) (-1152.657) [-1146.796] (-1147.294) -- 0:01:35
533000 -- [-1144.910] (-1136.473) (-1148.459) (-1142.872) * (-1144.792) [-1144.283] (-1151.884) (-1135.734) -- 0:01:34
534000 -- [-1139.362] (-1142.958) (-1145.386) (-1151.926) * [-1136.709] (-1142.041) (-1145.815) (-1147.314) -- 0:01:34
535000 -- (-1142.645) (-1142.764) (-1143.810) [-1143.584] * (-1136.604) (-1144.736) [-1139.428] (-1145.457) -- 0:01:33
Average standard deviation of split frequencies: 0.007780
536000 -- [-1142.045] (-1143.872) (-1143.394) (-1149.595) * (-1149.766) [-1145.262] (-1139.237) (-1142.819) -- 0:01:34
537000 -- [-1137.167] (-1138.986) (-1143.176) (-1137.172) * (-1147.897) (-1149.696) [-1136.057] (-1147.866) -- 0:01:33
538000 -- (-1141.031) (-1152.111) [-1138.058] (-1147.770) * (-1146.773) (-1143.830) [-1141.481] (-1140.398) -- 0:01:33
539000 -- (-1146.070) (-1139.593) [-1137.942] (-1142.554) * (-1137.128) (-1154.479) [-1143.869] (-1139.202) -- 0:01:33
540000 -- [-1142.628] (-1144.075) (-1142.675) (-1143.566) * (-1146.143) (-1143.258) (-1150.012) [-1139.438] -- 0:01:32
Average standard deviation of split frequencies: 0.007780
541000 -- (-1140.285) [-1137.440] (-1145.551) (-1141.751) * (-1144.310) [-1141.615] (-1142.106) (-1141.135) -- 0:01:33
542000 -- (-1142.807) (-1139.834) (-1143.710) [-1146.196] * (-1146.121) [-1139.272] (-1140.043) (-1153.026) -- 0:01:32
543000 -- (-1138.023) [-1137.117] (-1147.795) (-1144.748) * (-1139.832) (-1138.054) [-1137.185] (-1144.797) -- 0:01:32
544000 -- (-1148.721) [-1140.557] (-1140.820) (-1147.730) * [-1143.512] (-1149.427) (-1141.593) (-1143.349) -- 0:01:32
545000 -- (-1147.113) [-1135.963] (-1134.893) (-1136.178) * (-1145.730) (-1145.689) [-1141.535] (-1140.062) -- 0:01:31
Average standard deviation of split frequencies: 0.007438
546000 -- (-1149.740) (-1142.378) (-1146.724) [-1139.174] * (-1143.102) (-1149.736) [-1141.435] (-1149.188) -- 0:01:32
547000 -- (-1136.568) (-1143.191) [-1141.000] (-1144.703) * (-1143.594) [-1140.135] (-1140.460) (-1146.213) -- 0:01:31
548000 -- (-1140.557) [-1139.849] (-1143.311) (-1141.707) * (-1144.375) (-1143.545) [-1137.532] (-1144.771) -- 0:01:31
549000 -- (-1147.951) [-1141.015] (-1144.618) (-1140.866) * (-1142.757) [-1141.374] (-1144.081) (-1140.220) -- 0:01:31
550000 -- (-1148.963) [-1143.218] (-1142.157) (-1147.559) * (-1144.399) (-1142.698) [-1143.370] (-1134.560) -- 0:01:30
Average standard deviation of split frequencies: 0.007375
551000 -- (-1148.408) (-1141.336) [-1142.137] (-1142.766) * (-1147.719) (-1148.159) (-1147.254) [-1139.749] -- 0:01:31
552000 -- [-1139.014] (-1150.862) (-1139.462) (-1142.071) * (-1145.315) (-1141.714) (-1146.921) [-1143.181] -- 0:01:30
553000 -- (-1139.576) (-1140.242) (-1142.172) [-1138.634] * (-1146.419) [-1145.773] (-1139.262) (-1147.981) -- 0:01:30
554000 -- [-1146.173] (-1146.488) (-1147.863) (-1143.846) * (-1143.566) [-1141.847] (-1144.514) (-1143.884) -- 0:01:30
555000 -- (-1144.115) (-1139.280) (-1142.424) [-1138.395] * (-1138.815) [-1138.438] (-1144.544) (-1151.385) -- 0:01:29
Average standard deviation of split frequencies: 0.007305
556000 -- (-1141.469) (-1147.310) (-1148.028) [-1138.361] * (-1143.482) (-1142.137) (-1146.376) [-1137.491] -- 0:01:30
557000 -- (-1150.209) [-1142.690] (-1141.848) (-1137.434) * [-1140.334] (-1146.737) (-1155.937) (-1141.980) -- 0:01:29
558000 -- (-1139.436) (-1143.347) (-1151.162) [-1138.175] * [-1144.342] (-1139.045) (-1144.685) (-1155.580) -- 0:01:29
559000 -- (-1143.830) [-1139.574] (-1136.895) (-1146.246) * (-1140.904) [-1144.772] (-1151.332) (-1138.683) -- 0:01:29
560000 -- [-1137.858] (-1144.537) (-1144.917) (-1142.027) * (-1141.971) (-1157.585) (-1144.869) [-1142.390] -- 0:01:28
Average standard deviation of split frequencies: 0.007826
561000 -- (-1146.993) (-1144.731) [-1143.690] (-1152.828) * [-1141.085] (-1146.993) (-1142.786) (-1145.021) -- 0:01:29
562000 -- (-1142.903) (-1141.356) [-1144.806] (-1150.975) * (-1144.679) [-1143.737] (-1143.495) (-1146.951) -- 0:01:28
563000 -- (-1136.442) [-1142.000] (-1137.969) (-1150.971) * (-1142.795) (-1141.160) (-1138.900) [-1140.442] -- 0:01:28
564000 -- (-1140.227) (-1146.039) (-1141.656) [-1142.309] * (-1140.082) (-1147.067) (-1148.819) [-1143.460] -- 0:01:28
565000 -- [-1137.349] (-1148.204) (-1144.970) (-1144.738) * (-1142.383) (-1145.434) [-1139.727] (-1144.426) -- 0:01:28
Average standard deviation of split frequencies: 0.007175
566000 -- [-1138.797] (-1142.554) (-1144.372) (-1136.223) * (-1146.167) (-1139.627) [-1141.872] (-1147.084) -- 0:01:28
567000 -- [-1146.084] (-1144.155) (-1142.810) (-1153.727) * (-1139.854) [-1143.057] (-1146.129) (-1148.879) -- 0:01:27
568000 -- (-1143.544) (-1143.413) [-1141.797] (-1146.408) * [-1140.174] (-1146.253) (-1147.023) (-1141.814) -- 0:01:27
569000 -- (-1145.948) (-1144.681) (-1139.066) [-1137.275] * [-1139.011] (-1139.295) (-1142.699) (-1146.749) -- 0:01:27
570000 -- (-1137.734) [-1139.592] (-1146.194) (-1155.225) * (-1141.180) (-1147.996) [-1139.108] (-1146.735) -- 0:01:27
Average standard deviation of split frequencies: 0.007371
571000 -- (-1144.389) (-1142.281) [-1141.592] (-1138.011) * (-1149.692) [-1138.122] (-1145.377) (-1144.119) -- 0:01:27
572000 -- (-1139.570) [-1141.381] (-1141.487) (-1148.602) * (-1141.265) (-1142.185) (-1151.858) [-1141.570] -- 0:01:26
573000 -- (-1137.430) (-1144.951) (-1138.514) [-1140.715] * [-1140.517] (-1138.326) (-1144.419) (-1140.988) -- 0:01:26
574000 -- (-1143.133) (-1147.367) [-1146.064] (-1147.674) * (-1139.361) [-1139.196] (-1147.968) (-1142.104) -- 0:01:26
575000 -- (-1146.211) (-1144.455) (-1144.115) [-1140.999] * [-1146.648] (-1141.651) (-1135.491) (-1138.828) -- 0:01:26
Average standard deviation of split frequencies: 0.007743
576000 -- [-1145.068] (-1143.575) (-1142.620) (-1144.824) * (-1141.443) (-1137.181) [-1136.924] (-1154.347) -- 0:01:26
577000 -- [-1141.421] (-1144.107) (-1139.596) (-1140.020) * [-1138.921] (-1138.147) (-1140.242) (-1146.313) -- 0:01:25
578000 -- [-1136.920] (-1144.193) (-1141.448) (-1141.853) * [-1138.871] (-1150.655) (-1139.128) (-1146.984) -- 0:01:25
579000 -- [-1142.569] (-1143.031) (-1141.011) (-1140.341) * (-1145.383) (-1154.157) [-1139.959] (-1146.243) -- 0:01:25
580000 -- (-1142.996) (-1145.163) [-1143.154] (-1143.770) * (-1139.142) [-1139.887] (-1150.527) (-1150.450) -- 0:01:25
Average standard deviation of split frequencies: 0.007619
581000 -- (-1137.606) [-1141.850] (-1143.853) (-1137.873) * (-1135.829) [-1139.307] (-1143.891) (-1136.538) -- 0:01:25
582000 -- (-1147.980) [-1136.863] (-1143.756) (-1150.591) * (-1139.004) [-1143.562] (-1155.280) (-1139.901) -- 0:01:24
583000 -- (-1140.322) [-1143.633] (-1145.707) (-1147.051) * (-1143.174) (-1143.684) [-1138.023] (-1163.250) -- 0:01:24
584000 -- [-1145.479] (-1134.845) (-1141.540) (-1140.570) * (-1146.876) (-1141.365) [-1140.665] (-1147.302) -- 0:01:24
585000 -- [-1138.074] (-1136.219) (-1149.267) (-1138.447) * (-1144.372) (-1136.641) (-1143.094) [-1139.352] -- 0:01:24
Average standard deviation of split frequencies: 0.007549
586000 -- (-1144.223) [-1138.985] (-1148.136) (-1147.214) * [-1136.638] (-1143.517) (-1145.737) (-1153.554) -- 0:01:24
587000 -- (-1146.488) (-1138.875) (-1152.364) [-1142.169] * (-1144.039) (-1140.652) [-1143.221] (-1146.900) -- 0:01:23
588000 -- [-1141.146] (-1140.755) (-1139.435) (-1139.167) * [-1142.341] (-1139.712) (-1143.869) (-1144.942) -- 0:01:23
589000 -- (-1142.197) (-1140.966) (-1140.173) [-1143.446] * (-1146.299) [-1135.306] (-1144.672) (-1150.283) -- 0:01:23
590000 -- (-1148.494) [-1141.200] (-1148.608) (-1143.013) * [-1152.101] (-1148.459) (-1144.060) (-1142.853) -- 0:01:23
Average standard deviation of split frequencies: 0.007244
591000 -- (-1141.691) [-1143.345] (-1147.662) (-1151.273) * (-1151.335) (-1144.448) [-1147.053] (-1149.452) -- 0:01:23
592000 -- [-1135.865] (-1137.883) (-1145.456) (-1141.532) * (-1140.471) (-1141.495) (-1138.978) [-1146.054] -- 0:01:22
593000 -- (-1147.332) (-1144.317) (-1140.314) [-1148.593] * [-1136.659] (-1142.613) (-1143.465) (-1149.657) -- 0:01:22
594000 -- (-1146.295) (-1141.674) [-1134.849] (-1144.644) * (-1138.041) (-1147.048) (-1142.082) [-1135.690] -- 0:01:22
595000 -- (-1147.123) (-1152.923) [-1140.220] (-1151.171) * (-1143.983) [-1139.891] (-1141.220) (-1148.002) -- 0:01:22
Average standard deviation of split frequencies: 0.007423
596000 -- [-1143.372] (-1141.218) (-1139.768) (-1136.716) * (-1141.845) (-1139.672) (-1137.631) [-1137.155] -- 0:01:22
597000 -- [-1140.607] (-1136.318) (-1145.774) (-1147.307) * (-1147.468) (-1143.302) (-1159.865) [-1141.261] -- 0:01:21
598000 -- [-1141.923] (-1144.948) (-1144.781) (-1145.373) * [-1144.500] (-1146.561) (-1135.980) (-1139.998) -- 0:01:21
599000 -- [-1144.336] (-1141.289) (-1147.960) (-1147.712) * (-1138.801) [-1143.623] (-1144.468) (-1141.041) -- 0:01:21
600000 -- (-1143.076) (-1144.211) [-1138.550] (-1137.985) * [-1143.368] (-1142.449) (-1144.815) (-1144.844) -- 0:01:21
Average standard deviation of split frequencies: 0.007425
601000 -- [-1138.983] (-1141.562) (-1140.578) (-1141.948) * (-1141.694) (-1146.196) [-1144.069] (-1144.287) -- 0:01:20
602000 -- (-1144.094) (-1140.868) [-1138.318] (-1142.783) * (-1143.876) [-1136.886] (-1145.109) (-1135.370) -- 0:01:20
603000 -- (-1152.851) [-1146.025] (-1150.072) (-1143.797) * [-1138.767] (-1144.076) (-1142.076) (-1145.113) -- 0:01:20
604000 -- (-1147.746) (-1147.780) [-1138.355] (-1144.085) * [-1147.821] (-1150.926) (-1139.576) (-1144.793) -- 0:01:20
605000 -- (-1144.208) [-1138.611] (-1141.131) (-1142.048) * [-1142.650] (-1146.670) (-1139.953) (-1141.150) -- 0:01:20
Average standard deviation of split frequencies: 0.007240
606000 -- (-1138.371) (-1144.000) [-1138.752] (-1146.885) * (-1136.952) [-1145.115] (-1143.259) (-1153.369) -- 0:01:19
607000 -- (-1141.467) (-1150.806) [-1143.469] (-1139.237) * (-1144.862) (-1143.912) (-1141.302) [-1142.011] -- 0:01:19
608000 -- (-1144.876) [-1135.380] (-1140.465) (-1146.014) * (-1140.535) (-1144.124) (-1147.392) [-1139.724] -- 0:01:19
609000 -- [-1140.521] (-1139.798) (-1146.138) (-1143.275) * (-1140.674) [-1149.892] (-1136.889) (-1149.343) -- 0:01:19
610000 -- (-1143.026) (-1142.880) [-1139.570] (-1142.400) * (-1137.219) (-1145.364) (-1136.156) [-1143.831] -- 0:01:19
Average standard deviation of split frequencies: 0.007957
611000 -- (-1142.379) [-1142.989] (-1138.045) (-1145.019) * (-1141.706) (-1138.582) [-1137.602] (-1151.478) -- 0:01:18
612000 -- (-1145.502) (-1139.911) (-1138.927) [-1142.151] * (-1152.415) [-1145.026] (-1138.662) (-1153.181) -- 0:01:18
613000 -- (-1152.208) (-1138.670) [-1134.972] (-1143.943) * (-1147.939) (-1141.513) [-1134.187] (-1148.608) -- 0:01:18
614000 -- (-1147.350) (-1141.169) (-1149.380) [-1137.028] * (-1145.245) (-1148.682) [-1137.049] (-1143.082) -- 0:01:18
615000 -- (-1147.642) (-1149.160) [-1139.620] (-1142.535) * (-1160.502) (-1138.018) (-1143.231) [-1136.548] -- 0:01:18
Average standard deviation of split frequencies: 0.007476
616000 -- [-1142.351] (-1145.186) (-1144.598) (-1140.439) * [-1141.907] (-1146.642) (-1143.109) (-1146.436) -- 0:01:17
617000 -- [-1142.427] (-1148.394) (-1156.223) (-1141.811) * (-1138.839) (-1149.477) (-1151.218) [-1143.160] -- 0:01:17
618000 -- (-1139.890) [-1137.361] (-1146.583) (-1149.901) * (-1144.955) (-1147.189) (-1144.973) [-1140.443] -- 0:01:17
619000 -- [-1142.172] (-1142.451) (-1141.606) (-1148.410) * (-1150.811) (-1142.424) (-1145.923) [-1139.868] -- 0:01:17
620000 -- (-1142.311) (-1141.549) (-1141.846) [-1145.242] * [-1139.869] (-1147.591) (-1141.578) (-1148.395) -- 0:01:17
Average standard deviation of split frequencies: 0.007420
621000 -- (-1155.108) (-1145.656) [-1148.406] (-1143.841) * (-1147.561) [-1146.314] (-1141.190) (-1146.601) -- 0:01:16
622000 -- [-1150.474] (-1139.750) (-1145.664) (-1142.387) * (-1148.390) [-1152.295] (-1149.955) (-1141.984) -- 0:01:16
623000 -- (-1141.608) [-1141.004] (-1154.570) (-1151.209) * (-1148.198) [-1141.817] (-1148.289) (-1142.753) -- 0:01:16
624000 -- [-1146.363] (-1146.589) (-1137.831) (-1141.464) * [-1137.381] (-1139.655) (-1147.593) (-1143.111) -- 0:01:16
625000 -- (-1148.898) (-1160.927) [-1141.881] (-1141.984) * (-1147.160) (-1148.167) [-1140.655] (-1145.979) -- 0:01:16
Average standard deviation of split frequencies: 0.007588
626000 -- [-1140.124] (-1150.669) (-1144.618) (-1150.745) * (-1145.789) [-1135.997] (-1140.125) (-1143.459) -- 0:01:15
627000 -- [-1138.060] (-1145.661) (-1142.243) (-1150.152) * [-1138.453] (-1147.186) (-1144.383) (-1139.779) -- 0:01:15
628000 -- (-1139.425) (-1137.069) (-1154.702) [-1136.326] * (-1144.808) (-1138.103) (-1140.778) [-1139.006] -- 0:01:15
629000 -- [-1145.836] (-1142.344) (-1146.978) (-1144.829) * [-1143.502] (-1146.046) (-1147.725) (-1142.394) -- 0:01:15
630000 -- [-1147.472] (-1144.729) (-1150.955) (-1140.863) * (-1141.873) [-1142.370] (-1154.699) (-1138.597) -- 0:01:15
Average standard deviation of split frequencies: 0.007245
631000 -- (-1140.395) (-1138.506) (-1161.212) [-1142.733] * [-1144.770] (-1149.135) (-1145.464) (-1137.163) -- 0:01:14
632000 -- (-1141.674) (-1146.942) (-1141.151) [-1140.616] * (-1140.315) (-1141.805) [-1142.686] (-1144.540) -- 0:01:14
633000 -- (-1136.251) [-1144.890] (-1141.700) (-1147.583) * (-1143.241) [-1135.419] (-1150.497) (-1142.068) -- 0:01:14
634000 -- (-1137.098) (-1146.952) (-1144.882) [-1137.919] * [-1135.456] (-1140.225) (-1145.467) (-1145.653) -- 0:01:14
635000 -- (-1143.384) (-1146.676) [-1139.756] (-1141.557) * (-1147.164) (-1139.118) (-1139.561) [-1143.620] -- 0:01:14
Average standard deviation of split frequencies: 0.007412
636000 -- (-1143.344) (-1140.620) (-1140.352) [-1139.202] * (-1136.538) [-1142.261] (-1145.276) (-1144.408) -- 0:01:13
637000 -- (-1139.742) (-1139.193) (-1141.880) [-1151.578] * (-1143.508) (-1138.887) [-1142.051] (-1144.824) -- 0:01:13
638000 -- (-1143.070) [-1142.294] (-1140.627) (-1142.191) * (-1151.720) (-1138.129) (-1138.632) [-1146.045] -- 0:01:13
639000 -- (-1144.975) (-1142.543) [-1145.213] (-1147.372) * (-1140.892) (-1144.290) (-1143.969) [-1145.347] -- 0:01:13
640000 -- [-1140.816] (-1148.537) (-1147.123) (-1137.782) * (-1141.764) (-1139.707) [-1145.390] (-1142.386) -- 0:01:13
Average standard deviation of split frequencies: 0.007132
641000 -- (-1143.520) (-1150.130) (-1142.707) [-1143.542] * (-1147.841) (-1151.895) [-1141.309] (-1146.264) -- 0:01:12
642000 -- (-1149.968) (-1144.474) (-1139.991) [-1144.709] * [-1142.249] (-1150.253) (-1141.845) (-1149.278) -- 0:01:12
643000 -- (-1141.771) (-1141.749) (-1150.433) [-1142.218] * [-1138.675] (-1147.385) (-1138.032) (-1140.473) -- 0:01:12
644000 -- [-1138.195] (-1145.300) (-1144.494) (-1143.735) * [-1140.449] (-1142.558) (-1145.073) (-1145.438) -- 0:01:12
645000 -- (-1141.748) (-1145.898) (-1141.517) [-1137.120] * (-1140.981) (-1137.953) [-1149.908] (-1148.390) -- 0:01:12
Average standard deviation of split frequencies: 0.007129
646000 -- (-1142.796) (-1145.017) (-1145.814) [-1144.607] * (-1147.293) (-1141.588) (-1142.517) [-1140.100] -- 0:01:11
647000 -- (-1141.639) (-1143.205) (-1146.954) [-1135.237] * (-1143.673) (-1140.855) [-1144.136] (-1150.116) -- 0:01:12
648000 -- [-1140.754] (-1144.632) (-1149.757) (-1143.976) * (-1139.369) (-1140.538) (-1150.501) [-1147.410] -- 0:01:11
649000 -- (-1159.842) (-1145.653) [-1141.913] (-1143.784) * [-1145.432] (-1141.468) (-1145.506) (-1149.113) -- 0:01:11
650000 -- [-1137.136] (-1139.221) (-1152.798) (-1141.082) * [-1136.729] (-1146.836) (-1139.410) (-1142.980) -- 0:01:11
Average standard deviation of split frequencies: 0.006966
651000 -- [-1136.298] (-1140.846) (-1143.069) (-1142.946) * [-1134.475] (-1150.822) (-1139.830) (-1142.524) -- 0:01:10
652000 -- (-1147.215) (-1141.779) [-1140.662] (-1144.203) * (-1145.087) (-1143.400) [-1134.901] (-1148.776) -- 0:01:10
653000 -- (-1137.977) [-1145.904] (-1135.869) (-1152.254) * (-1139.084) (-1150.026) [-1141.444] (-1141.275) -- 0:01:10
654000 -- [-1135.179] (-1144.361) (-1145.029) (-1141.462) * (-1141.661) (-1145.957) [-1137.539] (-1143.140) -- 0:01:10
655000 -- [-1139.799] (-1145.434) (-1145.438) (-1146.550) * (-1148.513) [-1141.886] (-1142.593) (-1150.867) -- 0:01:10
Average standard deviation of split frequencies: 0.007241
656000 -- (-1149.827) (-1144.535) [-1142.118] (-1145.648) * (-1140.332) [-1147.629] (-1138.715) (-1146.008) -- 0:01:09
657000 -- (-1139.666) [-1139.161] (-1142.495) (-1148.886) * [-1139.138] (-1142.364) (-1143.363) (-1142.188) -- 0:01:09
658000 -- (-1143.866) (-1139.233) [-1141.762] (-1140.747) * (-1141.388) [-1147.034] (-1147.458) (-1143.883) -- 0:01:09
659000 -- (-1144.936) [-1137.722] (-1143.233) (-1141.914) * (-1144.942) (-1143.578) [-1146.905] (-1148.218) -- 0:01:09
660000 -- (-1146.401) [-1142.843] (-1139.347) (-1141.536) * (-1140.166) [-1141.415] (-1140.669) (-1140.689) -- 0:01:09
Average standard deviation of split frequencies: 0.006751
661000 -- (-1147.878) (-1155.391) (-1138.563) [-1144.768] * (-1139.659) (-1144.515) (-1147.505) [-1141.450] -- 0:01:08
662000 -- (-1143.210) (-1144.650) (-1138.317) [-1140.122] * (-1148.887) (-1145.324) (-1140.614) [-1140.460] -- 0:01:08
663000 -- [-1141.488] (-1143.447) (-1139.909) (-1145.500) * (-1150.327) [-1139.031] (-1140.098) (-1149.778) -- 0:01:08
664000 -- (-1143.659) (-1137.716) (-1139.754) [-1143.705] * (-1146.809) (-1145.311) [-1142.251] (-1147.261) -- 0:01:08
665000 -- (-1148.224) (-1133.616) (-1146.607) [-1140.781] * (-1145.667) (-1149.165) (-1138.481) [-1143.428] -- 0:01:08
Average standard deviation of split frequencies: 0.006915
666000 -- (-1144.227) (-1140.087) (-1141.538) [-1141.641] * (-1140.417) (-1148.917) [-1141.836] (-1151.197) -- 0:01:07
667000 -- (-1146.044) (-1137.654) (-1145.169) [-1138.786] * (-1149.506) (-1141.307) (-1143.805) [-1141.746] -- 0:01:07
668000 -- (-1148.404) (-1143.394) [-1138.857] (-1147.098) * [-1147.448] (-1144.166) (-1145.808) (-1142.084) -- 0:01:07
669000 -- (-1140.892) (-1147.796) [-1139.760] (-1155.597) * (-1149.453) (-1142.633) [-1137.463] (-1146.936) -- 0:01:07
670000 -- (-1148.353) [-1139.467] (-1141.249) (-1143.072) * [-1139.943] (-1141.474) (-1143.625) (-1140.950) -- 0:01:06
Average standard deviation of split frequencies: 0.006704
671000 -- (-1143.169) [-1138.017] (-1137.954) (-1138.899) * [-1142.510] (-1148.316) (-1145.712) (-1136.589) -- 0:01:06
672000 -- (-1144.657) (-1139.370) [-1140.560] (-1145.885) * (-1141.976) (-1143.975) [-1136.638] (-1145.102) -- 0:01:06
673000 -- [-1145.023] (-1144.261) (-1147.855) (-1158.031) * [-1141.191] (-1150.341) (-1140.008) (-1152.807) -- 0:01:06
674000 -- (-1145.192) [-1141.870] (-1150.421) (-1140.635) * (-1145.153) (-1148.167) (-1147.206) [-1138.569] -- 0:01:06
675000 -- (-1151.931) [-1140.907] (-1143.421) (-1149.750) * (-1143.332) (-1148.295) (-1144.834) [-1136.616] -- 0:01:05
Average standard deviation of split frequencies: 0.006705
676000 -- (-1146.314) (-1143.048) [-1137.650] (-1148.091) * (-1141.006) (-1149.827) [-1142.510] (-1140.936) -- 0:01:05
677000 -- [-1145.479] (-1140.736) (-1151.486) (-1143.524) * (-1138.591) (-1142.928) (-1144.816) [-1142.177] -- 0:01:05
678000 -- (-1141.441) [-1144.996] (-1143.128) (-1137.834) * [-1136.558] (-1145.567) (-1141.930) (-1139.309) -- 0:01:05
679000 -- (-1156.107) (-1138.422) (-1149.219) [-1141.569] * (-1141.209) (-1141.672) [-1143.062] (-1145.340) -- 0:01:05
680000 -- [-1138.223] (-1149.607) (-1137.577) (-1152.672) * (-1146.413) [-1139.971] (-1141.264) (-1151.599) -- 0:01:04
Average standard deviation of split frequencies: 0.006766
681000 -- (-1140.266) (-1144.903) [-1144.407] (-1142.851) * (-1143.152) [-1140.401] (-1141.598) (-1142.575) -- 0:01:04
682000 -- (-1143.101) (-1139.280) (-1147.394) [-1135.640] * [-1143.450] (-1136.376) (-1141.530) (-1144.962) -- 0:01:04
683000 -- (-1150.684) [-1145.127] (-1144.927) (-1137.872) * [-1139.589] (-1143.801) (-1142.764) (-1142.453) -- 0:01:04
684000 -- (-1142.869) (-1141.129) [-1141.316] (-1142.702) * (-1136.417) (-1144.637) (-1139.253) [-1140.290] -- 0:01:04
685000 -- (-1145.560) (-1137.216) [-1146.883] (-1143.286) * (-1144.488) [-1135.894] (-1147.195) (-1140.492) -- 0:01:03
Average standard deviation of split frequencies: 0.007189
686000 -- (-1145.589) [-1146.333] (-1145.775) (-1142.304) * (-1138.157) [-1136.745] (-1141.269) (-1137.116) -- 0:01:03
687000 -- (-1148.026) (-1138.251) [-1137.371] (-1137.790) * [-1140.250] (-1142.595) (-1142.340) (-1149.284) -- 0:01:03
688000 -- (-1149.148) (-1138.130) (-1142.099) [-1153.009] * (-1145.872) (-1143.955) [-1139.322] (-1150.416) -- 0:01:03
689000 -- (-1155.278) [-1148.123] (-1137.694) (-1140.898) * (-1153.379) [-1142.104] (-1140.846) (-1147.148) -- 0:01:03
690000 -- (-1143.040) [-1141.149] (-1149.541) (-1146.599) * (-1143.760) (-1142.113) [-1131.982] (-1148.464) -- 0:01:02
Average standard deviation of split frequencies: 0.007298
691000 -- (-1150.643) [-1147.186] (-1144.621) (-1141.999) * (-1142.138) [-1141.716] (-1138.807) (-1146.851) -- 0:01:03
692000 -- (-1148.205) (-1144.425) [-1143.048] (-1143.946) * (-1148.201) (-1138.626) [-1144.881] (-1149.055) -- 0:01:02
693000 -- (-1139.750) [-1136.738] (-1140.765) (-1152.898) * (-1141.774) [-1145.797] (-1139.428) (-1147.027) -- 0:01:02
694000 -- [-1138.508] (-1140.557) (-1144.466) (-1147.625) * (-1143.882) (-1143.950) (-1146.490) [-1140.588] -- 0:01:02
695000 -- (-1142.588) [-1143.337] (-1142.197) (-1141.056) * [-1147.609] (-1143.873) (-1146.976) (-1139.974) -- 0:01:01
Average standard deviation of split frequencies: 0.007138
696000 -- [-1143.766] (-1138.893) (-1143.427) (-1145.401) * (-1145.803) (-1140.106) (-1143.408) [-1138.594] -- 0:01:02
697000 -- [-1139.586] (-1141.343) (-1148.173) (-1146.903) * (-1149.127) (-1140.759) (-1145.917) [-1141.548] -- 0:01:01
698000 -- (-1154.879) (-1148.210) (-1151.131) [-1137.044] * (-1146.066) [-1140.269] (-1142.904) (-1150.248) -- 0:01:01
699000 -- [-1139.951] (-1146.709) (-1148.199) (-1148.601) * (-1153.353) [-1142.589] (-1142.602) (-1146.440) -- 0:01:01
700000 -- (-1142.406) (-1139.890) [-1139.444] (-1143.421) * [-1141.342] (-1145.430) (-1142.401) (-1141.883) -- 0:01:00
Average standard deviation of split frequencies: 0.007401
701000 -- (-1147.888) (-1147.262) [-1136.965] (-1151.566) * [-1139.172] (-1148.124) (-1148.736) (-1142.629) -- 0:01:00
702000 -- (-1139.981) (-1149.736) [-1141.845] (-1144.274) * [-1145.799] (-1142.256) (-1142.818) (-1147.834) -- 0:01:00
703000 -- [-1141.956] (-1147.553) (-1149.393) (-1142.047) * [-1139.194] (-1153.488) (-1144.455) (-1150.340) -- 0:01:00
704000 -- [-1142.696] (-1147.359) (-1141.502) (-1144.815) * [-1141.642] (-1143.747) (-1143.721) (-1146.349) -- 0:01:00
705000 -- [-1144.148] (-1138.721) (-1143.114) (-1143.990) * [-1142.876] (-1151.884) (-1148.140) (-1143.152) -- 0:00:59
Average standard deviation of split frequencies: 0.007602
706000 -- (-1153.627) [-1143.729] (-1147.647) (-1139.948) * (-1145.672) [-1136.845] (-1138.611) (-1141.150) -- 0:00:59
707000 -- (-1135.462) (-1145.595) (-1141.453) [-1139.184] * (-1142.111) (-1139.312) [-1141.406] (-1136.292) -- 0:00:59
708000 -- (-1149.264) (-1144.710) (-1138.961) [-1142.483] * (-1139.472) (-1152.032) [-1139.226] (-1146.183) -- 0:00:59
709000 -- (-1140.265) (-1143.561) (-1143.300) [-1148.040] * (-1141.128) (-1152.242) [-1139.552] (-1146.231) -- 0:00:59
710000 -- (-1143.891) (-1150.047) [-1146.171] (-1140.794) * (-1153.217) [-1139.570] (-1138.185) (-1140.821) -- 0:00:58
Average standard deviation of split frequencies: 0.007144
711000 -- (-1143.397) (-1144.686) (-1139.130) [-1138.679] * (-1149.855) (-1145.254) (-1146.772) [-1144.393] -- 0:00:58
712000 -- (-1145.499) [-1144.122] (-1142.132) (-1157.683) * [-1144.287] (-1149.126) (-1145.996) (-1138.722) -- 0:00:58
713000 -- (-1149.455) (-1143.906) [-1148.428] (-1146.138) * (-1145.769) (-1145.514) [-1144.930] (-1139.991) -- 0:00:58
714000 -- (-1140.444) (-1142.283) (-1146.393) [-1134.727] * (-1140.946) (-1150.428) (-1142.416) [-1142.789] -- 0:00:58
715000 -- (-1147.456) (-1144.657) [-1138.535] (-1143.444) * (-1150.368) (-1141.205) [-1142.500] (-1142.853) -- 0:00:57
Average standard deviation of split frequencies: 0.006888
716000 -- (-1145.225) (-1146.323) [-1140.363] (-1144.746) * (-1145.360) (-1136.432) (-1147.114) [-1139.913] -- 0:00:57
717000 -- [-1144.996] (-1143.398) (-1145.299) (-1142.180) * (-1138.590) (-1139.540) (-1142.728) [-1150.951] -- 0:00:57
718000 -- (-1142.107) (-1145.873) [-1141.322] (-1144.364) * (-1149.372) (-1140.032) [-1142.040] (-1143.682) -- 0:00:57
719000 -- (-1140.331) [-1143.038] (-1149.739) (-1148.092) * (-1140.734) [-1144.540] (-1149.992) (-1151.110) -- 0:00:57
720000 -- (-1154.162) (-1142.717) (-1141.123) [-1146.606] * [-1142.768] (-1149.847) (-1140.382) (-1141.205) -- 0:00:56
Average standard deviation of split frequencies: 0.007296
721000 -- (-1144.870) (-1147.989) (-1143.593) [-1142.609] * (-1138.098) [-1144.566] (-1149.002) (-1141.247) -- 0:00:56
722000 -- (-1139.077) [-1138.998] (-1143.861) (-1139.116) * (-1143.342) [-1144.755] (-1149.853) (-1143.719) -- 0:00:56
723000 -- (-1142.194) [-1142.907] (-1141.333) (-1139.546) * [-1145.344] (-1139.296) (-1146.430) (-1144.217) -- 0:00:56
724000 -- (-1140.815) (-1146.392) (-1146.322) [-1140.820] * (-1151.988) (-1153.274) [-1147.579] (-1139.265) -- 0:00:56
725000 -- (-1146.230) [-1141.217] (-1143.615) (-1144.460) * (-1147.835) [-1136.641] (-1140.834) (-1150.875) -- 0:00:55
Average standard deviation of split frequencies: 0.007192
726000 -- (-1143.963) [-1140.978] (-1138.294) (-1151.131) * [-1154.039] (-1141.627) (-1143.846) (-1141.904) -- 0:00:55
727000 -- (-1147.437) [-1136.392] (-1146.947) (-1144.547) * (-1139.917) (-1136.559) (-1143.475) [-1135.720] -- 0:00:55
728000 -- (-1144.074) (-1140.771) [-1140.313] (-1154.721) * (-1146.363) [-1139.298] (-1141.371) (-1146.948) -- 0:00:55
729000 -- (-1146.257) (-1141.209) [-1136.321] (-1145.406) * (-1146.847) (-1142.721) [-1137.703] (-1146.026) -- 0:00:55
730000 -- [-1142.647] (-1137.115) (-1144.428) (-1148.421) * (-1136.960) [-1137.431] (-1144.588) (-1153.041) -- 0:00:54
Average standard deviation of split frequencies: 0.008139
731000 -- (-1155.525) (-1145.964) [-1140.446] (-1140.191) * (-1137.566) [-1139.764] (-1140.714) (-1152.700) -- 0:00:54
732000 -- [-1147.711] (-1142.981) (-1151.750) (-1139.423) * [-1139.464] (-1138.433) (-1143.682) (-1139.011) -- 0:00:54
733000 -- (-1147.150) [-1139.746] (-1145.007) (-1136.369) * (-1153.999) (-1145.395) (-1141.805) [-1147.072] -- 0:00:54
734000 -- [-1137.822] (-1135.720) (-1145.953) (-1150.449) * [-1141.848] (-1140.087) (-1147.444) (-1149.670) -- 0:00:53
735000 -- (-1142.322) (-1145.948) (-1151.013) [-1140.335] * [-1143.746] (-1140.484) (-1148.091) (-1145.625) -- 0:00:53
Average standard deviation of split frequencies: 0.008031
736000 -- (-1140.375) [-1140.867] (-1150.629) (-1140.972) * [-1141.341] (-1146.212) (-1139.970) (-1143.073) -- 0:00:53
737000 -- (-1144.711) (-1142.664) (-1149.959) [-1138.784] * (-1136.157) [-1139.198] (-1150.326) (-1149.619) -- 0:00:53
738000 -- (-1142.187) (-1141.938) (-1144.889) [-1142.550] * (-1141.111) (-1154.159) (-1145.380) [-1137.532] -- 0:00:53
739000 -- (-1139.262) (-1148.983) (-1145.090) [-1137.277] * (-1138.679) (-1138.281) (-1147.452) [-1140.729] -- 0:00:52
740000 -- (-1136.592) [-1143.654] (-1142.230) (-1149.909) * (-1148.897) (-1134.927) [-1141.679] (-1144.524) -- 0:00:52
Average standard deviation of split frequencies: 0.008176
741000 -- [-1140.976] (-1148.124) (-1149.655) (-1140.727) * (-1141.051) (-1143.444) (-1150.828) [-1139.400] -- 0:00:52
742000 -- (-1144.263) (-1143.561) (-1140.848) [-1140.915] * (-1148.154) (-1147.223) (-1141.279) [-1145.524] -- 0:00:52
743000 -- (-1139.912) [-1140.927] (-1141.862) (-1141.302) * (-1152.375) (-1151.538) [-1138.262] (-1142.816) -- 0:00:52
744000 -- (-1141.343) (-1139.916) (-1139.134) [-1143.840] * (-1137.254) [-1135.656] (-1142.928) (-1152.309) -- 0:00:51
745000 -- (-1142.058) [-1138.074] (-1144.382) (-1141.850) * (-1140.472) [-1139.184] (-1144.662) (-1141.453) -- 0:00:51
Average standard deviation of split frequencies: 0.008166
746000 -- (-1138.094) (-1140.934) [-1144.206] (-1137.179) * (-1142.437) [-1141.587] (-1143.758) (-1146.554) -- 0:00:51
747000 -- (-1141.297) [-1143.287] (-1149.372) (-1149.151) * (-1142.835) [-1138.482] (-1142.522) (-1146.163) -- 0:00:51
748000 -- (-1136.347) (-1145.795) (-1146.723) [-1138.821] * (-1159.259) (-1142.384) [-1136.500] (-1144.053) -- 0:00:51
749000 -- (-1142.097) [-1142.060] (-1139.307) (-1141.276) * (-1157.564) [-1141.670] (-1142.908) (-1147.263) -- 0:00:50
750000 -- (-1139.673) [-1140.371] (-1141.577) (-1151.378) * (-1146.676) (-1147.550) (-1143.572) [-1141.761] -- 0:00:50
Average standard deviation of split frequencies: 0.007729
751000 -- (-1141.663) (-1145.928) [-1138.132] (-1144.248) * (-1142.476) (-1156.156) [-1141.091] (-1140.025) -- 0:00:50
752000 -- [-1136.133] (-1144.690) (-1145.179) (-1139.251) * (-1140.568) (-1142.417) (-1151.799) [-1139.799] -- 0:00:50
753000 -- (-1137.354) [-1138.368] (-1141.269) (-1151.858) * (-1141.190) (-1143.470) (-1146.725) [-1137.772] -- 0:00:50
754000 -- (-1141.046) (-1145.751) (-1145.840) [-1144.176] * [-1142.018] (-1141.373) (-1143.614) (-1143.021) -- 0:00:49
755000 -- (-1142.786) (-1138.502) (-1139.305) [-1135.501] * (-1142.337) [-1142.304] (-1148.879) (-1148.427) -- 0:00:49
Average standard deviation of split frequencies: 0.007147
756000 -- (-1143.324) (-1138.275) [-1140.921] (-1144.009) * [-1139.016] (-1149.743) (-1142.879) (-1146.599) -- 0:00:49
757000 -- (-1141.489) (-1154.010) [-1137.660] (-1143.480) * (-1153.399) (-1143.125) (-1136.856) [-1138.227] -- 0:00:49
758000 -- [-1152.645] (-1151.191) (-1153.147) (-1141.330) * [-1145.634] (-1146.856) (-1144.141) (-1139.696) -- 0:00:49
759000 -- (-1146.972) (-1142.407) [-1143.550] (-1144.845) * (-1144.637) (-1145.202) [-1136.406] (-1141.493) -- 0:00:48
760000 -- [-1140.679] (-1143.794) (-1142.417) (-1150.444) * (-1141.794) (-1152.210) [-1138.704] (-1142.966) -- 0:00:48
Average standard deviation of split frequencies: 0.006626
761000 -- (-1149.575) [-1143.208] (-1147.277) (-1147.922) * (-1146.250) (-1144.915) (-1150.446) [-1145.719] -- 0:00:48
762000 -- [-1141.781] (-1147.493) (-1141.547) (-1141.917) * (-1140.985) [-1143.626] (-1143.941) (-1136.683) -- 0:00:48
763000 -- (-1149.169) (-1143.777) (-1138.326) [-1142.439] * (-1141.825) (-1144.750) [-1142.364] (-1145.639) -- 0:00:48
764000 -- (-1147.526) [-1147.933] (-1146.360) (-1140.062) * (-1151.895) [-1140.936] (-1137.893) (-1141.491) -- 0:00:47
765000 -- (-1146.473) (-1141.927) (-1145.178) [-1139.571] * (-1140.058) (-1147.887) [-1146.769] (-1145.554) -- 0:00:47
Average standard deviation of split frequencies: 0.006438
766000 -- (-1138.363) (-1139.651) (-1143.196) [-1148.039] * [-1140.670] (-1143.528) (-1137.440) (-1147.203) -- 0:00:47
767000 -- (-1144.559) (-1141.489) [-1138.155] (-1145.477) * (-1145.233) (-1150.879) [-1144.440] (-1139.934) -- 0:00:47
768000 -- (-1150.758) (-1140.589) [-1142.410] (-1141.877) * (-1140.188) (-1151.914) [-1134.101] (-1146.150) -- 0:00:47
769000 -- (-1143.791) [-1145.001] (-1149.446) (-1138.005) * (-1140.372) [-1146.923] (-1140.625) (-1143.528) -- 0:00:46
770000 -- (-1142.403) (-1142.629) [-1139.176] (-1141.581) * (-1143.666) [-1139.511] (-1143.324) (-1145.572) -- 0:00:46
Average standard deviation of split frequencies: 0.007434
771000 -- [-1142.407] (-1142.538) (-1140.343) (-1144.275) * (-1142.283) [-1141.180] (-1144.655) (-1144.832) -- 0:00:46
772000 -- [-1135.951] (-1144.029) (-1144.307) (-1140.342) * (-1153.498) (-1139.393) (-1141.715) [-1139.697] -- 0:00:46
773000 -- (-1135.081) (-1139.481) [-1140.908] (-1145.848) * [-1145.992] (-1146.553) (-1146.733) (-1144.933) -- 0:00:46
774000 -- (-1142.454) (-1140.710) (-1140.254) [-1138.776] * [-1142.203] (-1149.547) (-1143.788) (-1143.496) -- 0:00:45
775000 -- (-1144.673) (-1151.397) [-1140.990] (-1141.626) * (-1149.850) [-1135.536] (-1143.117) (-1145.470) -- 0:00:45
Average standard deviation of split frequencies: 0.007383
776000 -- (-1140.445) [-1143.809] (-1142.615) (-1141.944) * (-1145.672) (-1138.116) [-1137.781] (-1141.514) -- 0:00:45
777000 -- [-1145.082] (-1156.315) (-1141.024) (-1151.856) * (-1151.440) (-1144.798) [-1140.377] (-1138.913) -- 0:00:45
778000 -- (-1139.766) (-1147.531) [-1141.406] (-1145.726) * (-1145.893) (-1138.515) (-1145.075) [-1140.148] -- 0:00:45
779000 -- (-1137.864) (-1150.637) (-1144.225) [-1143.841] * (-1151.134) (-1139.521) (-1148.695) [-1138.110] -- 0:00:44
780000 -- (-1146.230) (-1152.096) (-1141.792) [-1143.360] * (-1145.646) [-1140.757] (-1154.375) (-1142.429) -- 0:00:44
Average standard deviation of split frequencies: 0.007478
781000 -- (-1151.228) [-1140.079] (-1143.667) (-1142.432) * (-1143.919) (-1141.946) [-1139.376] (-1141.496) -- 0:00:44
782000 -- (-1149.620) (-1139.512) (-1142.167) [-1140.290] * [-1138.932] (-1143.542) (-1142.834) (-1139.405) -- 0:00:44
783000 -- [-1146.482] (-1140.140) (-1140.797) (-1146.967) * (-1142.528) (-1142.317) (-1155.058) [-1145.937] -- 0:00:44
784000 -- [-1133.926] (-1142.674) (-1142.386) (-1150.164) * (-1141.724) (-1143.798) (-1143.880) [-1144.360] -- 0:00:43
785000 -- [-1141.070] (-1137.904) (-1144.390) (-1141.064) * (-1141.459) [-1138.794] (-1137.884) (-1142.835) -- 0:00:43
Average standard deviation of split frequencies: 0.007289
786000 -- [-1144.079] (-1144.166) (-1141.922) (-1143.143) * (-1140.677) (-1139.040) [-1137.833] (-1143.158) -- 0:00:43
787000 -- (-1145.228) [-1142.673] (-1142.280) (-1152.921) * [-1137.440] (-1145.317) (-1143.028) (-1148.424) -- 0:00:43
788000 -- (-1149.166) (-1137.247) (-1143.797) [-1143.997] * (-1144.122) [-1138.481] (-1142.058) (-1147.064) -- 0:00:43
789000 -- [-1142.643] (-1150.220) (-1143.418) (-1146.907) * (-1135.859) (-1154.220) [-1147.052] (-1144.576) -- 0:00:42
790000 -- (-1143.897) (-1134.397) [-1149.729] (-1149.002) * [-1139.551] (-1144.928) (-1142.995) (-1137.978) -- 0:00:42
Average standard deviation of split frequencies: 0.007384
791000 -- (-1141.558) (-1139.916) (-1149.025) [-1143.345] * [-1136.166] (-1148.767) (-1149.397) (-1146.161) -- 0:00:42
792000 -- (-1145.867) (-1139.142) [-1139.199] (-1137.870) * (-1147.338) (-1141.981) (-1140.668) [-1142.970] -- 0:00:42
793000 -- (-1136.792) (-1137.758) [-1142.289] (-1135.377) * (-1143.705) (-1145.781) [-1140.146] (-1137.769) -- 0:00:42
794000 -- (-1143.411) [-1136.920] (-1134.483) (-1151.626) * (-1139.155) [-1142.010] (-1144.695) (-1142.063) -- 0:00:41
795000 -- (-1144.420) (-1140.745) [-1140.697] (-1140.836) * (-1145.610) [-1140.628] (-1143.104) (-1138.620) -- 0:00:41
Average standard deviation of split frequencies: 0.007107
796000 -- (-1143.782) [-1135.434] (-1143.008) (-1146.814) * (-1142.566) (-1140.843) (-1147.827) [-1134.703] -- 0:00:41
797000 -- (-1146.447) [-1142.555] (-1132.532) (-1148.472) * (-1145.092) [-1139.018] (-1138.253) (-1135.657) -- 0:00:41
798000 -- (-1142.314) (-1146.331) (-1143.431) [-1139.759] * (-1144.159) (-1144.153) (-1140.218) [-1138.413] -- 0:00:41
799000 -- (-1139.747) (-1142.964) [-1137.454] (-1151.488) * (-1148.127) (-1138.400) (-1147.477) [-1139.392] -- 0:00:40
800000 -- (-1141.658) (-1148.146) (-1142.930) [-1143.763] * [-1146.687] (-1137.528) (-1144.189) (-1153.065) -- 0:00:40
Average standard deviation of split frequencies: 0.006975
801000 -- (-1142.094) [-1138.219] (-1139.230) (-1144.551) * (-1144.740) [-1144.433] (-1139.514) (-1147.394) -- 0:00:40
802000 -- (-1143.662) (-1145.072) (-1142.967) [-1151.502] * (-1138.057) [-1147.424] (-1143.942) (-1145.027) -- 0:00:40
803000 -- (-1139.419) (-1143.480) [-1144.921] (-1149.626) * (-1142.173) (-1147.412) [-1140.746] (-1146.361) -- 0:00:39
804000 -- (-1138.369) (-1147.765) (-1137.351) [-1138.695] * [-1140.626] (-1143.631) (-1146.475) (-1144.262) -- 0:00:39
805000 -- (-1140.039) (-1149.087) (-1138.774) [-1140.319] * (-1142.097) (-1143.526) [-1137.844] (-1144.097) -- 0:00:39
Average standard deviation of split frequencies: 0.007108
806000 -- [-1140.834] (-1144.513) (-1143.575) (-1136.939) * (-1142.180) (-1144.333) (-1143.678) [-1141.938] -- 0:00:39
807000 -- (-1143.969) [-1143.750] (-1149.402) (-1132.126) * (-1146.346) (-1138.239) (-1140.047) [-1138.669] -- 0:00:39
808000 -- (-1145.588) (-1151.651) [-1142.362] (-1149.723) * (-1153.961) (-1143.288) (-1151.109) [-1140.278] -- 0:00:38
809000 -- (-1144.021) (-1143.431) (-1142.289) [-1142.294] * (-1140.261) (-1146.992) (-1139.300) [-1136.358] -- 0:00:38
810000 -- (-1141.089) (-1146.707) (-1138.844) [-1141.724] * (-1143.166) [-1145.250] (-1156.931) (-1147.164) -- 0:00:38
Average standard deviation of split frequencies: 0.006754
811000 -- [-1145.810] (-1151.577) (-1140.375) (-1141.296) * (-1144.821) [-1144.135] (-1143.690) (-1138.564) -- 0:00:38
812000 -- (-1144.355) [-1142.110] (-1135.339) (-1141.720) * (-1141.105) (-1141.033) [-1141.763] (-1145.719) -- 0:00:38
813000 -- (-1146.774) (-1141.777) (-1139.355) [-1141.194] * [-1137.439] (-1141.486) (-1147.539) (-1149.496) -- 0:00:37
814000 -- (-1146.173) (-1140.636) [-1150.406] (-1146.358) * (-1141.032) [-1150.958] (-1141.771) (-1140.285) -- 0:00:37
815000 -- (-1141.390) (-1142.286) (-1151.790) [-1140.394] * (-1142.022) (-1146.615) [-1150.869] (-1140.587) -- 0:00:37
Average standard deviation of split frequencies: 0.006977
816000 -- (-1142.893) (-1144.250) (-1141.794) [-1137.013] * (-1152.109) (-1151.965) [-1151.081] (-1146.573) -- 0:00:37
817000 -- (-1135.495) (-1142.025) (-1155.312) [-1138.505] * (-1140.839) [-1134.414] (-1143.997) (-1141.852) -- 0:00:37
818000 -- (-1141.006) [-1147.203] (-1147.461) (-1143.635) * [-1138.034] (-1142.497) (-1143.780) (-1141.474) -- 0:00:36
819000 -- [-1135.681] (-1149.817) (-1150.600) (-1140.158) * (-1139.722) (-1140.416) [-1140.110] (-1135.127) -- 0:00:36
820000 -- [-1141.373] (-1141.569) (-1144.078) (-1139.064) * [-1139.785] (-1147.737) (-1141.164) (-1146.271) -- 0:00:36
Average standard deviation of split frequencies: 0.006849
821000 -- [-1142.804] (-1141.617) (-1142.498) (-1146.553) * (-1146.945) [-1139.631] (-1140.961) (-1140.899) -- 0:00:36
822000 -- (-1137.488) (-1157.798) (-1143.181) [-1143.546] * (-1140.599) (-1148.302) [-1137.587] (-1149.911) -- 0:00:36
823000 -- (-1143.636) [-1142.661] (-1135.040) (-1147.607) * (-1146.894) (-1145.440) [-1140.918] (-1141.301) -- 0:00:35
824000 -- (-1147.519) (-1147.565) [-1144.168] (-1142.804) * (-1154.091) (-1147.881) (-1149.034) [-1141.840] -- 0:00:35
825000 -- [-1143.208] (-1138.343) (-1139.630) (-1148.626) * [-1143.638] (-1155.288) (-1153.627) (-1139.420) -- 0:00:35
Average standard deviation of split frequencies: 0.006673
826000 -- (-1138.192) (-1148.760) [-1140.974] (-1158.777) * (-1144.230) (-1138.298) (-1154.707) [-1140.869] -- 0:00:35
827000 -- (-1147.868) (-1140.746) (-1141.361) [-1137.509] * [-1139.622] (-1135.925) (-1139.586) (-1138.677) -- 0:00:35
828000 -- (-1144.533) (-1140.930) [-1141.251] (-1141.503) * (-1140.808) (-1144.614) (-1142.626) [-1136.007] -- 0:00:34
829000 -- (-1147.128) (-1138.282) (-1147.879) [-1135.333] * (-1147.803) (-1149.169) [-1139.865] (-1148.169) -- 0:00:34
830000 -- (-1152.464) (-1141.006) [-1145.729] (-1143.957) * (-1148.606) (-1139.606) (-1146.947) [-1140.078] -- 0:00:34
Average standard deviation of split frequencies: 0.006897
831000 -- (-1152.002) [-1135.800] (-1145.943) (-1150.195) * (-1152.432) (-1146.777) [-1143.164] (-1144.005) -- 0:00:34
832000 -- (-1148.517) (-1145.629) [-1140.484] (-1151.849) * (-1142.485) [-1141.543] (-1146.493) (-1149.066) -- 0:00:34
833000 -- [-1137.725] (-1144.196) (-1142.736) (-1147.848) * (-1140.635) (-1148.395) [-1139.677] (-1137.295) -- 0:00:33
834000 -- (-1141.334) [-1142.007] (-1144.864) (-1143.514) * (-1147.603) [-1143.139] (-1138.009) (-1148.548) -- 0:00:33
835000 -- [-1141.724] (-1138.185) (-1143.663) (-1142.926) * (-1146.132) [-1139.403] (-1146.756) (-1150.322) -- 0:00:33
Average standard deviation of split frequencies: 0.006853
836000 -- (-1148.037) (-1142.082) (-1147.169) [-1145.318] * (-1146.044) (-1140.785) [-1142.301] (-1148.302) -- 0:00:33
837000 -- (-1146.655) [-1139.140] (-1153.198) (-1140.755) * (-1142.115) [-1141.693] (-1140.033) (-1142.272) -- 0:00:33
838000 -- (-1143.859) (-1136.474) [-1136.171] (-1144.404) * (-1144.366) (-1143.290) [-1142.157] (-1144.228) -- 0:00:32
839000 -- (-1139.146) (-1148.654) [-1148.038] (-1145.042) * (-1140.729) (-1137.156) [-1142.570] (-1139.898) -- 0:00:32
840000 -- (-1142.388) [-1141.270] (-1147.850) (-1149.668) * [-1142.808] (-1144.736) (-1152.200) (-1142.227) -- 0:00:32
Average standard deviation of split frequencies: 0.007203
841000 -- (-1146.243) (-1140.862) [-1136.329] (-1155.882) * (-1148.826) [-1147.543] (-1147.371) (-1140.534) -- 0:00:32
842000 -- (-1142.831) [-1139.615] (-1136.813) (-1162.277) * (-1151.602) (-1140.754) (-1141.431) [-1144.001] -- 0:00:32
843000 -- [-1145.951] (-1150.763) (-1139.918) (-1146.512) * [-1143.315] (-1146.370) (-1143.079) (-1139.831) -- 0:00:31
844000 -- (-1137.404) (-1140.132) [-1143.490] (-1135.922) * (-1140.209) [-1139.071] (-1141.857) (-1150.018) -- 0:00:31
845000 -- [-1137.188] (-1142.403) (-1147.846) (-1141.601) * [-1144.984] (-1147.970) (-1138.499) (-1140.598) -- 0:00:31
Average standard deviation of split frequencies: 0.006429
846000 -- [-1141.498] (-1146.451) (-1147.127) (-1146.986) * (-1145.393) (-1140.942) (-1139.123) [-1142.179] -- 0:00:31
847000 -- (-1148.185) (-1141.642) (-1137.233) [-1136.080] * (-1153.738) (-1145.697) [-1143.191] (-1139.609) -- 0:00:31
848000 -- (-1146.735) (-1149.368) (-1145.884) [-1149.900] * (-1137.551) [-1143.412] (-1147.522) (-1136.196) -- 0:00:30
849000 -- (-1145.614) (-1147.262) [-1147.727] (-1138.148) * (-1139.807) (-1144.973) (-1149.482) [-1138.409] -- 0:00:30
850000 -- [-1145.727] (-1145.611) (-1144.065) (-1137.105) * [-1144.666] (-1142.640) (-1141.380) (-1139.882) -- 0:00:30
Average standard deviation of split frequencies: 0.006522
851000 -- (-1144.234) [-1142.043] (-1142.670) (-1137.128) * (-1144.833) (-1149.687) [-1138.637] (-1135.064) -- 0:00:30
852000 -- (-1142.683) (-1149.354) [-1140.474] (-1140.601) * (-1140.540) (-1141.308) [-1139.104] (-1145.488) -- 0:00:30
853000 -- [-1144.557] (-1141.573) (-1143.423) (-1138.285) * [-1142.538] (-1142.466) (-1140.105) (-1151.001) -- 0:00:29
854000 -- (-1137.415) [-1136.712] (-1138.725) (-1156.018) * (-1142.244) [-1150.094] (-1143.807) (-1146.064) -- 0:00:29
855000 -- [-1141.523] (-1140.653) (-1141.768) (-1145.329) * (-1142.735) [-1141.505] (-1141.589) (-1153.036) -- 0:00:29
Average standard deviation of split frequencies: 0.006608
856000 -- [-1143.851] (-1150.850) (-1142.543) (-1144.469) * (-1148.293) (-1141.743) [-1144.111] (-1140.800) -- 0:00:29
857000 -- (-1139.069) (-1145.195) [-1136.008] (-1139.710) * [-1134.685] (-1140.257) (-1144.534) (-1145.798) -- 0:00:29
858000 -- (-1139.257) (-1143.946) [-1147.230] (-1139.389) * (-1139.591) [-1139.714] (-1152.584) (-1142.680) -- 0:00:28
859000 -- (-1145.526) (-1141.789) (-1137.855) [-1141.784] * (-1143.540) (-1148.382) [-1150.452] (-1146.119) -- 0:00:28
860000 -- (-1152.361) [-1143.456] (-1136.733) (-1154.208) * [-1137.791] (-1154.613) (-1152.899) (-1144.264) -- 0:00:28
Average standard deviation of split frequencies: 0.006236
861000 -- (-1147.848) (-1137.282) [-1141.843] (-1143.114) * (-1144.491) (-1139.058) (-1146.844) [-1144.630] -- 0:00:28
862000 -- (-1142.751) [-1145.843] (-1142.177) (-1144.086) * (-1138.742) (-1140.607) (-1142.325) [-1138.763] -- 0:00:28
863000 -- (-1141.416) (-1141.064) (-1148.990) [-1135.812] * (-1141.134) (-1147.174) (-1151.661) [-1149.116] -- 0:00:27
864000 -- (-1142.833) [-1137.802] (-1144.646) (-1136.679) * (-1141.434) (-1142.836) [-1135.924] (-1143.253) -- 0:00:27
865000 -- (-1156.590) (-1143.794) [-1139.443] (-1141.357) * (-1146.866) (-1143.204) (-1143.330) [-1138.676] -- 0:00:27
Average standard deviation of split frequencies: 0.005820
866000 -- (-1142.875) [-1149.568] (-1133.456) (-1139.555) * [-1139.654] (-1148.664) (-1149.121) (-1149.202) -- 0:00:27
867000 -- (-1145.903) (-1141.207) [-1143.470] (-1141.324) * (-1143.029) (-1139.927) (-1146.685) [-1136.753] -- 0:00:26
868000 -- [-1145.033] (-1145.537) (-1139.952) (-1140.199) * (-1141.368) (-1143.682) [-1139.505] (-1148.704) -- 0:00:26
869000 -- (-1138.961) (-1146.696) [-1139.779] (-1138.485) * [-1144.303] (-1138.637) (-1139.943) (-1140.867) -- 0:00:26
870000 -- (-1150.986) (-1142.313) [-1139.655] (-1146.262) * (-1136.203) [-1141.349] (-1140.723) (-1144.934) -- 0:00:26
Average standard deviation of split frequencies: 0.006081
871000 -- (-1150.955) [-1145.318] (-1145.254) (-1146.903) * (-1140.082) (-1143.406) [-1140.126] (-1141.480) -- 0:00:26
872000 -- (-1146.116) (-1142.735) [-1141.065] (-1147.810) * (-1150.178) (-1141.669) [-1141.874] (-1145.281) -- 0:00:25
873000 -- [-1142.276] (-1145.925) (-1158.564) (-1147.261) * [-1142.379] (-1142.743) (-1145.297) (-1145.176) -- 0:00:25
874000 -- [-1142.588] (-1145.061) (-1142.630) (-1145.859) * (-1140.520) [-1142.204] (-1151.883) (-1142.766) -- 0:00:25
875000 -- (-1149.751) (-1138.810) (-1145.975) [-1143.664] * (-1140.748) (-1137.155) (-1152.410) [-1144.793] -- 0:00:25
Average standard deviation of split frequencies: 0.006333
876000 -- (-1150.073) [-1146.391] (-1140.822) (-1141.065) * (-1139.939) (-1149.583) (-1155.857) [-1140.602] -- 0:00:25
877000 -- (-1145.842) [-1143.443] (-1139.734) (-1147.950) * (-1138.415) (-1136.412) [-1140.247] (-1150.354) -- 0:00:24
878000 -- (-1140.836) (-1144.490) [-1139.369] (-1141.964) * (-1137.298) (-1145.204) (-1141.192) [-1138.805] -- 0:00:24
879000 -- (-1146.441) (-1138.340) (-1140.028) [-1143.656] * [-1144.022] (-1139.842) (-1148.757) (-1149.463) -- 0:00:24
880000 -- [-1145.406] (-1139.107) (-1140.625) (-1148.073) * (-1146.202) (-1142.349) (-1144.455) [-1140.620] -- 0:00:24
Average standard deviation of split frequencies: 0.005847
881000 -- [-1145.799] (-1146.275) (-1141.470) (-1144.202) * [-1142.759] (-1139.914) (-1141.882) (-1134.104) -- 0:00:24
882000 -- [-1141.727] (-1139.129) (-1148.766) (-1150.585) * [-1142.266] (-1145.109) (-1151.895) (-1137.002) -- 0:00:23
883000 -- [-1137.829] (-1140.139) (-1144.923) (-1142.599) * (-1145.769) (-1141.229) (-1144.998) [-1140.278] -- 0:00:23
884000 -- (-1142.162) (-1140.128) [-1142.596] (-1144.346) * (-1151.680) (-1139.538) (-1147.543) [-1140.948] -- 0:00:23
885000 -- (-1149.890) [-1140.568] (-1140.077) (-1142.994) * [-1139.774] (-1141.910) (-1154.779) (-1148.134) -- 0:00:23
Average standard deviation of split frequencies: 0.005812
886000 -- (-1143.078) (-1144.162) (-1143.676) [-1141.068] * (-1141.319) [-1141.993] (-1152.488) (-1148.645) -- 0:00:23
887000 -- (-1142.199) (-1142.076) [-1145.950] (-1140.120) * (-1139.732) [-1141.019] (-1148.067) (-1149.248) -- 0:00:22
888000 -- (-1145.441) (-1146.913) (-1146.030) [-1143.818] * (-1135.778) (-1138.982) [-1143.646] (-1140.342) -- 0:00:22
889000 -- (-1147.427) (-1152.965) [-1144.641] (-1142.685) * [-1144.753] (-1150.995) (-1140.551) (-1141.688) -- 0:00:22
890000 -- [-1139.126] (-1142.650) (-1144.136) (-1144.700) * (-1148.985) (-1152.816) (-1139.074) [-1138.636] -- 0:00:22
Average standard deviation of split frequencies: 0.005333
891000 -- (-1143.354) (-1137.155) [-1135.705] (-1146.542) * [-1148.067] (-1140.032) (-1142.620) (-1141.837) -- 0:00:22
892000 -- (-1145.718) (-1143.809) [-1140.008] (-1144.473) * (-1151.626) (-1141.142) (-1149.385) [-1140.301] -- 0:00:21
893000 -- [-1145.889] (-1142.400) (-1144.167) (-1151.445) * (-1142.133) (-1148.960) (-1156.650) [-1140.869] -- 0:00:21
894000 -- [-1138.882] (-1139.965) (-1148.171) (-1142.576) * [-1145.012] (-1140.222) (-1146.886) (-1142.939) -- 0:00:21
895000 -- (-1140.702) (-1147.081) [-1137.604] (-1151.376) * (-1145.239) (-1144.879) [-1147.607] (-1138.789) -- 0:00:21
Average standard deviation of split frequencies: 0.005099
896000 -- [-1139.549] (-1142.936) (-1147.550) (-1148.443) * (-1144.179) (-1137.916) [-1142.737] (-1143.820) -- 0:00:21
897000 -- (-1138.891) (-1146.989) (-1139.314) [-1147.456] * (-1146.888) (-1140.881) (-1141.003) [-1146.432] -- 0:00:20
898000 -- (-1144.756) (-1139.004) [-1138.872] (-1134.427) * [-1141.693] (-1146.024) (-1139.486) (-1139.027) -- 0:00:20
899000 -- [-1134.575] (-1141.579) (-1143.823) (-1138.158) * [-1144.746] (-1142.846) (-1145.478) (-1151.830) -- 0:00:20
900000 -- [-1139.755] (-1141.110) (-1148.218) (-1140.918) * (-1143.446) (-1147.819) (-1142.056) [-1138.429] -- 0:00:20
Average standard deviation of split frequencies: 0.005153
901000 -- [-1137.595] (-1140.607) (-1143.769) (-1147.936) * (-1157.642) [-1135.665] (-1141.861) (-1137.031) -- 0:00:20
902000 -- [-1133.798] (-1144.446) (-1143.651) (-1144.448) * [-1140.144] (-1145.686) (-1151.303) (-1138.257) -- 0:00:19
903000 -- [-1136.396] (-1143.901) (-1140.867) (-1146.875) * (-1143.211) (-1138.753) [-1138.213] (-1140.499) -- 0:00:19
904000 -- (-1141.697) [-1139.149] (-1146.092) (-1143.875) * (-1148.432) (-1139.777) (-1149.152) [-1146.084] -- 0:00:19
905000 -- (-1142.386) [-1143.742] (-1137.865) (-1147.845) * (-1141.089) [-1139.589] (-1142.566) (-1138.349) -- 0:00:19
Average standard deviation of split frequencies: 0.004923
906000 -- (-1139.633) (-1144.654) [-1143.371] (-1136.112) * [-1141.193] (-1149.277) (-1152.512) (-1147.989) -- 0:00:19
907000 -- (-1146.789) (-1145.226) [-1138.919] (-1139.148) * (-1140.118) (-1139.378) [-1147.702] (-1153.997) -- 0:00:18
908000 -- (-1143.327) (-1141.244) [-1138.172] (-1148.926) * [-1143.142] (-1140.092) (-1142.990) (-1145.727) -- 0:00:18
909000 -- (-1148.241) [-1142.336] (-1148.877) (-1145.511) * (-1146.307) (-1141.333) (-1145.859) [-1140.688] -- 0:00:18
910000 -- (-1138.897) (-1141.193) [-1140.705] (-1144.754) * (-1144.587) (-1145.072) [-1143.319] (-1139.571) -- 0:00:18
Average standard deviation of split frequencies: 0.004738
911000 -- (-1140.610) (-1144.617) [-1141.781] (-1144.835) * (-1141.167) (-1147.350) [-1145.311] (-1145.032) -- 0:00:18
912000 -- [-1143.148] (-1140.839) (-1144.726) (-1141.995) * (-1137.533) (-1142.376) (-1145.628) [-1140.563] -- 0:00:17
913000 -- (-1137.987) (-1143.659) [-1133.296] (-1143.185) * [-1145.018] (-1138.789) (-1153.329) (-1140.239) -- 0:00:17
914000 -- (-1144.561) (-1141.889) (-1136.755) [-1138.585] * (-1147.065) (-1143.104) (-1146.273) [-1146.342] -- 0:00:17
915000 -- [-1148.926] (-1142.353) (-1142.673) (-1148.407) * [-1140.350] (-1147.579) (-1157.753) (-1139.771) -- 0:00:17
Average standard deviation of split frequencies: 0.004790
916000 -- (-1145.677) [-1147.873] (-1145.242) (-1145.178) * (-1135.703) (-1142.229) (-1151.192) [-1140.727] -- 0:00:17
917000 -- [-1137.701] (-1145.063) (-1144.234) (-1146.777) * (-1145.083) [-1140.989] (-1146.678) (-1144.811) -- 0:00:16
918000 -- [-1138.814] (-1147.520) (-1140.658) (-1152.233) * [-1143.942] (-1143.309) (-1141.646) (-1149.376) -- 0:00:16
919000 -- (-1143.895) (-1146.571) [-1142.901] (-1143.123) * (-1148.473) (-1146.664) [-1143.047] (-1145.577) -- 0:00:16
920000 -- (-1139.658) (-1148.513) [-1141.995] (-1149.155) * (-1145.494) [-1139.632] (-1154.124) (-1140.648) -- 0:00:16
Average standard deviation of split frequencies: 0.004608
921000 -- (-1147.416) (-1149.785) [-1140.592] (-1148.941) * (-1141.490) (-1150.404) (-1154.374) [-1142.115] -- 0:00:16
922000 -- (-1146.567) [-1142.183] (-1145.437) (-1147.468) * (-1153.342) (-1146.940) [-1140.895] (-1146.852) -- 0:00:15
923000 -- (-1141.854) [-1142.028] (-1144.516) (-1145.775) * (-1147.943) (-1142.181) [-1143.492] (-1138.199) -- 0:00:15
924000 -- (-1143.021) (-1145.497) (-1143.033) [-1148.400] * (-1145.660) [-1147.013] (-1143.374) (-1151.420) -- 0:00:15
925000 -- (-1152.650) (-1145.747) (-1135.801) [-1138.440] * [-1141.576] (-1148.676) (-1143.111) (-1137.269) -- 0:00:15
Average standard deviation of split frequencies: 0.004699
926000 -- [-1143.457] (-1147.510) (-1140.646) (-1145.133) * [-1142.326] (-1140.900) (-1146.542) (-1138.540) -- 0:00:15
927000 -- [-1142.430] (-1141.375) (-1146.518) (-1150.201) * (-1149.402) (-1150.702) (-1148.007) [-1140.316] -- 0:00:14
928000 -- [-1143.063] (-1143.843) (-1146.217) (-1144.123) * (-1144.467) [-1143.933] (-1142.944) (-1143.213) -- 0:00:14
929000 -- (-1141.911) [-1137.646] (-1147.552) (-1143.279) * (-1141.377) (-1149.473) [-1146.271] (-1140.884) -- 0:00:14
930000 -- (-1148.750) (-1156.267) (-1148.511) [-1140.359] * (-1144.557) (-1146.124) (-1145.769) [-1146.554] -- 0:00:14
Average standard deviation of split frequencies: 0.004286
931000 -- [-1136.470] (-1151.607) (-1147.094) (-1140.433) * (-1144.136) (-1141.960) (-1147.796) [-1139.133] -- 0:00:14
932000 -- (-1144.931) (-1148.857) (-1150.897) [-1141.788] * (-1142.156) (-1155.013) (-1151.249) [-1141.409] -- 0:00:13
933000 -- (-1148.417) [-1137.376] (-1142.729) (-1139.517) * (-1150.966) (-1147.694) [-1143.580] (-1144.302) -- 0:00:13
934000 -- (-1143.996) [-1135.548] (-1141.860) (-1149.124) * (-1138.321) [-1140.731] (-1143.683) (-1150.755) -- 0:00:13
935000 -- (-1144.214) (-1135.450) (-1140.089) [-1142.893] * (-1146.609) (-1140.719) (-1141.282) [-1140.663] -- 0:00:13
Average standard deviation of split frequencies: 0.004223
936000 -- (-1150.135) (-1141.115) (-1147.632) [-1136.786] * [-1142.543] (-1145.275) (-1145.327) (-1145.985) -- 0:00:12
937000 -- (-1154.508) (-1141.204) [-1145.471] (-1138.727) * [-1142.591] (-1149.147) (-1140.057) (-1135.826) -- 0:00:12
938000 -- (-1145.911) [-1140.907] (-1138.735) (-1152.161) * [-1141.074] (-1141.317) (-1139.404) (-1141.326) -- 0:00:12
939000 -- (-1145.404) [-1139.966] (-1140.167) (-1145.224) * [-1138.108] (-1153.975) (-1140.054) (-1140.363) -- 0:00:12
940000 -- (-1147.106) [-1147.687] (-1149.899) (-1139.299) * (-1143.548) (-1149.216) [-1141.379] (-1141.512) -- 0:00:12
Average standard deviation of split frequencies: 0.004510
941000 -- (-1146.812) (-1154.191) [-1143.430] (-1150.420) * (-1136.333) (-1143.680) [-1136.259] (-1146.074) -- 0:00:11
942000 -- (-1146.351) (-1138.884) (-1144.704) [-1135.936] * (-1142.854) (-1146.159) [-1137.416] (-1141.914) -- 0:00:11
943000 -- [-1144.129] (-1139.801) (-1138.598) (-1150.236) * (-1141.618) (-1154.999) [-1146.349] (-1147.993) -- 0:00:11
944000 -- (-1148.039) (-1139.333) [-1141.218] (-1140.249) * (-1139.365) (-1147.632) (-1143.091) [-1149.436] -- 0:00:11
945000 -- (-1142.232) (-1139.827) [-1140.227] (-1146.155) * [-1135.870] (-1144.830) (-1139.045) (-1150.842) -- 0:00:11
Average standard deviation of split frequencies: 0.005328
946000 -- (-1142.167) [-1146.974] (-1146.333) (-1141.857) * (-1140.269) (-1138.692) (-1142.790) [-1142.814] -- 0:00:10
947000 -- (-1134.916) [-1134.698] (-1145.978) (-1156.231) * [-1142.684] (-1144.317) (-1145.086) (-1145.514) -- 0:00:10
948000 -- [-1145.579] (-1142.183) (-1134.671) (-1147.846) * (-1146.428) (-1149.759) [-1145.294] (-1143.007) -- 0:00:10
949000 -- (-1148.124) [-1137.547] (-1145.480) (-1147.679) * (-1152.941) [-1145.989] (-1145.416) (-1146.462) -- 0:00:10
950000 -- (-1145.206) (-1139.321) [-1143.074] (-1150.066) * (-1163.380) (-1144.179) [-1143.493] (-1147.034) -- 0:00:10
Average standard deviation of split frequencies: 0.005188
951000 -- (-1145.689) [-1144.780] (-1146.672) (-1150.019) * (-1145.733) (-1141.824) (-1147.830) [-1139.706] -- 0:00:09
952000 -- [-1146.460] (-1146.944) (-1145.009) (-1143.253) * (-1151.580) [-1140.719] (-1139.424) (-1144.377) -- 0:00:09
953000 -- [-1148.304] (-1142.763) (-1146.012) (-1144.043) * (-1145.221) [-1138.558] (-1138.977) (-1147.106) -- 0:00:09
954000 -- (-1143.719) [-1138.754] (-1147.931) (-1143.821) * (-1151.426) (-1153.400) (-1136.524) [-1135.961] -- 0:00:09
955000 -- (-1143.564) [-1139.894] (-1145.847) (-1140.402) * (-1138.288) (-1148.359) [-1146.188] (-1140.936) -- 0:00:09
Average standard deviation of split frequencies: 0.005386
956000 -- [-1145.268] (-1140.208) (-1149.220) (-1149.943) * [-1136.615] (-1148.966) (-1146.065) (-1150.833) -- 0:00:08
957000 -- [-1142.828] (-1139.094) (-1146.576) (-1154.166) * [-1140.097] (-1142.147) (-1142.326) (-1150.256) -- 0:00:08
958000 -- (-1160.034) (-1148.551) (-1147.373) [-1139.805] * (-1146.032) [-1138.638] (-1138.896) (-1141.798) -- 0:00:08
959000 -- (-1141.500) (-1143.611) (-1142.008) [-1147.492] * (-1138.296) [-1141.336] (-1140.578) (-1149.781) -- 0:00:08
960000 -- (-1144.342) [-1148.212] (-1144.775) (-1148.385) * (-1144.483) (-1145.849) (-1145.739) [-1143.093] -- 0:00:08
Average standard deviation of split frequencies: 0.005360
961000 -- (-1145.869) (-1153.170) [-1146.249] (-1140.812) * (-1146.542) (-1148.610) (-1140.827) [-1144.091] -- 0:00:07
962000 -- (-1143.621) (-1143.046) (-1145.348) [-1138.323] * [-1147.961] (-1143.405) (-1138.988) (-1142.961) -- 0:00:07
963000 -- (-1158.940) (-1148.665) [-1135.751] (-1140.453) * (-1145.001) (-1150.252) [-1150.467] (-1145.181) -- 0:00:07
964000 -- (-1148.092) (-1145.228) [-1137.989] (-1145.693) * (-1151.725) (-1146.788) (-1149.123) [-1137.706] -- 0:00:07
965000 -- (-1140.159) (-1146.402) (-1138.319) [-1150.821] * (-1150.729) [-1136.528] (-1137.845) (-1144.836) -- 0:00:07
Average standard deviation of split frequencies: 0.005218
966000 -- (-1145.463) (-1144.477) (-1150.294) [-1139.196] * (-1139.865) (-1138.631) (-1140.897) [-1146.275] -- 0:00:06
967000 -- (-1141.317) (-1146.691) (-1144.793) [-1143.204] * (-1149.580) (-1139.586) (-1139.370) [-1139.154] -- 0:00:06
968000 -- (-1143.101) (-1140.991) (-1143.570) [-1137.037] * (-1149.238) [-1143.996] (-1151.991) (-1140.938) -- 0:00:06
969000 -- [-1137.463] (-1143.407) (-1153.847) (-1152.161) * (-1152.139) (-1141.566) [-1144.066] (-1147.068) -- 0:00:06
970000 -- (-1149.460) [-1142.648] (-1150.692) (-1149.171) * (-1140.110) (-1145.896) (-1147.203) [-1142.272] -- 0:00:06
Average standard deviation of split frequencies: 0.005529
971000 -- [-1143.902] (-1140.891) (-1143.450) (-1142.266) * (-1145.090) (-1150.241) (-1143.664) [-1138.434] -- 0:00:05
972000 -- (-1141.430) (-1140.206) [-1139.632] (-1158.914) * (-1142.692) (-1143.407) [-1137.672] (-1140.647) -- 0:00:05
973000 -- (-1144.784) (-1149.259) [-1144.282] (-1153.587) * (-1138.632) (-1140.125) [-1138.526] (-1142.291) -- 0:00:05
974000 -- (-1146.436) (-1148.018) [-1139.242] (-1156.595) * (-1150.129) [-1142.611] (-1153.137) (-1148.920) -- 0:00:05
975000 -- (-1140.706) [-1138.244] (-1136.585) (-1142.994) * [-1138.290] (-1144.666) (-1144.833) (-1144.787) -- 0:00:05
Average standard deviation of split frequencies: 0.005499
976000 -- [-1139.653] (-1142.020) (-1140.038) (-1148.837) * [-1140.140] (-1141.756) (-1145.851) (-1140.732) -- 0:00:04
977000 -- [-1141.928] (-1140.229) (-1138.955) (-1151.887) * (-1149.512) [-1148.706] (-1147.134) (-1146.388) -- 0:00:04
978000 -- (-1142.401) (-1146.757) [-1143.346] (-1139.746) * (-1137.545) (-1139.267) (-1143.006) [-1135.480] -- 0:00:04
979000 -- (-1146.672) (-1144.038) [-1151.316] (-1136.549) * (-1137.723) (-1141.726) (-1139.901) [-1141.975] -- 0:00:04
980000 -- [-1136.398] (-1141.250) (-1143.781) (-1151.785) * (-1142.515) (-1142.403) [-1140.353] (-1141.522) -- 0:00:04
Average standard deviation of split frequencies: 0.005620
981000 -- [-1137.352] (-1147.226) (-1143.942) (-1146.611) * [-1139.067] (-1149.220) (-1139.149) (-1147.815) -- 0:00:03
982000 -- (-1154.024) (-1134.974) (-1146.933) [-1143.056] * (-1148.898) (-1150.185) [-1140.316] (-1150.137) -- 0:00:03
983000 -- (-1147.817) (-1142.831) [-1139.922] (-1145.675) * [-1154.707] (-1144.688) (-1146.191) (-1150.602) -- 0:00:03
984000 -- (-1151.199) (-1142.444) (-1147.599) [-1142.775] * (-1142.939) (-1141.836) [-1143.591] (-1150.040) -- 0:00:03
985000 -- (-1145.806) [-1145.597] (-1148.035) (-1142.532) * [-1148.232] (-1147.750) (-1143.801) (-1141.132) -- 0:00:03
Average standard deviation of split frequencies: 0.005664
986000 -- (-1149.954) [-1148.729] (-1141.059) (-1140.624) * (-1145.066) (-1140.680) [-1139.833] (-1138.480) -- 0:00:02
987000 -- [-1141.395] (-1152.355) (-1143.540) (-1140.803) * (-1158.173) (-1142.086) [-1145.749] (-1139.718) -- 0:00:02
988000 -- (-1139.585) (-1142.387) [-1138.428] (-1139.290) * (-1140.657) [-1140.491] (-1134.444) (-1142.723) -- 0:00:02
989000 -- (-1145.106) (-1149.711) (-1141.026) [-1142.387] * (-1145.754) [-1146.959] (-1134.628) (-1143.415) -- 0:00:02
990000 -- [-1143.142] (-1144.683) (-1142.107) (-1139.318) * (-1143.816) [-1146.420] (-1153.066) (-1139.494) -- 0:00:02
Average standard deviation of split frequencies: 0.005783
991000 -- [-1138.078] (-1150.197) (-1142.365) (-1141.489) * (-1147.323) [-1141.255] (-1150.807) (-1143.123) -- 0:00:01
992000 -- (-1141.130) (-1140.640) (-1139.986) [-1137.165] * (-1146.371) [-1142.266] (-1150.903) (-1142.617) -- 0:00:01
993000 -- (-1153.997) (-1150.613) (-1138.909) [-1146.369] * (-1142.411) (-1148.544) (-1142.582) [-1138.627] -- 0:00:01
994000 -- [-1139.569] (-1144.639) (-1141.744) (-1141.148) * (-1157.212) [-1139.908] (-1140.806) (-1140.203) -- 0:00:01
995000 -- (-1141.318) (-1140.723) [-1136.977] (-1139.724) * [-1136.827] (-1152.758) (-1142.541) (-1144.617) -- 0:00:01
Average standard deviation of split frequencies: 0.005789
996000 -- (-1144.640) [-1146.313] (-1147.730) (-1140.641) * [-1144.730] (-1138.943) (-1144.370) (-1136.181) -- 0:00:00
997000 -- (-1137.811) (-1146.698) [-1138.666] (-1140.221) * (-1146.861) (-1138.829) [-1136.640] (-1141.595) -- 0:00:00
998000 -- (-1142.999) [-1139.759] (-1153.095) (-1146.097) * [-1140.026] (-1138.422) (-1145.651) (-1151.648) -- 0:00:00
999000 -- [-1139.768] (-1138.404) (-1145.541) (-1142.602) * (-1135.738) (-1145.939) (-1152.389) [-1144.124] -- 0:00:00
1000000 -- (-1141.592) (-1142.740) (-1137.958) [-1138.338] * (-1142.083) (-1142.239) [-1147.944] (-1143.178) -- 0:00:00
Average standard deviation of split frequencies: 0.005472
Analysis completed in 3 mins 23 seconds
Analysis used 203.02 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1131.13
Likelihood of best state for "cold" chain of run 2 was -1131.30
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
70.3 % ( 61 %) Dirichlet(Revmat{all})
83.9 % ( 76 %) Slider(Revmat{all})
28.0 % ( 24 %) Dirichlet(Pi{all})
30.7 % ( 29 %) Slider(Pi{all})
80.6 % ( 66 %) Multiplier(Alpha{1,2})
74.5 % ( 56 %) Multiplier(Alpha{3})
91.8 % ( 84 %) Slider(Pinvar{all})
39.5 % ( 29 %) ExtSPR(Tau{all},V{all})
30.7 % ( 31 %) ExtTBR(Tau{all},V{all})
44.0 % ( 39 %) NNI(Tau{all},V{all})
30.8 % ( 35 %) ParsSPR(Tau{all},V{all})
27.5 % ( 30 %) Multiplier(V{all})
66.0 % ( 59 %) Nodeslider(V{all})
26.3 % ( 15 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
69.9 % ( 69 %) Dirichlet(Revmat{all})
83.2 % ( 76 %) Slider(Revmat{all})
28.3 % ( 23 %) Dirichlet(Pi{all})
30.6 % ( 26 %) Slider(Pi{all})
80.5 % ( 57 %) Multiplier(Alpha{1,2})
73.5 % ( 53 %) Multiplier(Alpha{3})
92.4 % ( 88 %) Slider(Pinvar{all})
39.7 % ( 43 %) ExtSPR(Tau{all},V{all})
30.4 % ( 27 %) ExtTBR(Tau{all},V{all})
44.2 % ( 45 %) NNI(Tau{all},V{all})
30.4 % ( 33 %) ParsSPR(Tau{all},V{all})
27.4 % ( 24 %) Multiplier(V{all})
66.1 % ( 70 %) Nodeslider(V{all})
26.4 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.76 0.56 0.40
2 | 166849 0.78 0.59
3 | 166620 166372 0.79
4 | 166340 166804 167015
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.76 0.56 0.40
2 | 166925 0.78 0.59
3 | 166174 166998 0.79
4 | 166609 166563 166731
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1139.85
| 1 |
| 2 1 1 2 |
|1 2 1 1 2 2 22 |
| 2 1 2 2 22 1 1 1 1 |
| 2 1 2 111 12 1 2 |
| 1 2 ** 2 2 2 12 1 11 2 1|
| 2 1 1 2 2 2 11 * |
|21 2 1 1 221 2 2 21 1 2 21 2 |
| 2 1 2 2 2 1 2 11 2 1 11 2|
| 1 2 2 1 1 2 2 2 2 21 1 |
| 11 2 2 2 |
| 21 1 1 2 2 1 1 |
| 1 1 1 |
| |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1143.56
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1137.57 -1148.79
2 -1137.58 -1149.81
--------------------------------------
TOTAL -1137.57 -1149.42
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.055752 0.000133 0.034925 0.078134 0.054568 1143.17 1257.78 1.000
r(A<->C){all} 0.134661 0.003567 0.030913 0.254384 0.127570 469.02 611.46 1.000
r(A<->G){all} 0.176013 0.004119 0.052163 0.293553 0.169420 470.02 561.53 1.001
r(A<->T){all} 0.059485 0.001406 0.000033 0.131165 0.053183 452.37 534.03 1.001
r(C<->G){all} 0.084981 0.002880 0.000173 0.191168 0.075875 491.64 509.57 1.000
r(C<->T){all} 0.344982 0.006469 0.199141 0.502817 0.338709 678.52 681.85 1.001
r(G<->T){all} 0.199877 0.004387 0.075444 0.327170 0.195841 495.83 614.45 1.001
pi(A){all} 0.251697 0.000276 0.219531 0.284867 0.251695 938.93 1164.32 1.000
pi(C){all} 0.225184 0.000243 0.195861 0.256535 0.224815 1150.03 1211.36 1.000
pi(G){all} 0.209728 0.000231 0.181366 0.240873 0.209306 961.35 1159.48 1.000
pi(T){all} 0.313391 0.000313 0.280244 0.347870 0.313146 1067.31 1136.26 1.000
alpha{1,2} 0.879031 0.888504 0.000174 2.826837 0.567818 983.33 1110.22 1.000
alpha{3} 1.396129 1.276684 0.002101 3.552859 1.091005 1302.26 1310.03 1.000
pinvar{all} 0.332767 0.046524 0.000028 0.714439 0.314464 634.58 660.52 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- ..******
10 -- .....**.
11 -- ..***..*
12 -- ...**...
13 -- ..*....*
14 -- ..*.*..*
15 -- ...*...*
16 -- ..*.*...
17 -- ..**...*
18 -- ....*..*
19 -- ..**....
20 -- ...**..*
21 -- ..***...
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 3000 0.999334 0.000942 0.998668 1.000000 2
10 2836 0.944704 0.010364 0.937375 0.952032 2
11 2705 0.901066 0.006124 0.896736 0.905396 2
12 601 0.200200 0.003298 0.197868 0.202532 2
13 591 0.196869 0.007066 0.191872 0.201865 2
14 590 0.196536 0.004711 0.193205 0.199867 2
15 578 0.192538 0.004711 0.189207 0.195869 2
16 577 0.192205 0.004240 0.189207 0.195203 2
17 569 0.189540 0.011777 0.181213 0.197868 2
18 566 0.188541 0.002827 0.186542 0.190540 2
19 558 0.185876 0.006595 0.181213 0.190540 2
20 552 0.183877 0.001884 0.182545 0.185210 2
21 542 0.180546 0.006595 0.175883 0.185210 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.005611 0.000008 0.001029 0.011488 0.005169 1.000 2
length{all}[2] 0.028002 0.000060 0.014713 0.043326 0.026852 1.000 2
length{all}[3] 0.001142 0.000001 0.000001 0.003456 0.000800 1.000 2
length{all}[4] 0.001162 0.000001 0.000000 0.003487 0.000815 1.000 2
length{all}[5] 0.001127 0.000001 0.000000 0.003372 0.000778 1.000 2
length{all}[6] 0.001137 0.000001 0.000001 0.003477 0.000775 1.000 2
length{all}[7] 0.001109 0.000001 0.000000 0.003322 0.000793 1.001 2
length{all}[8] 0.001112 0.000001 0.000000 0.003391 0.000758 1.000 2
length{all}[9] 0.008590 0.000013 0.002529 0.015786 0.008124 1.000 2
length{all}[10] 0.002357 0.000003 0.000063 0.005795 0.001964 1.000 2
length{all}[11] 0.002313 0.000003 0.000003 0.005656 0.001895 1.001 2
length{all}[12] 0.001136 0.000001 0.000001 0.003414 0.000787 0.998 2
length{all}[13] 0.001207 0.000001 0.000001 0.003640 0.000894 1.000 2
length{all}[14] 0.001053 0.000001 0.000001 0.003209 0.000702 1.000 2
length{all}[15] 0.001134 0.000001 0.000002 0.003392 0.000748 0.998 2
length{all}[16] 0.001072 0.000001 0.000001 0.003312 0.000784 1.000 2
length{all}[17] 0.001227 0.000002 0.000004 0.003596 0.000837 0.999 2
length{all}[18] 0.001119 0.000001 0.000001 0.003506 0.000814 0.998 2
length{all}[19] 0.001171 0.000001 0.000004 0.003496 0.000824 1.000 2
length{all}[20] 0.001117 0.000001 0.000002 0.003204 0.000766 1.000 2
length{all}[21] 0.001147 0.000001 0.000003 0.003484 0.000833 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005472
Maximum standard deviation of split frequencies = 0.011777
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
| /------------------------ C3 (3)
+ |
| |------------------------ C4 (4)
| /-----------90----------+
| | |------------------------ C5 (5)
| | |
\----------100----------+ \------------------------ C8 (8)
|
| /------------------------ C6 (6)
\-----------94----------+
\------------------------ C7 (7)
Phylogram (based on average branch lengths):
/-------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
| /-- C3 (3)
+ |
| |-- C4 (4)
| /----+
| | |-- C5 (5)
| | |
\---------------------+ \-- C8 (8)
|
| /-- C6 (6)
\----+
\-- C7 (7)
|------------| 0.005 expected changes per site
Calculating tree probabilities...
Credible sets of trees (135 trees sampled):
50 % credible set contains 9 trees
90 % credible set contains 39 trees
95 % credible set contains 72 trees
99 % credible set contains 113 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Thu Oct 20 00:46:27 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=8, Len=229
C1 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C2 MSNGDNSTIPTDVVIQHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C3 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C4 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C5 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C6 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C7 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
C8 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL
.*.*** * *::**********************************
C1 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C2 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C3 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
C4 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
C5 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
C6 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C7 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV
C8 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV
*************************************:************
C1 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C2 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C3 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C4 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C5 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C6 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C7 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
C8 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG
**************************************************
C1 TLLVEGIKIATGVQVNQLPTYITVVKPSTTIVYQRAGRSLNTRSNTGWAF
C2 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C3 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C4 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C5 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C6 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C7 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
C8 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF
********:***************.*************************
C1 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C2 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C3 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C4 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C5 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C6 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C7 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
C8 YVRSKNGDYSAVTSSADSLTEDEKLLHLV
*****************************
-- Starting log on Thu Oct 20 01:04:27 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/codeml,175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 687 sites
reading seq# 2 C2 687 sites
reading seq# 3 C3 687 sites
reading seq# 4 C4 687 sites
reading seq# 5 C5 687 sites
reading seq# 6 C6 687 sites
reading seq# 7 C7 687 sites
reading seq# 8 C8 687 sitesns = 8 ls = 687
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Sites with gaps or missing data are removed.
9 ambiguity characters in seq. 1
9 ambiguity characters in seq. 3
9 ambiguity characters in seq. 4
9 ambiguity characters in seq. 5
9 ambiguity characters in seq. 6
9 ambiguity characters in seq. 7
9 ambiguity characters in seq. 8
3 sites are removed. 1 2 3
Sequences read..
Counting site patterns.. 0:00
Compressing, 76 patterns at 226 / 226 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 76 patterns at 226 / 226 sites (100.0%), 0:00
Counting codons..
224 bytes for distance
74176 bytes for conP
6688 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, ((3, 4, 5, 8), (6, 7))); MP score: 23
148352 bytes for conP, adjusted
0.073511 0.049456 0.075350 0.087000 0.053006 0.017322 0.047025 0.076485 0.038076 0.018087 0.070929 0.300000 0.826413 0.371614
ntime & nrate & np: 11 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.037526
np = 14
lnL0 = -1215.593817
Iterating by ming2
Initial: fx= 1215.593817
x= 0.07351 0.04946 0.07535 0.08700 0.05301 0.01732 0.04702 0.07648 0.03808 0.01809 0.07093 0.30000 0.82641 0.37161
1 h-m-p 0.0000 0.0001 654.4454 ++ 1181.801737 m 0.0001 19 | 1/14
2 h-m-p 0.0000 0.0000 4498.4568 ++ 1180.635265 m 0.0000 36 | 2/14
3 h-m-p 0.0000 0.0000 12286.4508 ++ 1146.148697 m 0.0000 53 | 3/14
4 h-m-p 0.0000 0.0000 2761.5125 ++ 1141.187704 m 0.0000 70 | 4/14
5 h-m-p 0.0000 0.0000 2399.1040 ++ 1130.282757 m 0.0000 87 | 5/14
6 h-m-p 0.0000 0.0000 844.4859 ++ 1128.447469 m 0.0000 104 | 6/14
7 h-m-p 0.0000 0.0002 230.3526 +YCYCCC 1123.667857 5 0.0002 131 | 6/14
8 h-m-p 0.0008 0.0096 51.1747 ++ 1113.647625 m 0.0096 148 | 6/14
9 h-m-p 0.0001 0.0004 264.6651 +CCC 1111.903743 2 0.0004 170 | 6/14
10 h-m-p 0.0001 0.0004 36.2506 ++ 1111.415629 m 0.0004 187 | 7/14
11 h-m-p 0.0002 0.0195 58.7688 +YYCCC 1110.832618 4 0.0011 211 | 7/14
12 h-m-p 0.0523 0.2615 0.9564 +YYCCCC 1106.714872 5 0.1631 237 | 7/14
13 h-m-p 0.0703 0.8783 2.2181 +YCYC 1104.824708 3 0.2055 266 | 7/14
14 h-m-p 0.0878 0.4392 0.4108 YCCCC 1103.816213 4 0.2314 290 | 7/14
15 h-m-p 0.4868 8.0000 0.1953 +YCCCC 1101.694043 4 1.3326 322 | 7/14
16 h-m-p 0.1993 0.9963 0.2618 YCYCCC 1100.652466 5 0.5048 354 | 7/14
17 h-m-p 0.4849 2.4247 0.0906 YCCCC 1100.182993 4 0.9429 385 | 7/14
18 h-m-p 1.2986 8.0000 0.0658 CYCC 1099.991108 3 0.9545 414 | 7/14
19 h-m-p 0.8238 7.9880 0.0762 +YCC 1099.751302 2 2.1360 442 | 7/14
20 h-m-p 1.6000 8.0000 0.0086 YC 1099.627425 1 3.6363 467 | 7/14
21 h-m-p 1.0696 8.0000 0.0292 ++ 1099.297391 m 8.0000 491 | 7/14
22 h-m-p 1.6000 8.0000 0.0383 CYC 1099.247185 2 1.3248 518 | 7/14
23 h-m-p 1.6000 8.0000 0.0098 +YC 1099.191391 1 5.0939 544 | 7/14
24 h-m-p 1.6000 8.0000 0.0287 CYC 1099.168791 2 1.7952 571 | 7/14
25 h-m-p 1.6000 8.0000 0.0134 CC 1099.165510 1 1.7703 597 | 7/14
26 h-m-p 1.6000 8.0000 0.0020 C 1099.165285 0 1.5175 621 | 7/14
27 h-m-p 1.6000 8.0000 0.0001 C 1099.165278 0 1.7544 645 | 7/14
28 h-m-p 1.6000 8.0000 0.0000 C 1099.165277 0 1.4802 669 | 7/14
29 h-m-p 1.6000 8.0000 0.0000 Y 1099.165277 0 0.9253 693 | 7/14
30 h-m-p 1.6000 8.0000 0.0000 Y 1099.165277 0 1.6000 717 | 7/14
31 h-m-p 1.6000 8.0000 0.0000 Y 1099.165277 0 1.6000 741 | 7/14
32 h-m-p 1.5151 8.0000 0.0000 --Y 1099.165277 0 0.0413 767 | 7/14
33 h-m-p 0.3159 8.0000 0.0000 ----C 1099.165277 0 0.0003 795
Out..
lnL = -1099.165277
796 lfun, 2388 eigenQcodon, 17512 P(t)
end of tree file.
Time used: 0:07
Model 2: PositiveSelection
TREE # 1
(1, 2, ((3, 4, 5, 8), (6, 7))); MP score: 23
0.024699 0.075005 0.035053 0.095394 0.074448 0.074811 0.025003 0.032622 0.018077 0.096778 0.074433 1.757262 0.918310 0.366670 0.201440 1.513856
ntime & nrate & np: 11 3 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.396216
np = 16
lnL0 = -1201.724964
Iterating by ming2
Initial: fx= 1201.724964
x= 0.02470 0.07500 0.03505 0.09539 0.07445 0.07481 0.02500 0.03262 0.01808 0.09678 0.07443 1.75726 0.91831 0.36667 0.20144 1.51386
1 h-m-p 0.0000 0.0001 529.8089 ++ 1166.744274 m 0.0001 21 | 0/16
2 h-m-p 0.0000 0.0000 7659.7484
h-m-p: 2.40122924e-21 1.20061462e-20 7.65974842e+03 1166.744274
.. | 0/16
3 h-m-p 0.0000 0.0000 817.8590 ++ 1166.477271 m 0.0000 56 | 1/16
4 h-m-p 0.0000 0.0000 776.1553 ++ 1157.493387 m 0.0000 75 | 2/16
5 h-m-p 0.0000 0.0001 1373.0712 ++ 1119.332836 m 0.0001 94 | 3/16
6 h-m-p 0.0000 0.0000 1512.0006 ++ 1119.064171 m 0.0000 113 | 4/16
7 h-m-p 0.0000 0.0001 192.3407 ++ 1115.093310 m 0.0001 132 | 5/16
8 h-m-p 0.0000 0.0000 2365442.7197 ++ 1110.027117 m 0.0000 151 | 6/16
9 h-m-p 0.0000 0.0002 117.4231 +YYYCCC 1108.410643 5 0.0001 178 | 6/16
10 h-m-p 0.0004 0.0031 45.8255 ++ 1107.720590 m 0.0031 197 | 7/16
11 h-m-p 0.0073 0.4958 5.8048 ++CYCCCC 1100.933141 5 0.1941 227 | 7/16
12 h-m-p 0.0606 0.3032 2.8509 +YYCCC 1099.537923 4 0.2020 253 | 7/16
13 h-m-p 0.1271 1.4891 4.5310 +CYCCC 1093.981180 4 0.7616 280 | 6/16
14 h-m-p 0.0149 0.0745 46.2586 YCCC 1093.947805 3 0.0023 304 | 6/16
15 h-m-p 0.0387 5.4699 2.7210 +CYCC 1093.312173 3 0.2071 329 | 6/16
16 h-m-p 0.0565 0.2823 1.8411 ++ 1092.550188 m 0.2823 348 | 7/16
17 h-m-p 0.4887 7.6677 1.0613 YCC 1092.325648 2 0.3814 370 | 7/16
18 h-m-p 0.2653 8.0000 1.5253 +CCC 1091.869222 2 1.2587 394 | 7/16
19 h-m-p 1.6000 8.0000 0.8430 CCC 1091.633052 2 2.0727 417 | 7/16
20 h-m-p 1.6000 8.0000 0.7396 CC 1091.468676 1 2.5253 447 | 6/16
21 h-m-p 0.0036 0.0350 520.6498 CC 1091.353107 1 0.0031 477 | 6/16
22 h-m-p 1.2293 8.0000 1.3318 YCCC 1091.210035 3 2.2330 501 | 6/16
23 h-m-p 1.6000 8.0000 1.0930 YCCC 1091.004272 3 3.2884 525 | 6/16
24 h-m-p 1.3642 8.0000 2.6347 YCCC 1090.960442 3 0.8705 549 | 6/16
25 h-m-p 1.6000 8.0000 0.8597 CCC 1090.920734 2 1.5478 572 | 6/16
26 h-m-p 1.2339 8.0000 1.0784 YC 1090.901111 1 2.4725 602 | 6/16
27 h-m-p 1.6000 8.0000 0.1552 CC 1090.897975 1 1.4469 623 | 6/16
28 h-m-p 0.9057 8.0000 0.2479 CC 1090.897316 1 1.3749 654 | 6/16
29 h-m-p 1.6000 8.0000 0.0154 YC 1090.897184 1 3.0227 684 | 6/16
30 h-m-p 1.6000 8.0000 0.0050 Y 1090.897134 0 2.6693 713 | 6/16
31 h-m-p 0.8905 8.0000 0.0151 Y 1090.897126 0 2.0015 742 | 6/16
32 h-m-p 1.6000 8.0000 0.0062 C 1090.897125 0 1.8631 771 | 6/16
33 h-m-p 1.6000 8.0000 0.0009 C 1090.897125 0 1.3727 800 | 6/16
34 h-m-p 1.6000 8.0000 0.0006 C 1090.897125 0 1.4211 829 | 6/16
35 h-m-p 1.6000 8.0000 0.0001 --C 1090.897125 0 0.0250 860 | 6/16
36 h-m-p 0.0313 8.0000 0.0000 -----Y 1090.897125 0 0.0000 894
Out..
lnL = -1090.897125
895 lfun, 3580 eigenQcodon, 29535 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1099.863568 S = -1054.689809 -62.683713
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 76 patterns 0:17
did 20 / 76 patterns 0:17
did 30 / 76 patterns 0:17
did 40 / 76 patterns 0:17
did 50 / 76 patterns 0:17
did 60 / 76 patterns 0:17
did 70 / 76 patterns 0:17
did 76 / 76 patterns 0:17end of tree file.
Time used: 0:17
Model 7: beta
TREE # 1
(1, 2, ((3, 4, 5, 8), (6, 7))); MP score: 23
0.099492 0.061389 0.073753 0.092131 0.095434 0.059563 0.072881 0.069982 0.084272 0.018804 0.108326 2.638324 0.960376 1.427639
ntime & nrate & np: 11 1 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.074463
np = 14
lnL0 = -1240.080106
Iterating by ming2
Initial: fx= 1240.080106
x= 0.09949 0.06139 0.07375 0.09213 0.09543 0.05956 0.07288 0.06998 0.08427 0.01880 0.10833 2.63832 0.96038 1.42764
1 h-m-p 0.0000 0.0001 607.9968 ++ 1206.054470 m 0.0001 19 | 1/14
2 h-m-p 0.0000 0.0000 36751.1913 ++ 1142.198944 m 0.0000 36 | 2/14
3 h-m-p 0.0000 0.0000 11443.4520 ++ 1129.423142 m 0.0000 53 | 3/14
4 h-m-p 0.0000 0.0000 1652.2183 ++ 1127.199923 m 0.0000 70 | 4/14
5 h-m-p 0.0000 0.0001 670.0215 ++ 1116.078294 m 0.0001 87 | 5/14
6 h-m-p 0.0000 0.0000 833.9298 ++ 1112.509876 m 0.0000 104 | 6/14
7 h-m-p 0.0000 0.0003 153.1723 +YCCCCC 1109.177001 5 0.0002 132 | 6/14
8 h-m-p 0.0012 0.0062 5.3606 +YYCYCC 1108.180459 5 0.0042 157 | 6/14
9 h-m-p 0.0022 0.0108 9.8084 +YYCCC 1106.327343 4 0.0073 181 | 6/14
10 h-m-p 0.0132 0.0662 3.7838 +YCYCCC 1105.750244 5 0.0375 207 | 6/14
11 h-m-p 0.0157 0.0885 9.0749 YCYCCC 1104.680121 5 0.0400 232 | 6/14
12 h-m-p 0.2129 1.0645 1.4614 YCYCCC 1103.324295 5 0.4567 257 | 6/14
13 h-m-p 0.0646 0.3232 2.6857 CYCYC 1102.877035 4 0.1225 281 | 6/14
14 h-m-p 0.0994 0.4969 2.8357 CYCCC 1102.126771 4 0.1595 305 | 6/14
15 h-m-p 0.0322 0.1608 4.6842 +YYCYCCC 1101.223035 6 0.1100 332 | 6/14
16 h-m-p 0.0225 0.1124 2.1380 YCCCC 1101.070154 4 0.0454 356 | 6/14
17 h-m-p 0.0433 0.2165 0.7874 +YCYCCC 1099.621657 5 0.1867 382 | 6/14
18 h-m-p 0.1444 4.1436 1.0181 CYCC 1099.522756 3 0.1188 412 | 6/14
19 h-m-p 0.0159 0.0793 2.4577 ++ 1099.349654 m 0.0793 429 | 7/14
20 h-m-p 0.1260 0.6300 0.4292 YYYC 1099.307257 3 0.1164 449 | 7/14
21 h-m-p 0.1006 2.8653 0.4964 YC 1099.261267 1 0.1927 474 | 7/14
22 h-m-p 0.3619 2.8786 0.2643 --------------C 1099.261267 0 0.0000 512 | 7/14
23 h-m-p 0.0027 1.3635 0.0685 +++CCC 1099.219132 2 0.1891 543 | 7/14
24 h-m-p 1.6000 8.0000 0.0020 YC 1099.206293 1 0.8663 568 | 7/14
25 h-m-p 1.6000 8.0000 0.0007 YC 1099.205654 1 0.8773 593 | 7/14
26 h-m-p 1.6000 8.0000 0.0003 C 1099.205576 0 1.7238 617 | 7/14
27 h-m-p 0.9234 8.0000 0.0006 ++ 1099.205033 m 8.0000 641 | 6/14
28 h-m-p 0.0010 0.5000 5.9317 YYY 1099.204627 2 0.0010 667 | 6/14
29 h-m-p 0.1618 8.0000 0.0367 +YYC 1099.203399 2 0.5590 687 | 6/14
30 h-m-p 1.6000 8.0000 0.0074 YC 1099.203223 1 0.7805 713 | 6/14
31 h-m-p 1.6000 8.0000 0.0001 Y 1099.203204 0 0.9706 738 | 6/14
32 h-m-p 0.3923 8.0000 0.0003 Y 1099.203204 0 0.6887 763 | 6/14
33 h-m-p 1.6000 8.0000 0.0001 -----C 1099.203204 0 0.0004 793 | 6/14
34 h-m-p 0.0160 8.0000 0.0001 +++Y 1099.203203 0 2.1879 821 | 6/14
35 h-m-p 1.6000 8.0000 0.0000 ++ 1099.203197 m 8.0000 846 | 6/14
36 h-m-p 0.1320 8.0000 0.0022 ++C 1099.203105 0 2.2098 873 | 6/14
37 h-m-p 1.6000 8.0000 0.0011 ++ 1099.202727 m 8.0000 898 | 6/14
38 h-m-p 0.5465 2.7326 0.0015 ++ 1099.202670 m 2.7326 923 | 7/14
39 h-m-p 1.2364 6.1820 0.0025 -Y 1099.202670 0 0.0400 949 | 7/14
40 h-m-p 0.2066 8.0000 0.0005 +C 1099.202669 0 1.0132 974 | 7/14
41 h-m-p 1.6000 8.0000 0.0000 Y 1099.202669 0 0.9994 998 | 7/14
42 h-m-p 1.6000 8.0000 0.0000 Y 1099.202669 0 1.6000 1022 | 7/14
43 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 7/14
44 h-m-p 0.0160 8.0000 0.0001 -----Y 1099.202669 0 0.0000 1089
Out..
lnL = -1099.202669
1090 lfun, 11990 eigenQcodon, 119900 P(t)
end of tree file.
Time used: 1:00
Model 8: beta&w>1
TREE # 1
(1, 2, ((3, 4, 5, 8), (6, 7))); MP score: 23
0.069344 0.109897 0.062451 0.025265 0.052975 0.033524 0.082359 0.064481 0.075392 0.070165 0.051355 1.782534 0.900000 0.496987 1.570236 1.300000
ntime & nrate & np: 11 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.572527
np = 16
lnL0 = -1195.818605
Iterating by ming2
Initial: fx= 1195.818605
x= 0.06934 0.10990 0.06245 0.02527 0.05297 0.03352 0.08236 0.06448 0.07539 0.07017 0.05135 1.78253 0.90000 0.49699 1.57024 1.30000
1 h-m-p 0.0000 0.0002 544.2335 +++ 1148.179312 m 0.0002 22 | 0/16
2 h-m-p 0.0000 0.0000 7111.2511
h-m-p: 3.11931576e-21 1.55965788e-20 7.11125108e+03 1148.179312
.. | 0/16
3 h-m-p 0.0000 0.0000 2929.2364 +YCYCCC 1145.714769 5 0.0000 66 | 0/16
4 h-m-p 0.0000 0.0000 567.1482 ++ 1144.779520 m 0.0000 85 | 1/16
5 h-m-p 0.0000 0.0000 1868.8693 ++ 1118.944822 m 0.0000 104 | 2/16
6 h-m-p 0.0000 0.0000 395.2512 ++ 1117.291836 m 0.0000 123 | 3/16
7 h-m-p 0.0000 0.0000 732.4699 ++ 1109.932791 m 0.0000 142 | 4/16
8 h-m-p 0.0000 0.0000 2427.6849 ++ 1107.306419 m 0.0000 161 | 5/16
9 h-m-p 0.0000 0.0000 1497.4300 ++ 1104.654050 m 0.0000 180 | 6/16
10 h-m-p 0.0010 0.0166 11.4919 +YCCCCC 1103.402436 5 0.0048 209 | 6/16
11 h-m-p 0.0024 0.0122 13.3811 +YYCYCC 1102.355355 5 0.0081 236 | 6/16
12 h-m-p 0.0045 0.0226 17.4008 ++ 1099.651699 m 0.0226 255 | 6/16
13 h-m-p 0.0000 0.0000 8.9291
h-m-p: 1.08658438e-19 5.43292191e-19 8.92905778e+00 1099.651699
.. | 6/16
14 h-m-p 0.0000 0.0001 223.9896 +YYC 1099.030527 2 0.0000 293 | 6/16
15 h-m-p 0.0000 0.0001 163.7226 YCYCCC 1098.751733 5 0.0000 320 | 7/16
16 h-m-p 0.0000 0.0005 118.9520 +CCC 1098.202139 2 0.0001 344 | 7/16
17 h-m-p 0.0002 0.0122 79.6393 YCCC 1097.648261 3 0.0003 368 | 7/16
18 h-m-p 0.0002 0.0009 84.3914 YCCCC 1097.363435 4 0.0002 394 | 7/16
19 h-m-p 0.0041 0.5795 3.7401 CC 1097.335596 1 0.0041 415 | 7/16
20 h-m-p 0.0007 0.1616 22.9499 +++YCYCYCCC 1094.240706 7 0.0802 448 | 7/16
21 h-m-p 1.2554 6.2771 0.6623 YCCCC 1093.529062 4 0.6970 474 | 7/16
22 h-m-p 0.5484 7.5243 0.8418 +YYYYCCCCCC 1092.384078 9 2.4862 517 | 7/16
23 h-m-p 1.6000 8.0000 0.8705 CCC 1091.901521 2 1.6390 549 | 7/16
24 h-m-p 0.8843 8.0000 1.6135 CCCC 1091.560732 3 1.2885 583 | 7/16
25 h-m-p 1.6000 8.0000 0.8346 CCC 1091.463721 2 1.2085 606 | 7/16
26 h-m-p 0.9682 8.0000 1.0418 CCC 1091.418647 2 1.1132 638 | 7/16
27 h-m-p 1.6000 8.0000 0.4088 CC 1091.405428 1 1.2877 659 | 7/16
28 h-m-p 1.6000 8.0000 0.1540 CC 1091.404587 1 1.2728 689 | 7/16
29 h-m-p 1.6000 8.0000 0.0193 Y 1091.404556 0 1.1183 717 | 6/16
30 h-m-p 0.8026 8.0000 0.0270 CCCC 1091.355492 3 1.1867 751 | 6/16
31 h-m-p 0.0160 8.0000 3.5618 ---Y 1091.355490 0 0.0000 783 | 6/16
32 h-m-p 0.0175 8.0000 0.0098 +++++ 1091.348313 m 8.0000 805 | 6/16
33 h-m-p 0.0001 0.0204 619.5439 +++YYCCC 1091.097196 4 0.0062 843 | 6/16
34 h-m-p 1.6000 8.0000 1.1845 CCC 1091.045909 2 1.8138 866 | 6/16
35 h-m-p 1.6000 8.0000 0.0885 CYC 1091.031241 2 0.4742 888 | 6/16
36 h-m-p 0.0473 8.0000 0.8872 +++YC 1090.967380 1 4.3718 921 | 6/16
37 h-m-p 1.6000 8.0000 0.6097 YCCC 1090.925521 3 2.4811 955 | 6/16
38 h-m-p 1.6000 8.0000 0.2782 CYC 1090.918705 2 1.4382 987 | 6/16
39 h-m-p 1.6000 8.0000 0.2475 YC 1090.918329 1 0.7328 1017 | 6/16
40 h-m-p 1.6000 8.0000 0.0449 C 1090.918230 0 2.3438 1046 | 6/16
41 h-m-p 1.6000 8.0000 0.0073 ++ 1090.917832 m 8.0000 1075 | 6/16
42 h-m-p 0.5792 8.0000 0.1002 +YC 1090.917264 1 1.8192 1106 | 6/16
43 h-m-p 1.6000 8.0000 0.0653 +C 1090.916046 0 6.6619 1136 | 6/16
44 h-m-p 1.6000 8.0000 0.1451 ++ 1090.910738 m 8.0000 1165 | 6/16
45 h-m-p 1.0933 8.0000 1.0618 +CCC 1090.905633 2 3.7386 1199 | 6/16
46 h-m-p 1.6000 8.0000 0.9623 CC 1090.903464 1 1.8804 1220 | 6/16
47 h-m-p 1.4956 8.0000 1.2099 +YC 1090.902096 1 3.9081 1251 | 6/16
48 h-m-p 1.6000 8.0000 2.6114 CC 1090.900927 1 1.8416 1272 | 6/16
49 h-m-p 1.5949 8.0000 3.0154 YC 1090.900033 1 3.6252 1292 | 6/16
50 h-m-p 1.6000 8.0000 4.4314 CC 1090.899481 1 2.1962 1313 | 6/16
51 h-m-p 1.6000 8.0000 5.8015 +C 1090.898938 0 5.7627 1333 | 6/16
52 h-m-p 0.5195 2.5977 10.2540 +C 1090.898708 0 1.9776 1353 | 6/16
53 h-m-p 0.1030 0.5149 12.3514 ++ 1090.898667 m 0.5149 1372 | 7/16
54 h-m-p 0.0467 7.0456 12.7301 -------------Y 1090.898667 0 0.0000 1404 | 7/16
55 h-m-p 0.0160 8.0000 0.0647 +++Y 1090.898567 0 0.8468 1426 | 7/16
56 h-m-p 1.6000 8.0000 0.0244 Y 1090.898564 0 0.8230 1454 | 7/16
57 h-m-p 1.6000 8.0000 0.0003 Y 1090.898564 0 1.2014 1482 | 7/16
58 h-m-p 1.5534 8.0000 0.0003 Y 1090.898564 0 0.6668 1510 | 7/16
59 h-m-p 0.7133 8.0000 0.0002 C 1090.898564 0 1.0477 1538 | 7/16
60 h-m-p 1.0812 8.0000 0.0002 Y 1090.898564 0 2.2881 1566 | 7/16
61 h-m-p 1.6000 8.0000 0.0002 ++ 1090.898564 m 8.0000 1594 | 7/16
62 h-m-p 1.6000 8.0000 0.0002 ++ 1090.898563 m 8.0000 1622 | 7/16
63 h-m-p 0.0816 8.0000 0.0185 ++C 1090.898531 0 2.0533 1652 | 7/16
64 h-m-p 1.6000 8.0000 0.0112 ++ 1090.898298 m 8.0000 1680 | 7/16
65 h-m-p 0.1936 8.0000 0.4613 +CC 1090.897769 1 0.9931 1711 | 7/16
66 h-m-p 1.6000 8.0000 0.0089 C 1090.897766 0 1.3578 1739 | 7/16
67 h-m-p 1.6000 8.0000 0.0007 Y 1090.897766 0 0.9784 1767 | 7/16
68 h-m-p 1.6000 8.0000 0.0001 C 1090.897766 0 1.3127 1795 | 7/16
69 h-m-p 1.6000 8.0000 0.0000 Y 1090.897766 0 0.6999 1823 | 7/16
70 h-m-p 0.6684 8.0000 0.0000 -----------Y 1090.897766 0 0.0000 1862
Out..
lnL = -1090.897766
1863 lfun, 22356 eigenQcodon, 225423 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1098.635654 S = -1054.689703 -75.063631
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 76 patterns 2:20
did 20 / 76 patterns 2:20
did 30 / 76 patterns 2:20
did 40 / 76 patterns 2:20
did 50 / 76 patterns 2:20
did 60 / 76 patterns 2:20
did 70 / 76 patterns 2:21
did 76 / 76 patterns 2:21end of tree file.
Time used: 2:21
The loglikelihoods for models M1, M2, M7 and M8 are -1099.165277 -1090.897125 -1099.202669 -1090.897766 respectively
The loglikelihood for model M2a is significantly different from that for M1a. Twice the difference is 16.536304
The loglikelihood for model M8 is significantly different from that for M7. Twice the difference is 16.609806
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWP
183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MSNGDNSTIPTDVVIQHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWP
SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWP
LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWP
TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWP
TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWP
TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWP
TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWP
.*.*** * *::********************************************
175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 LVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFVNSFRLYRRTNTFWAFNPETD
183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 LVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFVNSFRLYRRTNTFWAFNPETD
SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 LVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFVNSFRLYRRTNTFWAFNPETD
LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 LVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFVNSFRLYRRTNTFWAFNPETD
TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 LVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFVNSFRLYRRTNTFWAFNPETD
TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 LVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFVNSFRLYRRTNTFWAFNPETD
TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 LVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFVNSFRLYRRTNTFWAFNPETD
TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 LVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFVNSFRLYRRTNTFWAFNPETD
***************************:********************************
175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 AIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKIATGVQVNQLPTYITVVKPSTT
183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 AIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTT
SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 AIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTT
LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 AIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTT
TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 AIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTT
TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 AIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTT
TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 AIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTT
TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 AIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTT
**************************************:***************.*****
175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 IVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV
183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 IVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV
SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 IVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV
LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 IVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV
TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 IVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV
TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 IVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV
TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 IVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV
TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 IVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV
*************************************************
>175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTTCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGTTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGGCTTGCATTACGCTTGTGCTGTGGATAATGTACTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATTACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGATTGCTACTGGTGTGCAGGTAAACCAATTACCTACGTACATCACTGTTGTTAAGCCTAGCACCACAATTGTGTATCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAACACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGTCAAACGGTGACAATTCAACGATACCCACAGATGTGGTTATCCAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTTCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGGCTTGCATTACGCTTGTGCTGTGGATAATGTACTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATTACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAACCAATTACCTACGTACATCACTGTTGCCAAGCCTAGCACCACAATTGTGTATCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAACACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGTCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGCACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGTCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGCACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGTCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGCACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGGCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGTACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGGCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGTACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGTCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGCACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC
>175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFVNSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKIATGVQVNQLPTYITVVKPSTTIVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV >183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MSNGDNSTIPTDVVIQHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFVNSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV >SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFVNSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV >LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFVNSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV >TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFVNSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV >TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFVNSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV >TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFVNSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV >TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYILKMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFVNSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSGTLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAFYVRSKNGDYSAVTSSADSLTEDEKLLHLV
Reading sequence file /data//pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/codeml/fasta/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1
Found 8 sequences of length 687
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 1.4%
Found 8 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 1
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 22 polymorphic sites
**p-Value(s)**
----------
NSS: 1.00e+00 (1000 permutations)
Max Chi^2: 0.00e+00 (1000 permutations)
PHI (Permutation): 1.00e+00 (1000 permutations)
PHI (Normal): 1.00e+00
#NEXUS
[ID: 5401703558]
begin taxa;
dimensions ntax=8;
taxlabels
175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10
183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10
SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
end;
begin trees;
translate
1 175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
2 183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
3 SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
4 LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
5 TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10,
6 TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10,
7 TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10,
8 TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:5.169159e-03,2:2.685190e-02,((3:7.995302e-04,4:8.146082e-04,5:7.782939e-04,8:7.581198e-04)0.901:1.895405e-03,(6:7.746902e-04,7:7.930853e-04)0.945:1.964482e-03)0.999:8.124156e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:5.169159e-03,2:2.685190e-02,((3:7.995302e-04,4:8.146082e-04,5:7.782939e-04,8:7.581198e-04):1.895405e-03,(6:7.746902e-04,7:7.930853e-04):1.964482e-03):8.124156e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1137.57 -1148.79
2 -1137.58 -1149.81
--------------------------------------
TOTAL -1137.57 -1149.42
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.055752 0.000133 0.034925 0.078134 0.054568 1143.17 1257.78 1.000
r(A<->C){all} 0.134661 0.003567 0.030913 0.254384 0.127570 469.02 611.46 1.000
r(A<->G){all} 0.176013 0.004119 0.052163 0.293553 0.169420 470.02 561.53 1.001
r(A<->T){all} 0.059485 0.001406 0.000033 0.131165 0.053183 452.37 534.03 1.001
r(C<->G){all} 0.084981 0.002880 0.000173 0.191168 0.075875 491.64 509.57 1.000
r(C<->T){all} 0.344982 0.006469 0.199141 0.502817 0.338709 678.52 681.85 1.001
r(G<->T){all} 0.199877 0.004387 0.075444 0.327170 0.195841 495.83 614.45 1.001
pi(A){all} 0.251697 0.000276 0.219531 0.284867 0.251695 938.93 1164.32 1.000
pi(C){all} 0.225184 0.000243 0.195861 0.256535 0.224815 1150.03 1211.36 1.000
pi(G){all} 0.209728 0.000231 0.181366 0.240873 0.209306 961.35 1159.48 1.000
pi(T){all} 0.313391 0.000313 0.280244 0.347870 0.313146 1067.31 1136.26 1.000
alpha{1,2} 0.879031 0.888504 0.000174 2.826837 0.567818 983.33 1110.22 1.000
alpha{3} 1.396129 1.276684 0.002101 3.552859 1.091005 1302.26 1310.03 1.000
pinvar{all} 0.332767 0.046524 0.000028 0.714439 0.314464 634.58 660.52 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 8 ls = 226
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 9 9 9 9 9 9 | Ser TCT 3 2 4 4 4 3 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 6 6 6 6 6 6 | TGC 1 1 1 1 1 1
Leu TTA 5 5 5 5 5 5 | TCA 4 5 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 0 0 0 0 0 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 9 9 9 9 9 9
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 9 9 8 8 8 8 | Pro CCT 4 3 4 4 4 4 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 4 3 4 4 4 4 | CCC 0 1 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 3 3 3 3 3 3
CTA 3 3 3 3 3 3 | CCA 2 2 2 2 2 2 | Gln CAA 4 5 4 4 4 4 | CGA 0 0 0 0 0 0
CTG 7 8 9 9 9 9 | CCG 1 1 1 1 1 1 | CAG 2 1 2 2 2 2 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 11 9 9 9 9 9 | Thr ACT 6 6 6 6 6 6 | Asn AAT 5 5 7 7 7 7 | Ser AGT 7 7 7 7 7 8
ATC 4 5 5 5 5 5 | ACC 3 3 3 3 3 3 | AAC 8 8 6 6 6 6 | AGC 2 2 2 2 2 1
ATA 2 3 2 2 2 2 | ACA 8 8 8 8 8 8 | Lys AAA 4 4 4 4 4 4 | Arg AGA 3 3 3 3 3 3
Met ATG 5 4 5 5 5 5 | ACG 5 6 5 5 5 5 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 5 4 4 4 4 | Ala GCT 8 8 7 7 7 8 | Asp GAT 2 3 2 2 2 2 | Gly GGT 4 5 4 4 4 4
GTC 6 5 6 6 6 6 | GCC 4 5 5 5 5 5 | GAC 4 4 4 4 4 4 | GGC 4 4 4 4 4 4
GTA 4 4 4 4 4 4 | GCA 0 0 0 0 0 0 | Glu GAA 4 3 4 4 4 4 | GGA 2 2 2 2 2 2
GTG 8 8 8 8 8 8 | GCG 1 1 1 1 1 1 | GAG 2 1 2 2 2 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------
Phe TTT 9 9 | Ser TCT 3 4 | Tyr TAT 4 4 | Cys TGT 0 0
TTC 3 3 | TCC 1 1 | TAC 6 6 | TGC 1 1
Leu TTA 5 5 | TCA 4 4 | *** TAA 0 0 | *** TGA 0 0
TTG 0 0 | TCG 3 3 | TAG 0 0 | Trp TGG 9 9
----------------------------------------------------------------------
Leu CTT 8 8 | Pro CCT 4 4 | His CAT 2 2 | Arg CGT 2 2
CTC 4 4 | CCC 0 0 | CAC 1 1 | CGC 3 3
CTA 3 3 | CCA 2 2 | Gln CAA 4 4 | CGA 0 0
CTG 9 9 | CCG 1 1 | CAG 2 2 | CGG 0 0
----------------------------------------------------------------------
Ile ATT 9 9 | Thr ACT 6 6 | Asn AAT 7 7 | Ser AGT 8 7
ATC 5 5 | ACC 3 3 | AAC 6 6 | AGC 1 2
ATA 2 2 | ACA 8 8 | Lys AAA 4 4 | Arg AGA 3 3
Met ATG 5 5 | ACG 5 5 | AAG 2 2 | AGG 1 1
----------------------------------------------------------------------
Val GTT 4 4 | Ala GCT 8 7 | Asp GAT 2 2 | Gly GGT 4 4
GTC 6 6 | GCC 5 5 | GAC 4 4 | GGC 4 4
GTA 4 4 | GCA 0 0 | Glu GAA 4 4 | GGA 2 2
GTG 8 8 | GCG 1 1 | GAG 2 2 | GGG 0 0
----------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.21681 C:0.19469 A:0.33628 G:0.25221
position 2: T:0.37611 C:0.23451 A:0.22124 G:0.16814
position 3: T:0.35398 C:0.23894 A:0.19912 G:0.20796
Average T:0.31563 C:0.22271 A:0.25221 G:0.20944
#2: C2
position 1: T:0.21239 C:0.19469 A:0.33628 G:0.25664
position 2: T:0.36726 C:0.24336 A:0.21681 G:0.17257
position 3: T:0.34956 C:0.24336 A:0.20796 G:0.19912
Average T:0.30973 C:0.22714 A:0.25369 G:0.20944
#3: C3
position 1: T:0.21681 C:0.19912 A:0.33186 G:0.25221
position 2: T:0.37168 C:0.23894 A:0.22124 G:0.16814
position 3: T:0.34956 C:0.23894 A:0.19912 G:0.21239
Average T:0.31268 C:0.22566 A:0.25074 G:0.21091
#4: C4
position 1: T:0.21681 C:0.19912 A:0.33186 G:0.25221
position 2: T:0.37168 C:0.23894 A:0.22124 G:0.16814
position 3: T:0.34956 C:0.23894 A:0.19912 G:0.21239
Average T:0.31268 C:0.22566 A:0.25074 G:0.21091
#5: C5
position 1: T:0.21681 C:0.19912 A:0.33186 G:0.25221
position 2: T:0.37168 C:0.23894 A:0.22124 G:0.16814
position 3: T:0.34956 C:0.23894 A:0.19912 G:0.21239
Average T:0.31268 C:0.22566 A:0.25074 G:0.21091
#6: C6
position 1: T:0.21239 C:0.19912 A:0.33186 G:0.25664
position 2: T:0.37168 C:0.23894 A:0.22124 G:0.16814
position 3: T:0.35398 C:0.23451 A:0.19912 G:0.21239
Average T:0.31268 C:0.22419 A:0.25074 G:0.21239
#7: C7
position 1: T:0.21239 C:0.19912 A:0.33186 G:0.25664
position 2: T:0.37168 C:0.23894 A:0.22124 G:0.16814
position 3: T:0.35398 C:0.23451 A:0.19912 G:0.21239
Average T:0.31268 C:0.22419 A:0.25074 G:0.21239
#8: C8
position 1: T:0.21681 C:0.19912 A:0.33186 G:0.25221
position 2: T:0.37168 C:0.23894 A:0.22124 G:0.16814
position 3: T:0.34956 C:0.23894 A:0.19912 G:0.21239
Average T:0.31268 C:0.22566 A:0.25074 G:0.21091
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 72 | Ser S TCT 27 | Tyr Y TAT 32 | Cys C TGT 0
TTC 24 | TCC 8 | TAC 48 | TGC 8
Leu L TTA 40 | TCA 33 | *** * TAA 0 | *** * TGA 0
TTG 1 | TCG 24 | TAG 0 | Trp W TGG 72
------------------------------------------------------------------------------
Leu L CTT 66 | Pro P CCT 31 | His H CAT 16 | Arg R CGT 16
CTC 31 | CCC 1 | CAC 8 | CGC 24
CTA 24 | CCA 16 | Gln Q CAA 33 | CGA 0
CTG 69 | CCG 8 | CAG 15 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 74 | Thr T ACT 48 | Asn N AAT 52 | Ser S AGT 58
ATC 39 | ACC 24 | AAC 52 | AGC 14
ATA 17 | ACA 64 | Lys K AAA 32 | Arg R AGA 24
Met M ATG 39 | ACG 41 | AAG 16 | AGG 8
------------------------------------------------------------------------------
Val V GTT 33 | Ala A GCT 60 | Asp D GAT 17 | Gly G GGT 33
GTC 47 | GCC 39 | GAC 32 | GGC 32
GTA 32 | GCA 0 | Glu E GAA 31 | GGA 16
GTG 64 | GCG 8 | GAG 15 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21515 C:0.19801 A:0.33296 G:0.25387
position 2: T:0.37168 C:0.23894 A:0.22069 G:0.16869
position 3: T:0.35122 C:0.23838 A:0.20022 G:0.21018
Average T:0.31268 C:0.22511 A:0.25129 G:0.21091
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, ((3, 4, 5, 8), (6, 7))); MP score: 23
lnL(ntime: 11 np: 14): -1099.165277 +0.000000
9..1 9..2 9..10 10..11 11..3 11..4 11..5 11..8 10..12 12..6 12..7
0.017838 0.102691 0.027903 0.004521 0.000004 0.000004 0.000004 0.000004 0.004502 0.000004 0.000004 1.757262 0.818605 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.157479
(1: 0.017838, 2: 0.102691, ((3: 0.000004, 4: 0.000004, 5: 0.000004, 8: 0.000004): 0.004521, (6: 0.000004, 7: 0.000004): 0.004502): 0.027903);
(C1: 0.017838, C2: 0.102691, ((C3: 0.000004, C4: 0.000004, C5: 0.000004, C8: 0.000004): 0.004521, (C6: 0.000004, C7: 0.000004): 0.004502): 0.027903);
Detailed output identifying parameters
kappa (ts/tv) = 1.75726
MLEs of dN/dS (w) for site classes (K=2)
p: 0.81860 0.18140
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.018 500.3 177.7 0.1814 0.0027 0.0150 1.4 2.7
9..2 0.103 500.3 177.7 0.1814 0.0157 0.0865 7.8 15.4
9..10 0.028 500.3 177.7 0.1814 0.0043 0.0235 2.1 4.2
10..11 0.005 500.3 177.7 0.1814 0.0007 0.0038 0.3 0.7
11..3 0.000 500.3 177.7 0.1814 0.0000 0.0000 0.0 0.0
11..4 0.000 500.3 177.7 0.1814 0.0000 0.0000 0.0 0.0
11..5 0.000 500.3 177.7 0.1814 0.0000 0.0000 0.0 0.0
11..8 0.000 500.3 177.7 0.1814 0.0000 0.0000 0.0 0.0
10..12 0.005 500.3 177.7 0.1814 0.0007 0.0038 0.3 0.7
12..6 0.000 500.3 177.7 0.1814 0.0000 0.0000 0.0 0.0
12..7 0.000 500.3 177.7 0.1814 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, ((3, 4, 5, 8), (6, 7))); MP score: 23
lnL(ntime: 11 np: 16): -1090.897125 +0.000000
9..1 9..2 9..10 10..11 11..3 11..4 11..5 11..8 10..12 12..6 12..7
0.018416 0.167024 0.034015 0.004465 0.000004 0.000004 0.000004 0.000004 0.004653 0.000004 0.000004 2.638324 0.968518 0.000000 0.082459 23.862244
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.228598
(1: 0.018416, 2: 0.167024, ((3: 0.000004, 4: 0.000004, 5: 0.000004, 8: 0.000004): 0.004465, (6: 0.000004, 7: 0.000004): 0.004653): 0.034015);
(C1: 0.018416, C2: 0.167024, ((C3: 0.000004, C4: 0.000004, C5: 0.000004, C8: 0.000004): 0.004465, (C6: 0.000004, C7: 0.000004): 0.004653): 0.034015);
Detailed output identifying parameters
kappa (ts/tv) = 2.63832
MLEs of dN/dS (w) for site classes (K=3)
p: 0.96852 0.00000 0.03148
w: 0.08246 1.00000 23.86224
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.018 491.5 186.5 0.8311 0.0058 0.0070 2.9 1.3
9..2 0.167 491.5 186.5 0.8311 0.0527 0.0634 25.9 11.8
9..10 0.034 491.5 186.5 0.8311 0.0107 0.0129 5.3 2.4
10..11 0.004 491.5 186.5 0.8311 0.0014 0.0017 0.7 0.3
11..3 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
11..4 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
11..5 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
11..8 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
10..12 0.005 491.5 186.5 0.8311 0.0015 0.0018 0.7 0.3
12..6 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
12..7 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.999** 23.848
2 S 0.997** 23.800
4 E 0.999** 23.847
8 L 0.998** 23.825
10 Q 0.998** 23.805
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.981* 8.928 +- 1.866
2 S 0.952* 8.697 +- 2.291
4 E 0.969* 8.834 +- 2.063
8 L 0.958* 8.746 +- 2.215
10 Q 0.956* 8.734 +- 2.232
13 E 0.545 5.170 +- 4.406
172 V 0.535 5.087 +- 4.410
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.829 0.153 0.017 0.001 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.000 0.001 0.005 0.013 0.030 0.060 0.107 0.172 0.256 0.357
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.025
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.029 0.160
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.233 0.541
sum of density on p0-p1 = 1.000000
Time used: 0:17
Model 7: beta (10 categories)
TREE # 1: (1, 2, ((3, 4, 5, 8), (6, 7))); MP score: 23
lnL(ntime: 11 np: 14): -1099.202669 +0.000000
9..1 9..2 9..10 10..11 11..3 11..4 11..5 11..8 10..12 12..6 12..7
0.017937 0.103027 0.028033 0.004546 0.000004 0.000004 0.000004 0.000004 0.004526 0.000004 0.000004 1.782534 0.005000 0.020324
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.158092
(1: 0.017937, 2: 0.103027, ((3: 0.000004, 4: 0.000004, 5: 0.000004, 8: 0.000004): 0.004546, (6: 0.000004, 7: 0.000004): 0.004526): 0.028033);
(C1: 0.017937, C2: 0.103027, ((C3: 0.000004, C4: 0.000004, C5: 0.000004, C8: 0.000004): 0.004546, (C6: 0.000004, C7: 0.000004): 0.004526): 0.028033);
Detailed output identifying parameters
kappa (ts/tv) = 1.78253
Parameters in M7 (beta):
p = 0.00500 q = 0.02032
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.018 500.0 178.0 0.2000 0.0029 0.0146 1.5 2.6
9..2 0.103 500.0 178.0 0.2000 0.0168 0.0838 8.4 14.9
9..10 0.028 500.0 178.0 0.2000 0.0046 0.0228 2.3 4.1
10..11 0.005 500.0 178.0 0.2000 0.0007 0.0037 0.4 0.7
11..3 0.000 500.0 178.0 0.2000 0.0000 0.0000 0.0 0.0
11..4 0.000 500.0 178.0 0.2000 0.0000 0.0000 0.0 0.0
11..5 0.000 500.0 178.0 0.2000 0.0000 0.0000 0.0 0.0
11..8 0.000 500.0 178.0 0.2000 0.0000 0.0000 0.0 0.0
10..12 0.005 500.0 178.0 0.2000 0.0007 0.0037 0.4 0.7
12..6 0.000 500.0 178.0 0.2000 0.0000 0.0000 0.0 0.0
12..7 0.000 500.0 178.0 0.2000 0.0000 0.0000 0.0 0.0
Time used: 1:00
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, ((3, 4, 5, 8), (6, 7))); MP score: 23
lnL(ntime: 11 np: 16): -1090.897766 +0.000000
9..1 9..2 9..10 10..11 11..3 11..4 11..5 11..8 10..12 12..6 12..7
0.018410 0.167019 0.034019 0.004465 0.000004 0.000004 0.000004 0.000004 0.004654 0.000004 0.000004 2.638149 0.968520 8.942431 99.000000 23.860352
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.228591
(1: 0.018410, 2: 0.167019, ((3: 0.000004, 4: 0.000004, 5: 0.000004, 8: 0.000004): 0.004465, (6: 0.000004, 7: 0.000004): 0.004654): 0.034019);
(C1: 0.018410, C2: 0.167019, ((C3: 0.000004, C4: 0.000004, C5: 0.000004, C8: 0.000004): 0.004465, (C6: 0.000004, C7: 0.000004): 0.004654): 0.034019);
Detailed output identifying parameters
kappa (ts/tv) = 2.63815
Parameters in M8 (beta&w>1):
p0 = 0.96852 p = 8.94243 q = 99.00000
(p1 = 0.03148) w = 23.86035
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09685 0.09685 0.09685 0.09685 0.09685 0.09685 0.09685 0.09685 0.09685 0.09685 0.03148
w: 0.04421 0.05595 0.06382 0.07058 0.07703 0.08360 0.09073 0.09909 0.11016 0.13027 23.86035
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.018 491.5 186.5 0.8311 0.0058 0.0070 2.9 1.3
9..2 0.167 491.5 186.5 0.8311 0.0527 0.0634 25.9 11.8
9..10 0.034 491.5 186.5 0.8311 0.0107 0.0129 5.3 2.4
10..11 0.004 491.5 186.5 0.8311 0.0014 0.0017 0.7 0.3
11..3 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
11..4 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
11..5 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
11..8 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
10..12 0.005 491.5 186.5 0.8311 0.0015 0.0018 0.7 0.3
12..6 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
12..7 0.000 491.5 186.5 0.8311 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.999** 23.844
2 S 0.997** 23.793
4 E 0.999** 23.844
8 L 0.998** 23.820
10 Q 0.997** 23.799
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.993** 8.959 +- 1.668
2 S 0.975* 8.818 +- 1.985
4 E 0.984* 8.894 +- 1.829
8 L 0.978* 8.844 +- 1.936
10 Q 0.978* 8.840 +- 1.942
13 E 0.604 5.597 +- 4.407
156 I 0.522 4.871 +- 4.466
172 V 0.594 5.512 +- 4.420
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.998
p : 0.814 0.148 0.030 0.007 0.002 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.004 0.024 0.052 0.082 0.111 0.140 0.168 0.195 0.223
ws: 0.000 0.001 0.003 0.012 0.031 0.066 0.116 0.180 0.255 0.336
Time used: 2:21
Model 1: NearlyNeutral -1099.165277
Model 2: PositiveSelection -1090.897125
Model 7: beta -1099.202669
Model 8: beta&w>1 -1090.897766
Model 2 vs 1 16.536304
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.999** 23.848
2 S 0.997** 23.800
4 E 0.999** 23.847
8 L 0.998** 23.825
10 Q 0.998** 23.805
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.981* 8.928 +- 1.866
2 S 0.952* 8.697 +- 2.291
4 E 0.969* 8.834 +- 2.063
8 L 0.958* 8.746 +- 2.215
10 Q 0.956* 8.734 +- 2.232
13 E 0.545 5.170 +- 4.406
172 V 0.535 5.087 +- 4.410
Model 8 vs 7 16.609806
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.999** 23.844
2 S 0.997** 23.793
4 E 0.999** 23.844
8 L 0.998** 23.820
10 Q 0.997** 23.799
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 M 0.993** 8.959 +- 1.668
2 S 0.975* 8.818 +- 1.985
4 E 0.984* 8.894 +- 1.829
8 L 0.978* 8.844 +- 1.936
10 Q 0.978* 8.840 +- 1.942
13 E 0.604 5.597 +- 4.407
156 I 0.522 4.871 +- 4.466
172 V 0.594 5.512 +- 4.420
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
