--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -290.58 -294.71
2 -290.55 -293.07
--------------------------------------
TOTAL -290.57 -294.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 8.803618 97.945221 0.000004 28.539790 5.756821 243.91 381.41 1.000
r(A<->C){all} 0.155064 0.016987 0.000004 0.419258 0.122201 191.94 239.33 1.000
r(A<->G){all} 0.161628 0.018658 0.000103 0.432568 0.125444 101.82 150.70 1.000
r(A<->T){all} 0.178465 0.023202 0.000001 0.486067 0.134419 105.69 123.61 1.005
r(C<->G){all} 0.163775 0.019277 0.000006 0.440523 0.124338 131.07 185.38 1.003
r(C<->T){all} 0.174810 0.021618 0.000313 0.470862 0.138058 109.91 174.30 1.000
r(G<->T){all} 0.166259 0.018852 0.000046 0.430731 0.133882 139.48 192.46 1.002
pi(A){all} 0.283943 0.000843 0.224475 0.339072 0.283198 1091.33 1282.11 1.001
pi(C){all} 0.122505 0.000448 0.082847 0.164546 0.121574 1231.58 1298.53 1.000
pi(G){all} 0.178791 0.000650 0.127935 0.229106 0.178006 1084.02 1170.00 1.001
pi(T){all} 0.414761 0.001030 0.350167 0.474762 0.414714 1005.24 1068.80 1.000
alpha{1,2} 0.914205 0.990830 0.000316 2.812838 0.601827 1016.32 1108.77 1.000
alpha{3} 0.960329 1.011446 0.000666 3.012459 0.641850 1106.19 1137.09 1.002
pinvar{all} 0.966101 0.011349 0.711975 0.999996 0.995926 15.69 31.20 1.003
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -277.579338
Model 2: PositiveSelection -277.579338
Model 7: beta -277.579338
Model 8: beta&w>1 -277.579338
Model 2 vs 1 0
Model 8 vs 7 0
-- Starting log on Thu Oct 20 00:46:20 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=8, Len=75
C1 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C2 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C3 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C4 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C5 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C6 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C7 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C8 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
**************************************************
C1 YVPVYSAYVMYKNFMQIDPCPVIDV
C2 YVPVYSAYVMYKNFMQIDPCPVIDV
C3 YVPVYSAYVMYKNFMQIDPCPVIDV
C4 YVPVYSAYVMYKNFMQIDPCPVIDV
C5 YVPVYSAYVMYKNFMQIDPCPVIDV
C6 YVPVYSAYVMYKNFMQIDPCPVIDV
C7 YVPVYSAYVMYKNFMQIDPCPVIDV
C8 YVPVYSAYVMYKNFMQIDPCPVIDV
*************************
-- Starting log on Thu Oct 20 00:46:52 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=8, Len=75
C1 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C2 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C3 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C4 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C5 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C6 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C7 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C8 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
**************************************************
C1 YVPVYSAYVMYKNFMQIDPCPVIDV
C2 YVPVYSAYVMYKNFMQIDPCPVIDV
C3 YVPVYSAYVMYKNFMQIDPCPVIDV
C4 YVPVYSAYVMYKNFMQIDPCPVIDV
C5 YVPVYSAYVMYKNFMQIDPCPVIDV
C6 YVPVYSAYVMYKNFMQIDPCPVIDV
C7 YVPVYSAYVMYKNFMQIDPCPVIDV
C8 YVPVYSAYVMYKNFMQIDPCPVIDV
*************************
-- Starting log on Thu Oct 20 00:53:52 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/gapped_alignment/codeml,175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 225 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666227238
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 553517530
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5405429103
Seed = 1799224935
Swapseed = 1666227238
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -364.897138 -- 29.153684
Chain 2 -- -364.897136 -- 29.153684
Chain 3 -- -364.897151 -- 29.153684
Chain 4 -- -364.897132 -- 29.153684
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -364.897142 -- 29.153684
Chain 2 -- -364.897145 -- 29.153684
Chain 3 -- -364.897136 -- 29.153684
Chain 4 -- -364.897138 -- 29.153684
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-364.897] (-364.897) (-364.897) (-364.897) * [-364.897] (-364.897) (-364.897) (-364.897)
1000 -- (-297.944) (-299.680) (-305.151) [-294.693] * (-304.025) [-295.508] (-297.094) (-293.158) -- 0:00:00
2000 -- (-299.430) (-292.674) (-301.956) [-291.168] * (-291.783) (-295.249) (-291.177) [-290.829] -- 0:00:00
3000 -- (-292.915) [-291.958] (-298.127) (-296.307) * (-290.161) (-293.633) [-292.225] (-298.740) -- 0:00:00
4000 -- (-297.330) [-294.709] (-296.860) (-297.899) * [-291.959] (-298.871) (-290.462) (-295.313) -- 0:00:00
5000 -- [-296.268] (-291.501) (-293.841) (-292.375) * (-290.462) [-290.726] (-293.092) (-294.297) -- 0:03:19
Average standard deviation of split frequencies: 0.078567
6000 -- (-296.394) (-297.317) (-300.401) [-292.566] * (-298.285) (-294.177) (-300.072) [-292.733] -- 0:02:45
7000 -- (-290.959) (-292.510) (-294.719) [-289.789] * [-291.674] (-294.163) (-299.608) (-293.019) -- 0:02:21
8000 -- (-300.421) (-289.908) (-295.383) [-293.704] * (-296.004) [-290.938] (-295.683) (-290.782) -- 0:02:04
9000 -- (-291.547) (-294.954) [-291.518] (-294.133) * (-292.954) (-296.614) [-290.899] (-296.334) -- 0:01:50
10000 -- (-295.886) (-295.518) [-290.915] (-293.662) * [-290.638] (-294.065) (-292.603) (-300.450) -- 0:01:39
Average standard deviation of split frequencies: 0.083653
11000 -- (-299.987) (-298.467) [-293.127] (-293.116) * [-290.869] (-292.786) (-293.323) (-299.205) -- 0:01:29
12000 -- (-297.556) (-291.768) [-293.894] (-292.497) * (-292.955) (-293.202) (-297.240) [-293.952] -- 0:02:44
13000 -- (-289.587) [-294.250] (-296.907) (-297.396) * (-296.766) (-299.127) (-295.875) [-290.906] -- 0:02:31
14000 -- (-291.665) (-291.595) (-295.478) [-293.885] * (-293.686) (-293.007) [-289.253] (-295.066) -- 0:02:20
15000 -- (-290.105) (-291.900) [-289.833] (-302.121) * (-296.311) (-293.813) [-290.050] (-291.447) -- 0:02:11
Average standard deviation of split frequencies: 0.071552
16000 -- (-290.062) (-292.538) [-289.697] (-298.055) * (-297.570) (-298.425) [-290.506] (-290.103) -- 0:02:03
17000 -- [-292.230] (-296.337) (-292.823) (-293.595) * (-292.019) (-301.841) [-293.727] (-290.714) -- 0:01:55
18000 -- (-292.967) [-289.445] (-291.736) (-299.152) * [-290.950] (-292.767) (-297.794) (-297.495) -- 0:02:43
19000 -- (-293.498) [-295.010] (-294.065) (-293.987) * (-297.312) (-291.344) [-292.191] (-294.848) -- 0:02:34
20000 -- (-293.548) [-291.767] (-293.091) (-296.309) * (-298.032) (-290.156) (-291.264) [-290.620] -- 0:02:27
Average standard deviation of split frequencies: 0.054744
21000 -- (-295.643) (-298.834) [-290.392] (-292.197) * (-299.903) (-292.137) (-291.182) [-295.234] -- 0:02:19
22000 -- (-292.627) [-290.358] (-296.051) (-294.274) * [-292.052] (-291.596) (-292.167) (-292.434) -- 0:02:13
23000 -- (-299.697) (-290.120) [-291.894] (-291.788) * (-292.361) (-294.067) [-289.189] (-290.038) -- 0:02:07
24000 -- (-293.088) [-291.004] (-294.864) (-291.740) * (-292.865) (-291.027) [-290.187] (-294.327) -- 0:02:02
25000 -- (-295.370) [-291.526] (-295.032) (-293.124) * [-290.109] (-290.941) (-293.173) (-293.131) -- 0:02:36
Average standard deviation of split frequencies: 0.052580
26000 -- (-294.850) [-289.559] (-294.462) (-290.616) * [-289.170] (-291.101) (-290.467) (-291.198) -- 0:02:29
27000 -- (-295.325) [-289.742] (-298.153) (-290.216) * [-290.616] (-292.003) (-290.400) (-290.577) -- 0:02:24
28000 -- (-299.110) (-291.313) (-300.322) [-289.269] * [-291.070] (-290.328) (-294.015) (-293.352) -- 0:02:18
29000 -- (-292.596) (-292.134) (-295.707) [-291.601] * [-291.771] (-295.630) (-291.243) (-291.304) -- 0:02:13
30000 -- (-290.085) (-292.572) [-293.515] (-290.669) * [-291.202] (-290.501) (-292.500) (-289.934) -- 0:02:09
Average standard deviation of split frequencies: 0.047076
31000 -- (-290.264) (-293.292) [-290.660] (-295.951) * [-294.139] (-290.327) (-295.645) (-290.933) -- 0:02:05
32000 -- (-292.573) (-291.919) (-297.158) [-290.696] * [-296.217] (-292.855) (-297.880) (-289.827) -- 0:02:31
33000 -- (-297.601) (-293.332) (-294.905) [-292.711] * (-294.128) (-293.537) [-289.779] (-291.146) -- 0:02:26
34000 -- (-291.772) [-289.635] (-293.948) (-295.916) * (-299.164) (-291.682) [-290.750] (-292.010) -- 0:02:22
35000 -- (-289.950) (-292.711) [-293.627] (-292.773) * (-292.222) (-292.006) [-290.923] (-291.043) -- 0:02:17
Average standard deviation of split frequencies: 0.036374
36000 -- (-290.194) (-296.590) (-293.148) [-290.480] * (-294.216) (-295.177) [-290.450] (-294.159) -- 0:02:13
37000 -- (-293.163) [-289.916] (-291.102) (-292.240) * (-293.878) (-291.171) [-291.881] (-290.338) -- 0:02:10
38000 -- (-290.151) (-295.035) [-290.216] (-292.338) * (-292.229) (-296.138) [-290.273] (-289.483) -- 0:02:06
39000 -- (-293.260) (-292.507) (-296.185) [-292.067] * (-293.146) (-293.068) [-290.390] (-289.227) -- 0:02:03
40000 -- (-291.068) [-290.705] (-290.323) (-290.180) * (-289.439) (-290.152) [-291.105] (-290.151) -- 0:02:24
Average standard deviation of split frequencies: 0.038916
41000 -- (-295.429) (-296.871) (-290.838) [-293.369] * (-291.904) (-289.839) [-290.827] (-290.864) -- 0:02:20
42000 -- (-298.918) (-295.176) (-297.951) [-291.256] * (-290.736) (-291.254) [-290.219] (-291.320) -- 0:02:16
43000 -- (-289.633) [-294.402] (-289.926) (-294.628) * (-290.747) (-291.520) [-289.673] (-290.691) -- 0:02:13
44000 -- (-289.961) [-295.841] (-291.052) (-291.526) * (-295.070) (-289.259) [-294.784] (-293.027) -- 0:02:10
45000 -- (-292.283) [-291.078] (-290.435) (-291.131) * (-292.306) (-294.728) [-290.107] (-289.565) -- 0:02:07
Average standard deviation of split frequencies: 0.032793
46000 -- (-290.910) (-292.220) (-290.263) [-292.195] * (-292.181) (-289.955) [-291.044] (-292.407) -- 0:02:04
47000 -- (-290.293) [-293.130] (-289.262) (-298.363) * (-290.810) (-289.922) [-290.500] (-291.643) -- 0:02:01
48000 -- (-290.160) (-293.770) (-292.740) [-291.621] * (-294.753) (-289.192) [-290.728] (-289.246) -- 0:02:18
49000 -- (-290.346) [-290.170] (-289.717) (-294.521) * (-289.482) (-294.582) [-290.052] (-289.724) -- 0:02:15
50000 -- (-294.216) (-291.819) (-291.129) [-289.347] * (-290.862) (-294.491) [-290.570] (-294.717) -- 0:02:13
Average standard deviation of split frequencies: 0.028429
51000 -- (-289.682) (-291.304) (-298.006) [-289.160] * (-290.249) (-291.343) [-292.167] (-301.258) -- 0:02:10
52000 -- (-289.951) [-290.175] (-289.994) (-292.503) * (-292.654) (-289.997) [-293.092] (-290.359) -- 0:02:07
53000 -- (-293.645) [-291.143] (-293.024) (-291.085) * (-289.361) (-289.145) [-295.584] (-291.031) -- 0:02:05
54000 -- (-293.089) (-292.235) (-290.705) [-292.077] * (-290.346) (-289.769) [-291.430] (-291.929) -- 0:02:02
55000 -- (-291.467) (-292.576) (-293.593) [-291.944] * (-293.968) (-295.594) [-290.850] (-290.178) -- 0:02:17
Average standard deviation of split frequencies: 0.031196
56000 -- (-290.431) (-292.877) (-293.650) [-291.136] * (-292.125) (-290.307) [-290.610] (-293.062) -- 0:02:14
57000 -- (-290.218) (-292.831) (-291.145) [-289.983] * (-293.745) (-292.602) [-293.284] (-291.283) -- 0:02:12
58000 -- (-290.587) [-292.746] (-296.725) (-292.118) * (-292.177) (-290.825) [-290.314] (-293.025) -- 0:02:09
59000 -- (-292.723) (-292.242) (-291.966) [-290.516] * (-290.487) (-291.990) [-292.905] (-296.555) -- 0:02:07
60000 -- (-291.312) [-294.640] (-291.889) (-293.456) * (-290.798) (-294.062) [-291.043] (-290.302) -- 0:02:05
Average standard deviation of split frequencies: 0.030596
61000 -- (-291.022) [-291.568] (-290.444) (-293.588) * (-292.009) (-291.750) [-289.857] (-292.058) -- 0:02:03
62000 -- (-289.418) [-290.537] (-295.126) (-290.738) * (-295.453) (-290.828) [-292.657] (-294.350) -- 0:02:01
63000 -- (-291.893) (-291.651) (-292.107) [-291.807] * (-291.177) (-292.668) [-290.399] (-291.719) -- 0:02:13
64000 -- (-292.605) (-293.310) (-294.101) [-291.054] * (-290.729) (-289.774) [-289.575] (-293.117) -- 0:02:11
65000 -- (-294.304) [-293.630] (-292.907) (-291.157) * (-291.355) (-290.554) [-289.348] (-289.451) -- 0:02:09
Average standard deviation of split frequencies: 0.028990
66000 -- (-289.690) [-290.851] (-293.099) (-290.639) * (-291.397) (-291.195) [-290.896] (-290.684) -- 0:02:07
67000 -- (-293.559) [-294.433] (-291.572) (-294.525) * (-291.992) (-291.711) [-293.866] (-289.287) -- 0:02:05
68000 -- (-290.938) (-291.722) (-290.701) [-290.164] * (-289.585) (-293.686) [-293.609] (-292.605) -- 0:02:03
69000 -- (-290.461) (-293.797) (-290.297) [-293.159] * (-291.512) (-289.923) [-291.613] (-293.560) -- 0:02:01
70000 -- (-292.190) (-291.825) (-292.325) [-291.020] * (-291.844) (-291.207) (-293.396) [-290.350] -- 0:01:59
Average standard deviation of split frequencies: 0.026350
71000 -- (-295.468) [-294.049] (-292.481) (-293.288) * (-291.894) [-290.943] (-291.303) (-289.904) -- 0:02:10
72000 -- (-289.832) [-291.028] (-293.345) (-291.879) * (-295.095) (-292.476) [-290.033] (-293.653) -- 0:02:08
73000 -- (-290.894) (-290.144) (-293.465) [-290.676] * (-290.920) (-289.297) [-291.332] (-291.889) -- 0:02:06
74000 -- (-289.573) (-293.864) (-291.344) [-290.919] * [-291.631] (-293.343) (-290.992) (-290.329) -- 0:02:05
75000 -- (-289.550) [-291.442] (-293.981) (-292.529) * [-292.430] (-293.625) (-289.495) (-289.963) -- 0:02:03
Average standard deviation of split frequencies: 0.026443
76000 -- (-289.696) [-290.421] (-292.467) (-290.251) * (-293.039) (-292.661) (-291.133) [-290.945] -- 0:02:01
77000 -- (-289.742) (-298.487) (-289.186) [-290.502] * [-294.274] (-290.554) (-289.422) (-290.789) -- 0:01:59
78000 -- (-296.917) [-291.151] (-292.946) (-298.061) * (-290.618) (-291.228) [-292.775] (-290.640) -- 0:01:58
79000 -- (-291.425) [-292.618] (-290.161) (-295.253) * (-290.943) [-290.087] (-290.596) (-291.312) -- 0:02:08
80000 -- (-294.661) (-291.403) (-294.308) [-292.720] * [-289.161] (-291.009) (-290.528) (-290.877) -- 0:02:06
Average standard deviation of split frequencies: 0.023765
81000 -- (-289.966) [-291.464] (-291.197) (-294.133) * (-292.746) [-292.235] (-289.717) (-289.139) -- 0:02:04
82000 -- (-290.938) (-294.320) (-291.533) [-289.757] * [-293.786] (-290.996) (-293.780) (-291.500) -- 0:02:03
83000 -- (-289.938) (-293.741) (-289.219) [-289.755] * (-293.469) [-290.240] (-293.848) (-291.444) -- 0:02:01
84000 -- (-291.041) [-290.850] (-291.861) (-290.365) * (-291.147) (-293.732) (-291.495) [-290.328] -- 0:01:59
85000 -- (-290.185) (-295.284) (-290.542) [-293.531] * (-292.662) [-291.633] (-291.362) (-293.289) -- 0:01:58
Average standard deviation of split frequencies: 0.025215
86000 -- (-289.443) [-290.751] (-290.023) (-293.992) * (-290.630) [-291.673] (-291.045) (-294.003) -- 0:01:56
87000 -- (-291.645) (-294.668) (-289.338) [-289.637] * (-290.396) (-291.037) (-290.034) [-291.428] -- 0:02:05
88000 -- (-290.579) (-292.860) (-295.473) [-293.437] * (-291.579) (-296.812) (-290.576) [-290.326] -- 0:02:04
89000 -- (-290.302) [-291.835] (-292.066) (-291.846) * (-290.093) (-291.604) [-289.227] (-291.149) -- 0:02:02
90000 -- (-290.667) [-289.865] (-292.204) (-290.435) * (-293.368) [-290.230] (-293.834) (-289.893) -- 0:02:01
Average standard deviation of split frequencies: 0.029376
91000 -- (-292.813) [-290.618] (-292.199) (-290.652) * (-290.021) (-289.765) [-289.203] (-293.047) -- 0:01:59
92000 -- (-291.578) [-291.089] (-289.962) (-294.740) * (-290.347) (-293.387) [-293.579] (-292.000) -- 0:01:58
93000 -- (-290.906) (-293.121) (-290.690) [-291.937] * (-292.253) (-292.806) [-291.178] (-292.176) -- 0:01:57
94000 -- (-292.846) (-293.161) (-290.755) [-290.680] * (-290.387) [-290.553] (-290.275) (-291.849) -- 0:01:55
95000 -- (-290.169) (-298.172) (-290.174) [-290.604] * (-290.145) (-292.574) (-292.945) [-292.424] -- 0:01:54
Average standard deviation of split frequencies: 0.028885
96000 -- (-289.408) (-295.053) (-292.212) [-289.705] * (-293.086) [-289.794] (-291.531) (-292.466) -- 0:02:02
97000 -- (-290.849) [-290.180] (-291.752) (-289.633) * [-292.179] (-292.003) (-288.928) (-290.574) -- 0:02:01
98000 -- (-292.075) (-289.176) (-292.839) [-289.354] * [-289.382] (-292.195) (-291.661) (-291.681) -- 0:01:59
99000 -- (-296.422) (-289.583) (-294.712) [-291.408] * (-290.993) (-292.195) [-290.543] (-290.469) -- 0:01:58
100000 -- (-293.703) (-292.497) (-294.200) [-290.753] * [-291.843] (-290.262) (-295.061) (-297.415) -- 0:01:56
Average standard deviation of split frequencies: 0.029435
101000 -- (-293.857) (-290.706) [-291.619] (-292.462) * (-290.127) (-293.623) (-291.685) [-290.956] -- 0:01:55
102000 -- (-293.775) [-290.369] (-289.931) (-293.288) * (-296.663) (-293.569) [-291.671] (-291.278) -- 0:01:54
103000 -- (-292.938) [-291.448] (-292.604) (-289.913) * (-290.032) (-289.900) (-290.923) [-291.362] -- 0:01:53
104000 -- (-290.263) [-292.300] (-289.616) (-294.858) * [-290.385] (-289.361) (-296.165) (-291.769) -- 0:02:00
105000 -- [-289.126] (-291.444) (-296.129) (-289.490) * (-289.831) [-290.363] (-291.523) (-291.078) -- 0:01:59
Average standard deviation of split frequencies: 0.026436
106000 -- (-295.446) [-290.414] (-290.387) (-290.957) * (-291.203) [-293.599] (-290.519) (-290.268) -- 0:01:58
107000 -- (-293.200) [-289.237] (-290.536) (-291.476) * (-290.640) (-291.562) [-290.622] (-292.968) -- 0:01:56
108000 -- (-295.726) [-291.450] (-292.018) (-289.553) * (-289.979) [-292.792] (-293.231) (-295.999) -- 0:01:55
109000 -- (-296.221) (-292.947) [-289.555] (-290.074) * (-290.157) (-292.652) [-290.812] (-289.455) -- 0:01:54
110000 -- [-290.261] (-289.252) (-292.890) (-294.812) * [-292.926] (-293.046) (-290.550) (-291.194) -- 0:01:53
Average standard deviation of split frequencies: 0.028220
111000 -- (-295.942) (-290.828) (-292.506) [-291.362] * (-290.243) (-291.638) [-289.422] (-293.930) -- 0:01:52
112000 -- (-298.769) (-290.742) (-289.910) [-289.736] * (-291.131) [-288.944] (-291.653) (-289.149) -- 0:01:51
113000 -- (-291.925) [-291.265] (-289.632) (-292.046) * (-290.510) (-294.834) (-295.155) [-289.757] -- 0:01:57
114000 -- (-292.655) (-291.516) [-290.375] (-291.880) * [-293.185] (-290.240) (-292.141) (-291.005) -- 0:01:56
115000 -- (-290.590) [-290.004] (-292.447) (-289.636) * (-290.125) [-290.139] (-291.170) (-291.155) -- 0:01:55
Average standard deviation of split frequencies: 0.028176
116000 -- (-292.071) (-291.101) (-292.414) [-294.571] * (-293.676) (-292.461) (-290.157) [-294.146] -- 0:01:54
117000 -- (-291.288) (-292.914) [-291.375] (-292.596) * (-290.622) (-290.217) (-291.144) [-290.849] -- 0:01:53
118000 -- (-291.534) (-292.836) [-290.570] (-289.168) * (-289.964) (-292.285) (-295.188) [-290.303] -- 0:01:52
119000 -- (-290.072) (-292.094) (-290.591) [-293.622] * (-290.934) (-290.428) (-289.678) [-290.040] -- 0:01:51
120000 -- (-291.290) [-290.746] (-289.326) (-292.008) * (-292.363) (-291.615) [-291.190] (-290.494) -- 0:01:50
Average standard deviation of split frequencies: 0.028742
121000 -- [-291.907] (-290.300) (-293.744) (-302.367) * (-292.390) (-290.566) [-293.136] (-291.807) -- 0:01:56
122000 -- (-290.991) [-290.498] (-292.363) (-292.027) * [-292.359] (-293.679) (-289.828) (-290.346) -- 0:01:55
123000 -- [-293.918] (-290.432) (-293.571) (-288.994) * (-289.517) (-291.346) (-292.030) [-291.304] -- 0:01:54
124000 -- (-293.600) (-292.114) [-292.448] (-293.366) * [-289.785] (-290.904) (-293.218) (-291.417) -- 0:01:53
125000 -- (-289.863) [-291.025] (-290.931) (-291.662) * (-289.523) (-291.096) [-290.637] (-295.625) -- 0:01:52
Average standard deviation of split frequencies: 0.021746
126000 -- [-289.630] (-299.260) (-293.346) (-297.578) * (-291.217) (-290.262) [-290.922] (-295.047) -- 0:01:50
127000 -- (-292.228) (-291.879) (-294.642) [-289.882] * [-292.238] (-291.250) (-290.259) (-295.811) -- 0:01:49
128000 -- (-292.601) (-290.667) [-291.307] (-289.226) * (-297.515) (-292.193) (-292.000) [-289.255] -- 0:01:49
129000 -- (-294.663) (-289.941) (-289.821) [-290.575] * (-292.017) (-290.456) [-289.758] (-292.362) -- 0:01:54
130000 -- (-290.937) [-292.635] (-291.708) (-291.939) * (-291.510) (-293.018) [-290.530] (-293.219) -- 0:01:53
Average standard deviation of split frequencies: 0.022677
131000 -- (-289.351) (-293.427) (-291.015) [-291.357] * [-292.095] (-290.892) (-290.128) (-292.836) -- 0:01:52
132000 -- (-289.728) (-295.845) (-289.496) [-290.716] * (-294.970) (-292.514) (-290.045) [-290.467] -- 0:01:51
133000 -- (-293.594) (-290.264) (-291.962) [-289.637] * [-290.064] (-292.904) (-290.689) (-297.673) -- 0:01:50
134000 -- [-294.068] (-292.323) (-292.709) (-296.718) * (-291.376) [-294.761] (-290.807) (-293.137) -- 0:01:49
135000 -- (-293.393) (-295.077) (-290.946) [-292.276] * (-290.466) (-291.276) [-292.661] (-290.200) -- 0:01:48
Average standard deviation of split frequencies: 0.020566
136000 -- (-292.606) (-291.056) (-293.308) [-290.905] * [-291.272] (-292.080) (-294.510) (-292.892) -- 0:01:48
137000 -- [-289.944] (-291.684) (-290.351) (-293.660) * (-289.804) (-292.629) (-289.634) [-293.031] -- 0:01:53
138000 -- (-294.974) (-290.732) (-290.489) [-290.277] * [-292.165] (-290.951) (-289.101) (-289.911) -- 0:01:52
139000 -- [-293.366] (-294.741) (-289.966) (-290.903) * (-291.870) (-290.556) [-291.703] (-290.488) -- 0:01:51
140000 -- [-292.734] (-292.899) (-293.192) (-293.522) * [-289.779] (-291.226) (-290.421) (-290.494) -- 0:01:50
Average standard deviation of split frequencies: 0.022170
141000 -- [-290.804] (-289.439) (-295.177) (-289.869) * (-298.245) (-292.886) (-291.503) [-291.803] -- 0:01:49
142000 -- (-298.017) (-290.088) [-291.391] (-292.899) * [-293.114] (-292.476) (-291.021) (-293.424) -- 0:01:48
143000 -- (-292.670) (-290.232) [-291.994] (-293.600) * (-293.785) [-291.909] (-291.960) (-290.583) -- 0:01:47
144000 -- [-292.931] (-291.826) (-292.226) (-289.306) * (-291.163) (-289.990) (-289.463) [-294.301] -- 0:01:47
145000 -- (-294.557) (-291.236) (-296.354) [-291.435] * (-290.401) [-291.123] (-292.130) (-291.005) -- 0:01:52
Average standard deviation of split frequencies: 0.022386
146000 -- (-291.943) (-293.610) [-293.533] (-292.746) * (-291.764) (-295.317) [-291.741] (-296.832) -- 0:01:51
147000 -- (-295.831) (-291.620) (-292.334) [-290.378] * (-291.453) [-289.997] (-289.202) (-290.141) -- 0:01:50
148000 -- (-291.132) [-293.577] (-290.578) (-290.322) * (-291.266) (-291.795) [-292.490] (-291.768) -- 0:01:49
149000 -- [-289.484] (-292.871) (-289.795) (-292.839) * (-292.421) (-292.270) (-289.976) [-290.912] -- 0:01:48
150000 -- [-290.200] (-289.880) (-291.228) (-290.271) * [-289.545] (-290.546) (-290.104) (-294.892) -- 0:01:47
Average standard deviation of split frequencies: 0.022684
151000 -- (-291.161) [-291.691] (-290.741) (-294.048) * (-292.574) (-294.477) [-291.525] (-293.704) -- 0:01:46
152000 -- [-292.166] (-292.408) (-292.094) (-291.220) * (-289.766) (-291.279) [-291.097] (-292.749) -- 0:01:46
153000 -- (-291.410) (-290.103) (-291.433) [-290.326] * (-289.376) (-290.775) [-290.603] (-291.424) -- 0:01:45
154000 -- (-297.093) (-290.174) (-292.666) [-289.644] * (-293.129) (-289.430) (-292.064) [-291.196] -- 0:01:49
155000 -- (-291.588) (-292.611) [-290.200] (-290.039) * (-289.813) [-289.397] (-289.364) (-293.222) -- 0:01:49
Average standard deviation of split frequencies: 0.023570
156000 -- (-291.150) (-292.660) [-290.606] (-290.935) * [-291.298] (-290.088) (-296.813) (-293.494) -- 0:01:48
157000 -- [-289.628] (-289.955) (-289.372) (-289.912) * [-289.318] (-289.495) (-290.224) (-290.230) -- 0:01:47
158000 -- (-296.442) (-294.687) (-291.043) [-289.075] * (-290.639) (-289.536) (-294.557) [-292.177] -- 0:01:46
159000 -- (-292.095) [-295.046] (-294.182) (-294.653) * [-292.472] (-290.415) (-294.273) (-292.419) -- 0:01:45
160000 -- [-290.053] (-291.256) (-290.684) (-290.220) * (-290.009) [-290.601] (-289.223) (-291.139) -- 0:01:45
Average standard deviation of split frequencies: 0.025359
161000 -- (-290.197) (-291.926) [-290.336] (-291.609) * (-290.002) (-296.415) [-292.598] (-291.523) -- 0:01:44
162000 -- (-291.960) (-293.763) (-290.812) [-294.540] * (-295.787) (-293.615) [-291.786] (-293.775) -- 0:01:48
163000 -- (-290.607) [-289.593] (-291.609) (-296.227) * (-290.765) (-292.965) (-294.166) [-291.159] -- 0:01:47
164000 -- (-289.755) (-291.779) (-290.315) [-295.005] * (-291.772) [-290.946] (-290.198) (-298.246) -- 0:01:47
165000 -- (-290.596) [-292.080] (-290.955) (-294.741) * (-291.168) (-291.999) (-290.931) [-291.101] -- 0:01:46
Average standard deviation of split frequencies: 0.026126
166000 -- (-292.734) (-290.597) (-292.322) [-290.646] * (-292.107) (-290.960) [-289.779] (-289.551) -- 0:01:45
167000 -- (-294.079) (-291.188) (-290.854) [-291.814] * (-291.182) (-295.739) (-292.869) [-292.924] -- 0:01:44
168000 -- (-290.581) (-292.370) (-292.720) [-289.865] * (-291.288) (-290.593) [-292.798] (-291.158) -- 0:01:44
169000 -- [-293.311] (-295.137) (-294.360) (-292.655) * [-292.486] (-289.751) (-290.249) (-297.874) -- 0:01:43
170000 -- (-290.532) [-293.222] (-291.145) (-290.784) * [-293.641] (-289.936) (-292.001) (-299.904) -- 0:01:42
Average standard deviation of split frequencies: 0.026068
171000 -- (-289.804) (-289.174) [-290.298] (-290.792) * [-294.979] (-292.092) (-292.254) (-291.771) -- 0:01:46
172000 -- [-292.071] (-291.368) (-291.813) (-293.718) * (-293.112) (-290.986) (-289.267) [-292.594] -- 0:01:45
173000 -- [-294.834] (-289.668) (-296.987) (-291.597) * (-292.045) (-292.600) [-289.705] (-290.712) -- 0:01:45
174000 -- (-294.488) [-290.838] (-292.370) (-290.759) * [-291.826] (-290.426) (-292.308) (-291.014) -- 0:01:44
175000 -- (-290.683) (-290.075) (-294.119) [-292.344] * [-290.555] (-289.385) (-291.831) (-291.869) -- 0:01:43
Average standard deviation of split frequencies: 0.026070
176000 -- (-290.535) (-290.976) (-294.970) [-292.663] * (-291.829) (-292.703) (-289.628) [-289.493] -- 0:01:43
177000 -- (-296.998) [-292.017] (-297.216) (-290.409) * (-291.520) (-290.537) [-290.762] (-290.642) -- 0:01:42
178000 -- (-289.723) (-295.103) [-293.888] (-291.091) * [-289.438] (-289.719) (-291.115) (-291.092) -- 0:01:41
179000 -- (-290.139) (-290.097) [-290.195] (-291.101) * [-290.816] (-290.427) (-292.467) (-293.429) -- 0:01:45
180000 -- (-289.615) [-289.476] (-295.228) (-291.445) * (-291.874) (-289.762) (-293.586) [-289.951] -- 0:01:44
Average standard deviation of split frequencies: 0.029789
181000 -- (-292.007) [-293.813] (-289.442) (-291.720) * [-290.196] (-291.841) (-299.159) (-290.886) -- 0:01:44
182000 -- (-291.259) (-293.767) (-290.828) [-289.771] * (-290.766) [-290.991] (-290.295) (-291.957) -- 0:01:43
183000 -- (-291.089) [-290.514] (-290.937) (-289.988) * (-290.551) (-292.846) [-289.139] (-292.797) -- 0:01:42
184000 -- (-290.254) [-290.427] (-290.981) (-289.543) * (-289.185) [-291.313] (-290.506) (-292.976) -- 0:01:42
185000 -- [-299.371] (-289.394) (-290.763) (-289.760) * [-291.112] (-292.293) (-290.904) (-289.643) -- 0:01:41
Average standard deviation of split frequencies: 0.025493
186000 -- [-290.727] (-291.364) (-291.553) (-293.500) * (-291.587) (-290.059) (-292.584) [-290.368] -- 0:01:40
187000 -- [-290.079] (-290.181) (-295.286) (-290.453) * (-289.713) [-293.540] (-293.012) (-290.073) -- 0:01:44
188000 -- (-290.258) [-290.661] (-291.416) (-293.049) * (-292.287) [-290.405] (-296.038) (-291.031) -- 0:01:43
189000 -- [-290.419] (-291.691) (-296.010) (-291.226) * (-292.278) (-298.255) [-291.269] (-289.229) -- 0:01:42
190000 -- (-291.563) [-291.167] (-292.025) (-290.044) * (-292.405) [-291.532] (-290.807) (-292.861) -- 0:01:42
Average standard deviation of split frequencies: 0.023997
191000 -- (-291.492) (-291.595) (-290.237) [-294.421] * (-289.489) (-293.324) [-290.498] (-289.996) -- 0:01:41
192000 -- (-290.841) (-289.297) [-295.381] (-290.526) * (-291.911) [-290.944] (-290.276) (-288.990) -- 0:01:41
193000 -- (-292.241) (-290.659) (-291.052) [-292.531] * (-291.401) (-293.299) (-291.564) [-289.776] -- 0:01:40
194000 -- [-289.685] (-290.958) (-292.414) (-291.834) * [-290.000] (-294.862) (-290.628) (-291.423) -- 0:01:39
195000 -- (-293.756) (-290.793) [-293.460] (-293.548) * [-290.441] (-289.113) (-290.054) (-289.450) -- 0:01:39
Average standard deviation of split frequencies: 0.024693
196000 -- [-290.076] (-291.424) (-292.108) (-290.683) * [-292.197] (-289.687) (-291.889) (-292.848) -- 0:01:42
197000 -- (-290.356) [-291.020] (-297.412) (-290.592) * (-291.434) (-290.149) (-290.847) [-291.089] -- 0:01:41
198000 -- (-297.867) (-289.100) (-292.023) [-289.651] * (-292.473) (-289.295) [-293.437] (-294.458) -- 0:01:41
199000 -- (-291.095) (-290.588) (-292.103) [-289.161] * (-291.717) (-292.383) (-296.434) [-292.288] -- 0:01:40
200000 -- (-291.603) (-291.395) (-290.423) [-291.356] * (-292.382) [-291.859] (-294.202) (-295.091) -- 0:01:40
Average standard deviation of split frequencies: 0.026925
201000 -- (-290.301) (-291.134) [-290.653] (-292.977) * (-291.563) (-295.570) [-291.224] (-294.588) -- 0:01:39
202000 -- [-292.628] (-297.059) (-293.022) (-290.192) * [-290.293] (-292.886) (-293.477) (-293.586) -- 0:01:38
203000 -- [-292.076] (-294.514) (-290.008) (-292.786) * [-290.023] (-292.192) (-289.552) (-290.325) -- 0:01:38
204000 -- (-290.920) [-289.722] (-290.482) (-292.835) * (-291.834) (-289.842) [-291.368] (-291.539) -- 0:01:41
205000 -- (-289.588) [-292.476] (-292.155) (-295.223) * (-292.839) (-290.765) (-292.956) [-291.329] -- 0:01:40
Average standard deviation of split frequencies: 0.023027
206000 -- (-290.827) [-291.918] (-290.225) (-291.999) * (-293.921) (-292.478) (-290.496) [-290.342] -- 0:01:40
207000 -- (-290.335) [-290.803] (-293.675) (-292.940) * [-291.513] (-291.761) (-298.052) (-291.169) -- 0:01:39
208000 -- (-290.790) [-289.493] (-293.598) (-291.698) * (-292.487) [-291.002] (-290.140) (-292.428) -- 0:01:39
209000 -- (-291.796) (-293.713) (-289.849) [-290.865] * (-291.364) (-291.297) [-289.629] (-291.704) -- 0:01:38
210000 -- (-295.391) (-291.681) [-289.288] (-291.594) * (-290.980) (-291.814) [-289.484] (-291.382) -- 0:01:37
Average standard deviation of split frequencies: 0.025475
211000 -- [-292.623] (-291.656) (-291.560) (-292.762) * (-293.475) (-290.503) (-289.041) [-291.919] -- 0:01:37
212000 -- (-289.746) [-291.099] (-291.897) (-289.314) * (-292.779) (-291.437) (-290.586) [-292.487] -- 0:01:40
213000 -- (-290.198) (-292.430) [-290.004] (-293.707) * (-294.692) (-290.005) [-292.776] (-293.771) -- 0:01:39
214000 -- [-293.578] (-291.221) (-290.632) (-290.627) * (-291.579) (-291.016) (-292.933) [-290.068] -- 0:01:39
215000 -- (-290.504) (-292.035) (-290.507) [-293.604] * (-295.265) (-290.284) (-294.422) [-292.114] -- 0:01:38
Average standard deviation of split frequencies: 0.023671
216000 -- [-294.877] (-290.171) (-290.687) (-292.004) * (-290.124) (-291.016) (-292.480) [-292.957] -- 0:01:38
217000 -- (-290.536) (-289.956) [-289.272] (-290.129) * (-293.579) (-298.831) (-293.883) [-293.985] -- 0:01:37
218000 -- (-289.554) (-291.748) [-294.988] (-292.301) * (-292.146) [-289.799] (-292.064) (-292.990) -- 0:01:36
219000 -- [-290.196] (-289.405) (-294.141) (-291.168) * (-294.079) (-290.700) [-292.149] (-290.181) -- 0:01:36
220000 -- (-289.983) (-291.161) [-291.268] (-292.768) * (-289.663) (-289.949) (-292.168) [-290.528] -- 0:01:39
Average standard deviation of split frequencies: 0.022431
221000 -- (-291.938) (-297.321) (-290.890) [-289.884] * (-291.820) (-293.052) [-290.840] (-291.297) -- 0:01:38
222000 -- (-293.536) (-297.225) (-291.465) [-291.764] * (-289.465) (-292.898) [-292.750] (-289.291) -- 0:01:38
223000 -- [-290.767] (-290.246) (-292.590) (-289.296) * (-291.248) (-291.099) [-289.912] (-291.646) -- 0:01:37
224000 -- (-292.922) [-290.145] (-289.687) (-290.427) * (-289.910) (-289.754) (-289.907) [-291.543] -- 0:01:37
225000 -- (-291.107) [-290.828] (-290.511) (-292.863) * [-289.652] (-290.285) (-291.236) (-290.237) -- 0:01:36
Average standard deviation of split frequencies: 0.021693
226000 -- [-292.598] (-291.758) (-291.645) (-291.300) * (-295.065) (-294.315) [-292.514] (-291.063) -- 0:01:35
227000 -- (-292.503) [-289.478] (-289.538) (-292.421) * [-290.010] (-292.508) (-291.955) (-292.333) -- 0:01:35
228000 -- [-293.093] (-290.699) (-289.881) (-296.137) * (-290.748) (-292.614) [-295.496] (-291.315) -- 0:01:34
229000 -- (-290.212) (-290.543) (-291.513) [-294.441] * (-292.315) (-291.311) (-293.339) [-291.651] -- 0:01:37
230000 -- (-289.293) [-290.100] (-293.343) (-289.759) * [-289.230] (-289.772) (-289.893) (-292.023) -- 0:01:37
Average standard deviation of split frequencies: 0.022480
231000 -- (-292.640) (-291.012) [-292.253] (-290.008) * (-293.264) (-291.566) [-289.988] (-291.891) -- 0:01:36
232000 -- (-291.351) (-293.181) [-293.433] (-294.079) * [-289.903] (-293.639) (-290.572) (-291.375) -- 0:01:36
233000 -- (-291.192) (-294.949) [-293.419] (-290.453) * (-291.719) (-290.337) [-290.669] (-290.095) -- 0:01:35
234000 -- (-295.105) (-292.541) [-290.049] (-289.157) * (-291.778) (-290.266) (-293.492) [-291.240] -- 0:01:34
235000 -- (-292.510) [-290.962] (-297.665) (-290.658) * (-291.304) (-289.975) [-289.233] (-291.488) -- 0:01:34
Average standard deviation of split frequencies: 0.025786
236000 -- (-295.831) (-295.082) [-292.727] (-291.301) * (-291.332) (-290.571) [-291.851] (-291.652) -- 0:01:33
237000 -- (-291.704) (-293.477) [-289.668] (-289.848) * (-290.192) (-294.848) [-289.867] (-291.255) -- 0:01:36
238000 -- [-289.783] (-293.264) (-292.159) (-290.081) * [-291.259] (-300.033) (-292.502) (-292.211) -- 0:01:36
239000 -- (-290.468) (-294.933) [-289.576] (-289.744) * [-289.798] (-296.261) (-296.503) (-292.256) -- 0:01:35
240000 -- [-291.130] (-289.405) (-294.798) (-290.175) * (-289.690) (-292.653) (-292.006) [-289.502] -- 0:01:35
Average standard deviation of split frequencies: 0.023995
241000 -- (-292.478) [-289.702] (-292.911) (-289.508) * (-292.393) [-292.171] (-290.035) (-292.591) -- 0:01:34
242000 -- (-289.786) (-293.310) [-293.521] (-292.068) * [-294.073] (-291.109) (-292.225) (-290.121) -- 0:01:33
243000 -- (-291.116) (-292.243) (-291.803) [-291.722] * (-290.916) (-295.074) [-291.930] (-290.178) -- 0:01:33
244000 -- (-292.334) (-291.300) (-292.679) [-289.455] * (-291.585) [-294.807] (-289.368) (-290.928) -- 0:01:32
245000 -- (-295.144) [-290.018] (-290.099) (-289.987) * [-289.503] (-291.021) (-290.777) (-291.131) -- 0:01:35
Average standard deviation of split frequencies: 0.021964
246000 -- (-296.346) [-292.780] (-290.331) (-290.066) * [-290.383] (-291.826) (-289.491) (-291.878) -- 0:01:35
247000 -- (-291.656) (-292.952) (-291.294) [-291.267] * [-296.503] (-295.163) (-293.117) (-293.868) -- 0:01:34
248000 -- [-290.745] (-295.404) (-291.475) (-293.912) * [-290.900] (-296.369) (-290.664) (-290.214) -- 0:01:34
249000 -- (-289.639) [-290.137] (-290.161) (-291.052) * [-290.066] (-292.802) (-294.150) (-290.269) -- 0:01:33
250000 -- [-290.150] (-291.175) (-290.158) (-290.106) * (-291.362) (-291.211) [-292.162] (-294.522) -- 0:01:33
Average standard deviation of split frequencies: 0.021989
251000 -- (-292.028) [-291.561] (-290.880) (-290.122) * (-291.949) (-290.315) (-290.183) [-289.671] -- 0:01:32
252000 -- (-292.689) (-292.552) (-290.352) [-290.851] * (-290.501) [-291.466] (-289.905) (-291.339) -- 0:01:32
253000 -- [-292.734] (-292.002) (-289.519) (-290.173) * (-292.415) [-291.139] (-291.027) (-292.628) -- 0:01:31
254000 -- (-293.025) [-290.528] (-292.095) (-288.994) * (-292.320) (-293.510) (-294.507) [-292.150] -- 0:01:33
255000 -- (-290.115) (-292.707) (-293.319) [-290.165] * (-291.059) (-294.062) [-293.219] (-292.793) -- 0:01:33
Average standard deviation of split frequencies: 0.023436
256000 -- [-290.384] (-293.291) (-292.797) (-292.153) * [-291.812] (-292.147) (-293.513) (-289.485) -- 0:01:33
257000 -- (-291.159) (-292.116) [-289.943] (-290.617) * (-293.827) [-290.751] (-292.940) (-295.729) -- 0:01:32
258000 -- (-290.345) (-290.652) [-290.878] (-291.925) * [-290.892] (-290.949) (-291.813) (-289.572) -- 0:01:32
259000 -- (-290.722) [-290.633] (-295.626) (-290.647) * (-294.422) (-289.760) (-291.619) [-290.095] -- 0:01:31
260000 -- (-290.787) (-292.919) (-290.383) [-291.491] * [-293.727] (-293.310) (-290.020) (-290.042) -- 0:01:31
Average standard deviation of split frequencies: 0.027127
261000 -- [-293.935] (-294.473) (-290.988) (-295.406) * (-290.865) (-289.710) [-289.213] (-291.114) -- 0:01:30
262000 -- (-291.151) (-291.321) [-290.574] (-292.773) * [-290.454] (-294.011) (-290.870) (-290.518) -- 0:01:32
263000 -- (-295.670) (-291.160) [-289.511] (-289.511) * (-293.274) (-290.195) (-292.793) [-292.691] -- 0:01:32
264000 -- [-289.170] (-291.579) (-290.779) (-293.633) * (-293.379) (-292.997) (-290.983) [-294.660] -- 0:01:32
265000 -- (-291.631) (-290.409) (-292.686) [-293.616] * (-289.939) (-293.668) (-293.255) [-292.125] -- 0:01:31
Average standard deviation of split frequencies: 0.023393
266000 -- (-291.413) [-291.213] (-292.382) (-290.112) * (-296.475) (-289.809) [-292.107] (-293.207) -- 0:01:31
267000 -- (-290.901) (-294.358) (-291.723) [-289.344] * (-290.422) (-292.275) [-291.153] (-289.141) -- 0:01:30
268000 -- [-290.304] (-298.283) (-293.481) (-294.346) * [-289.496] (-289.920) (-289.943) (-290.984) -- 0:01:30
269000 -- [-291.553] (-292.191) (-290.038) (-290.932) * [-290.351] (-290.011) (-289.555) (-293.471) -- 0:01:29
270000 -- (-293.097) (-289.619) (-291.661) [-291.278] * (-290.168) (-289.621) (-297.728) [-291.305] -- 0:01:31
Average standard deviation of split frequencies: 0.022816
271000 -- (-290.968) (-292.326) (-292.348) [-289.313] * (-291.628) (-289.552) [-292.270] (-290.954) -- 0:01:31
272000 -- (-291.500) (-293.306) [-291.187] (-291.558) * [-289.540] (-295.086) (-291.015) (-289.762) -- 0:01:31
273000 -- (-292.835) (-297.112) (-290.749) [-289.986] * [-290.392] (-289.991) (-290.222) (-291.981) -- 0:01:30
274000 -- (-292.660) [-291.102] (-289.757) (-292.224) * [-290.022] (-290.248) (-290.637) (-291.111) -- 0:01:30
275000 -- [-289.605] (-290.738) (-289.818) (-289.821) * [-291.712] (-291.418) (-291.137) (-292.895) -- 0:01:29
Average standard deviation of split frequencies: 0.024102
276000 -- (-291.552) (-291.650) [-290.617] (-291.831) * (-289.888) (-297.501) [-291.996] (-291.812) -- 0:01:29
277000 -- (-290.395) (-293.636) [-294.259] (-290.881) * (-290.939) (-292.705) [-290.481] (-291.397) -- 0:01:28
278000 -- (-293.094) (-291.421) (-289.533) [-290.899] * (-289.032) (-300.979) [-292.759] (-294.010) -- 0:01:28
279000 -- (-290.800) (-293.276) [-291.381] (-292.812) * (-290.991) [-291.999] (-290.773) (-292.276) -- 0:01:30
280000 -- [-290.774] (-290.753) (-290.610) (-293.451) * (-293.589) (-291.112) [-289.297] (-291.886) -- 0:01:30
Average standard deviation of split frequencies: 0.024821
281000 -- (-289.712) (-289.287) [-291.436] (-293.436) * (-291.759) (-297.007) (-289.961) [-290.073] -- 0:01:29
282000 -- (-290.577) (-294.661) [-293.301] (-290.899) * [-290.555] (-294.254) (-290.512) (-292.074) -- 0:01:29
283000 -- (-291.391) (-293.357) [-291.552] (-291.793) * (-290.346) (-292.232) (-293.588) [-294.015] -- 0:01:28
284000 -- [-291.335] (-289.768) (-291.528) (-290.485) * (-290.012) (-290.178) [-289.948] (-289.908) -- 0:01:28
285000 -- (-291.303) (-290.640) (-291.025) [-290.447] * (-289.755) (-293.463) (-291.657) [-292.124] -- 0:01:27
Average standard deviation of split frequencies: 0.022776
286000 -- (-289.857) (-293.844) (-292.380) [-290.832] * [-290.428] (-291.496) (-290.863) (-292.503) -- 0:01:27
287000 -- (-291.809) (-289.857) [-290.622] (-290.004) * (-290.425) (-290.793) [-290.952] (-292.738) -- 0:01:29
288000 -- [-289.792] (-290.977) (-291.793) (-290.530) * [-295.986] (-291.059) (-294.585) (-291.492) -- 0:01:29
289000 -- (-292.016) [-294.277] (-293.077) (-290.433) * (-290.991) [-291.349] (-294.810) (-290.501) -- 0:01:28
290000 -- [-293.266] (-292.243) (-292.815) (-293.699) * (-291.154) [-290.279] (-293.328) (-292.697) -- 0:01:28
Average standard deviation of split frequencies: 0.024003
291000 -- [-293.960] (-290.874) (-295.641) (-291.031) * [-291.400] (-291.902) (-290.431) (-291.075) -- 0:01:27
292000 -- [-290.589] (-293.945) (-293.704) (-294.198) * [-290.307] (-290.101) (-292.749) (-291.465) -- 0:01:27
293000 -- (-290.212) (-291.688) [-291.762] (-292.048) * [-290.467] (-290.695) (-294.962) (-292.764) -- 0:01:26
294000 -- (-290.980) (-289.664) (-291.519) [-290.032] * (-289.152) (-290.304) [-289.126] (-291.042) -- 0:01:26
295000 -- (-289.960) [-291.210] (-295.034) (-290.810) * (-296.909) [-289.880] (-292.461) (-297.538) -- 0:01:28
Average standard deviation of split frequencies: 0.023181
296000 -- (-290.363) (-290.892) (-291.310) [-289.690] * [-290.452] (-294.768) (-293.480) (-290.474) -- 0:01:28
297000 -- (-292.036) (-290.701) (-293.513) [-289.887] * (-289.312) (-290.513) (-289.643) [-292.282] -- 0:01:27
298000 -- (-292.267) (-290.313) (-290.571) [-289.850] * [-289.556] (-295.960) (-292.816) (-291.632) -- 0:01:27
299000 -- (-294.022) (-289.930) [-292.099] (-289.657) * [-292.404] (-293.998) (-290.548) (-290.514) -- 0:01:26
300000 -- (-290.234) (-290.602) (-290.183) [-290.135] * (-289.972) (-292.323) (-293.424) [-290.434] -- 0:01:26
Average standard deviation of split frequencies: 0.022299
301000 -- (-291.050) (-290.154) [-290.462] (-289.827) * (-296.363) (-293.136) [-290.705] (-290.171) -- 0:01:25
302000 -- (-291.095) (-291.506) [-289.503] (-291.357) * (-291.346) (-291.788) (-290.137) [-293.790] -- 0:01:25
303000 -- [-291.741] (-290.012) (-292.498) (-293.734) * [-292.291] (-289.687) (-290.378) (-290.124) -- 0:01:25
304000 -- (-290.073) [-291.073] (-289.912) (-289.863) * [-292.269] (-294.544) (-291.136) (-290.053) -- 0:01:27
305000 -- (-291.890) (-289.827) [-290.237] (-291.662) * (-291.949) [-291.635] (-292.150) (-300.838) -- 0:01:26
Average standard deviation of split frequencies: 0.021910
306000 -- (-290.248) (-293.012) (-290.403) [-290.779] * [-293.806] (-290.311) (-292.269) (-293.424) -- 0:01:26
307000 -- (-289.752) [-289.734] (-293.201) (-289.869) * (-292.051) [-291.152] (-290.599) (-293.695) -- 0:01:25
308000 -- (-291.265) (-289.074) [-292.007] (-296.219) * (-290.146) [-291.240] (-293.192) (-291.231) -- 0:01:25
309000 -- (-298.492) [-291.859] (-294.598) (-289.387) * [-293.560] (-290.162) (-292.908) (-290.337) -- 0:01:24
310000 -- [-295.322] (-297.847) (-295.493) (-294.860) * [-288.957] (-289.806) (-289.578) (-289.920) -- 0:01:24
Average standard deviation of split frequencies: 0.019726
311000 -- (-290.894) (-292.125) [-292.011] (-289.770) * (-291.541) (-292.841) (-289.324) [-291.937] -- 0:01:24
312000 -- (-293.835) [-291.509] (-291.337) (-288.974) * (-290.824) (-289.683) [-292.423] (-290.332) -- 0:01:26
313000 -- (-290.441) (-289.424) (-289.213) [-291.992] * (-291.693) [-291.192] (-289.244) (-295.038) -- 0:01:25
314000 -- (-290.475) [-290.161] (-290.944) (-293.258) * (-292.460) [-290.440] (-289.602) (-291.486) -- 0:01:25
315000 -- (-289.345) (-290.574) (-295.119) [-291.695] * (-292.605) [-291.307] (-289.646) (-289.852) -- 0:01:24
Average standard deviation of split frequencies: 0.017752
316000 -- [-291.331] (-291.155) (-291.465) (-296.545) * (-291.444) (-290.373) (-291.160) [-291.962] -- 0:01:24
317000 -- (-292.861) (-289.960) (-295.173) [-289.654] * (-290.175) (-292.270) (-289.341) [-290.242] -- 0:01:24
318000 -- [-289.928] (-291.410) (-296.978) (-293.585) * (-293.332) (-291.267) (-293.009) [-294.244] -- 0:01:23
319000 -- (-293.957) (-290.418) [-294.619] (-289.419) * (-291.584) (-293.305) (-290.358) [-291.678] -- 0:01:23
320000 -- (-291.664) (-291.466) (-292.825) [-292.410] * [-291.181] (-289.080) (-289.898) (-290.641) -- 0:01:22
Average standard deviation of split frequencies: 0.019479
321000 -- (-293.262) (-289.606) (-290.229) [-290.439] * (-290.109) (-293.041) (-293.899) [-292.003] -- 0:01:24
322000 -- (-291.926) [-294.435] (-294.380) (-290.144) * (-291.077) (-290.788) [-293.354] (-294.506) -- 0:01:24
323000 -- (-293.814) (-292.792) (-290.081) [-290.031] * (-293.113) (-290.464) [-290.443] (-292.136) -- 0:01:23
324000 -- (-289.950) (-294.125) (-293.399) [-289.580] * (-290.955) (-290.733) (-290.039) [-294.580] -- 0:01:23
325000 -- (-290.635) [-290.349] (-292.395) (-289.390) * (-291.040) [-290.546] (-292.077) (-293.238) -- 0:01:23
Average standard deviation of split frequencies: 0.016169
326000 -- [-291.913] (-291.064) (-289.908) (-291.854) * (-292.280) (-289.899) [-289.255] (-293.331) -- 0:01:22
327000 -- (-293.236) (-289.903) [-290.774] (-292.476) * (-290.829) [-292.794] (-291.599) (-295.890) -- 0:01:22
328000 -- (-291.718) (-292.874) [-290.117] (-291.002) * (-291.057) [-289.833] (-289.589) (-290.606) -- 0:01:21
329000 -- (-290.217) [-290.856] (-292.743) (-293.445) * (-290.043) [-290.704] (-292.082) (-295.932) -- 0:01:23
330000 -- [-289.210] (-291.399) (-289.801) (-291.670) * (-290.775) (-292.169) [-291.316] (-290.614) -- 0:01:23
Average standard deviation of split frequencies: 0.016537
331000 -- [-291.166] (-297.458) (-291.371) (-292.039) * (-291.933) (-291.016) [-290.142] (-290.381) -- 0:01:22
332000 -- [-293.201] (-290.669) (-291.638) (-294.561) * (-291.453) (-290.743) (-290.361) [-290.357] -- 0:01:22
333000 -- (-290.805) (-289.938) [-294.640] (-289.104) * [-290.764] (-289.333) (-291.952) (-294.249) -- 0:01:22
334000 -- [-293.468] (-291.141) (-290.550) (-291.168) * [-289.306] (-292.443) (-294.299) (-289.721) -- 0:01:21
335000 -- (-289.803) [-290.226] (-289.827) (-294.834) * (-290.513) (-289.046) [-291.727] (-292.838) -- 0:01:21
Average standard deviation of split frequencies: 0.016524
336000 -- (-292.169) (-290.174) [-291.470] (-291.125) * (-290.359) (-290.672) [-291.120] (-291.885) -- 0:01:21
337000 -- (-295.612) [-293.083] (-293.368) (-294.016) * (-292.313) (-289.439) [-291.723] (-291.301) -- 0:01:22
338000 -- (-291.517) (-290.629) (-289.360) [-289.573] * (-291.486) (-289.191) (-291.943) [-292.006] -- 0:01:22
339000 -- [-289.279] (-289.685) (-293.998) (-291.763) * (-291.954) (-293.923) [-292.987] (-291.074) -- 0:01:21
340000 -- (-292.831) [-291.538] (-293.529) (-291.638) * (-296.107) [-292.039] (-290.231) (-293.925) -- 0:01:21
Average standard deviation of split frequencies: 0.015775
341000 -- (-292.093) [-289.964] (-290.134) (-295.457) * (-292.136) (-291.417) [-289.423] (-291.686) -- 0:01:21
342000 -- [-301.435] (-294.773) (-289.289) (-292.525) * (-290.350) (-293.524) (-290.865) [-289.563] -- 0:01:20
343000 -- (-292.576) (-292.675) (-291.385) [-290.659] * [-291.148] (-289.947) (-292.498) (-290.315) -- 0:01:20
344000 -- [-289.975] (-290.348) (-291.415) (-295.075) * (-289.676) [-291.000] (-293.318) (-293.283) -- 0:01:20
345000 -- (-294.086) (-291.259) (-290.308) [-290.533] * (-292.553) (-289.968) (-290.776) [-290.023] -- 0:01:19
Average standard deviation of split frequencies: 0.013996
346000 -- (-291.725) [-291.185] (-292.624) (-291.281) * [-289.474] (-291.936) (-292.119) (-289.797) -- 0:01:21
347000 -- (-290.380) [-290.495] (-290.155) (-291.827) * (-291.354) (-290.402) (-291.982) [-289.639] -- 0:01:20
348000 -- (-293.774) (-291.090) (-291.428) [-289.769] * (-290.775) (-291.848) [-291.618] (-293.629) -- 0:01:20
349000 -- (-290.502) [-290.437] (-290.436) (-290.542) * (-293.321) (-292.753) [-292.250] (-293.123) -- 0:01:20
350000 -- (-291.285) [-291.596] (-290.291) (-291.684) * (-292.584) (-295.558) [-291.357] (-292.227) -- 0:01:19
Average standard deviation of split frequencies: 0.013932
351000 -- (-289.899) [-294.120] (-291.196) (-292.526) * (-290.724) (-289.908) [-291.018] (-291.983) -- 0:01:19
352000 -- [-291.568] (-289.993) (-291.345) (-296.303) * (-294.044) (-296.150) [-294.310] (-291.589) -- 0:01:19
353000 -- (-295.491) (-289.911) (-293.198) [-291.561] * [-291.993] (-290.259) (-293.816) (-290.431) -- 0:01:18
354000 -- (-290.721) (-292.288) (-291.623) [-290.413] * [-296.399] (-290.886) (-294.101) (-290.591) -- 0:01:20
355000 -- [-289.367] (-290.016) (-290.981) (-290.249) * (-290.109) [-291.946] (-289.656) (-290.565) -- 0:01:19
Average standard deviation of split frequencies: 0.014445
356000 -- (-291.050) [-291.016] (-294.151) (-290.294) * (-290.995) (-289.514) [-289.782] (-293.011) -- 0:01:19
357000 -- (-296.347) (-289.832) [-291.581] (-291.094) * (-292.602) (-291.986) (-290.506) [-292.955] -- 0:01:19
358000 -- (-290.545) (-289.163) (-300.318) [-290.612] * (-289.284) (-290.974) (-292.101) [-290.627] -- 0:01:18
359000 -- (-291.343) (-290.734) (-291.460) [-291.070] * (-291.407) (-290.136) [-290.767] (-293.934) -- 0:01:18
360000 -- (-290.996) (-291.569) [-291.419] (-289.859) * (-291.672) [-290.946] (-293.316) (-289.305) -- 0:01:18
Average standard deviation of split frequencies: 0.014051
361000 -- (-293.727) (-289.562) (-297.035) [-291.397] * (-289.198) (-290.857) [-290.831] (-290.233) -- 0:01:17
362000 -- (-291.095) [-290.829] (-291.608) (-291.484) * (-289.723) [-289.076] (-292.890) (-293.215) -- 0:01:17
363000 -- [-290.700] (-290.499) (-292.602) (-291.605) * [-289.607] (-290.294) (-289.727) (-289.618) -- 0:01:18
364000 -- (-291.785) [-293.427] (-290.185) (-291.777) * [-289.942] (-292.054) (-290.805) (-292.241) -- 0:01:18
365000 -- (-298.011) (-291.057) (-290.539) [-289.260] * [-291.869] (-292.672) (-291.746) (-290.887) -- 0:01:18
Average standard deviation of split frequencies: 0.014465
366000 -- (-296.529) (-291.508) [-291.626] (-292.403) * (-294.557) (-291.415) [-289.703] (-291.597) -- 0:01:17
367000 -- (-290.279) (-291.421) (-292.667) [-290.627] * (-290.816) [-292.530] (-292.602) (-291.460) -- 0:01:17
368000 -- [-291.941] (-294.127) (-292.260) (-291.844) * (-292.241) (-293.607) (-291.298) [-292.372] -- 0:01:17
369000 -- (-295.527) [-289.822] (-292.932) (-290.473) * (-293.438) [-291.047] (-292.048) (-293.585) -- 0:01:16
370000 -- (-292.617) (-290.591) [-290.007] (-290.740) * (-291.262) [-290.885] (-292.722) (-296.303) -- 0:01:16
Average standard deviation of split frequencies: 0.014731
371000 -- (-291.924) [-291.129] (-293.752) (-289.862) * (-289.852) (-289.633) [-291.005] (-292.446) -- 0:01:17
372000 -- (-289.657) [-290.465] (-294.444) (-289.888) * (-291.083) (-291.482) (-293.552) [-298.207] -- 0:01:17
373000 -- (-291.686) [-291.860] (-291.340) (-296.482) * (-290.213) [-290.516] (-293.029) (-291.479) -- 0:01:17
374000 -- [-289.302] (-296.626) (-290.534) (-296.619) * (-290.345) [-291.944] (-292.793) (-289.648) -- 0:01:16
375000 -- (-293.781) [-291.021] (-290.762) (-289.937) * (-292.743) [-293.833] (-290.890) (-291.884) -- 0:01:16
Average standard deviation of split frequencies: 0.016982
376000 -- (-290.864) (-290.841) (-292.125) [-294.888] * (-289.760) [-290.325] (-289.655) (-290.559) -- 0:01:16
377000 -- (-291.848) (-293.225) [-290.916] (-292.938) * (-295.210) (-290.073) (-289.888) [-291.613] -- 0:01:16
378000 -- [-290.890] (-289.500) (-289.753) (-291.949) * (-291.445) (-290.037) (-290.349) [-289.742] -- 0:01:15
379000 -- (-291.998) (-294.307) (-289.835) [-290.345] * [-289.906] (-293.092) (-290.445) (-290.126) -- 0:01:17
380000 -- (-290.174) (-290.829) (-290.318) [-290.104] * [-291.974] (-292.006) (-292.758) (-291.158) -- 0:01:16
Average standard deviation of split frequencies: 0.017461
381000 -- (-292.138) (-291.495) (-291.812) [-291.674] * (-291.723) (-290.932) (-291.168) [-290.511] -- 0:01:16
382000 -- (-289.571) (-290.436) (-290.020) [-290.489] * (-293.215) [-292.583] (-289.551) (-291.841) -- 0:01:16
383000 -- (-297.430) (-291.454) (-291.166) [-294.016] * (-292.615) (-297.236) [-290.803] (-290.471) -- 0:01:15
384000 -- (-293.277) (-291.434) (-289.757) [-289.814] * (-292.744) (-293.624) (-290.006) [-292.712] -- 0:01:15
385000 -- (-290.527) (-290.783) (-289.704) [-292.013] * (-294.478) [-290.548] (-290.820) (-291.003) -- 0:01:15
Average standard deviation of split frequencies: 0.016283
386000 -- (-295.233) (-289.661) (-295.439) [-290.530] * [-290.977] (-289.693) (-290.448) (-290.827) -- 0:01:14
387000 -- (-290.241) (-293.737) (-293.933) [-289.776] * (-290.933) (-293.037) [-291.718] (-291.740) -- 0:01:14
388000 -- (-291.099) (-289.388) (-294.878) [-290.154] * (-291.277) (-291.546) [-291.072] (-290.091) -- 0:01:15
389000 -- (-290.757) (-292.900) (-294.349) [-296.573] * (-290.908) (-292.232) [-290.807] (-296.124) -- 0:01:15
390000 -- (-289.039) (-290.853) (-293.446) [-295.319] * (-293.077) (-291.504) (-290.760) [-291.256] -- 0:01:15
Average standard deviation of split frequencies: 0.017552
391000 -- (-296.918) (-294.727) (-291.249) [-294.645] * (-290.326) (-289.963) (-292.584) [-292.918] -- 0:01:14
392000 -- (-290.815) (-289.226) (-290.852) [-290.698] * (-293.118) [-290.994] (-289.486) (-294.497) -- 0:01:14
393000 -- (-290.329) (-289.211) (-289.401) [-290.858] * [-292.333] (-293.365) (-291.596) (-293.177) -- 0:01:14
394000 -- (-290.599) (-297.753) (-290.231) [-291.240] * (-291.219) (-291.511) [-291.415] (-294.445) -- 0:01:13
395000 -- (-293.723) (-296.816) (-291.150) [-292.276] * (-292.453) (-290.576) [-293.739] (-290.719) -- 0:01:13
Average standard deviation of split frequencies: 0.016666
396000 -- (-290.766) (-293.206) (-291.458) [-291.582] * (-291.580) [-291.242] (-293.581) (-294.220) -- 0:01:14
397000 -- (-290.809) (-293.660) (-290.601) [-289.819] * [-290.928] (-292.538) (-291.435) (-294.003) -- 0:01:14
398000 -- (-290.445) (-289.953) [-289.755] (-289.545) * (-291.989) (-290.487) [-291.937] (-294.174) -- 0:01:14
399000 -- (-290.210) [-291.205] (-293.076) (-290.982) * [-291.036] (-290.485) (-290.938) (-291.800) -- 0:01:13
400000 -- [-292.132] (-290.620) (-292.418) (-290.769) * (-290.315) (-294.511) [-291.163] (-294.072) -- 0:01:13
Average standard deviation of split frequencies: 0.017113
401000 -- (-292.683) [-290.710] (-294.326) (-291.835) * [-289.436] (-289.956) (-291.320) (-292.193) -- 0:01:13
402000 -- (-290.753) [-290.044] (-293.734) (-290.614) * [-289.616] (-289.503) (-292.301) (-292.113) -- 0:01:12
403000 -- [-290.869] (-294.002) (-291.242) (-293.473) * [-289.927] (-294.549) (-290.849) (-290.708) -- 0:01:12
404000 -- (-290.567) [-290.116] (-289.781) (-294.486) * [-292.212] (-291.901) (-293.976) (-295.188) -- 0:01:13
405000 -- (-292.035) (-293.420) [-290.466] (-290.925) * [-290.896] (-289.359) (-292.963) (-290.406) -- 0:01:13
Average standard deviation of split frequencies: 0.017522
406000 -- (-291.728) [-291.087] (-292.226) (-292.076) * [-289.892] (-289.637) (-289.243) (-293.056) -- 0:01:13
407000 -- (-292.695) (-290.906) (-291.272) [-296.333] * (-291.364) (-290.651) (-291.467) [-290.091] -- 0:01:12
408000 -- (-291.591) (-289.965) (-290.605) [-294.751] * (-295.746) (-291.366) (-294.033) [-290.286] -- 0:01:12
409000 -- [-291.680] (-291.659) (-289.654) (-289.471) * (-289.676) (-290.930) (-290.105) [-293.011] -- 0:01:12
410000 -- (-291.748) [-290.678] (-290.668) (-291.142) * (-291.234) (-291.615) (-291.772) [-289.993] -- 0:01:11
Average standard deviation of split frequencies: 0.017792
411000 -- (-293.199) [-291.831] (-296.268) (-294.546) * (-290.353) (-292.722) (-291.115) [-291.115] -- 0:01:11
412000 -- (-293.299) (-291.415) [-290.876] (-291.410) * (-289.578) (-290.936) [-289.511] (-290.361) -- 0:01:11
413000 -- (-294.958) (-290.715) (-290.848) [-291.019] * (-289.266) (-291.856) (-293.193) [-291.139] -- 0:01:12
414000 -- (-292.197) (-291.458) [-290.944] (-292.971) * (-292.448) (-292.082) [-289.929] (-291.571) -- 0:01:12
415000 -- (-290.174) (-292.756) [-290.843] (-290.567) * [-290.329] (-294.574) (-290.243) (-290.744) -- 0:01:11
Average standard deviation of split frequencies: 0.016649
416000 -- (-295.211) (-292.414) [-292.917] (-290.846) * (-291.158) (-290.679) [-293.655] (-291.524) -- 0:01:11
417000 -- [-290.715] (-293.166) (-292.561) (-291.772) * [-290.259] (-291.978) (-292.510) (-292.166) -- 0:01:11
418000 -- (-289.301) [-292.895] (-292.073) (-291.626) * (-292.913) (-290.566) [-289.512] (-293.543) -- 0:01:11
419000 -- (-290.393) (-294.580) (-292.546) [-289.216] * (-289.343) [-291.318] (-294.680) (-290.747) -- 0:01:10
420000 -- (-290.073) (-293.162) [-292.164] (-290.629) * (-290.661) (-294.261) (-291.456) [-292.727] -- 0:01:10
Average standard deviation of split frequencies: 0.017650
421000 -- (-291.493) (-290.616) [-290.425] (-290.702) * (-291.136) (-291.188) (-291.453) [-289.688] -- 0:01:11
422000 -- (-290.603) [-291.355] (-292.924) (-291.664) * (-291.157) (-289.384) [-290.027] (-289.965) -- 0:01:11
423000 -- [-292.518] (-289.081) (-293.827) (-290.334) * (-293.750) (-290.082) (-292.028) [-292.834] -- 0:01:10
424000 -- (-294.328) (-291.861) (-289.706) [-292.500] * (-292.782) [-292.549] (-295.305) (-291.895) -- 0:01:10
425000 -- (-292.855) (-290.510) (-291.230) [-289.837] * [-292.292] (-291.220) (-291.202) (-292.843) -- 0:01:10
Average standard deviation of split frequencies: 0.016514
426000 -- (-290.826) [-291.133] (-289.620) (-292.454) * [-291.535] (-291.275) (-290.193) (-290.200) -- 0:01:10
427000 -- [-289.697] (-289.896) (-291.331) (-289.738) * (-289.884) (-292.335) (-293.241) [-291.798] -- 0:01:09
428000 -- (-290.003) [-293.113] (-291.001) (-291.684) * (-289.933) (-291.547) (-292.561) [-289.843] -- 0:01:09
429000 -- [-291.802] (-290.276) (-290.500) (-292.018) * (-297.609) (-290.711) [-292.478] (-291.791) -- 0:01:10
430000 -- (-292.026) (-290.844) [-290.201] (-289.681) * (-290.887) [-293.986] (-293.090) (-293.574) -- 0:01:10
Average standard deviation of split frequencies: 0.015559
431000 -- (-289.913) (-290.953) [-289.621] (-290.519) * (-291.835) (-290.260) [-291.159] (-291.850) -- 0:01:09
432000 -- (-292.351) (-292.642) (-290.158) [-292.729] * (-289.807) (-291.366) (-290.649) [-289.852] -- 0:01:09
433000 -- [-291.204] (-293.673) (-295.093) (-290.235) * (-289.731) (-289.553) (-289.728) [-290.826] -- 0:01:09
434000 -- (-291.907) [-292.064] (-291.681) (-295.452) * (-291.342) (-290.996) (-295.364) [-292.154] -- 0:01:09
435000 -- (-290.818) [-292.220] (-289.447) (-290.279) * (-290.571) (-291.641) (-290.174) [-289.519] -- 0:01:08
Average standard deviation of split frequencies: 0.016468
436000 -- [-293.000] (-293.133) (-294.533) (-289.247) * (-290.961) (-289.835) (-290.650) [-290.977] -- 0:01:08
437000 -- [-289.873] (-289.718) (-293.055) (-291.684) * (-292.631) (-290.987) (-291.095) [-289.500] -- 0:01:08
438000 -- (-292.626) (-290.743) [-296.280] (-289.391) * (-290.349) (-291.709) (-294.543) [-290.924] -- 0:01:09
439000 -- (-290.055) (-291.943) [-291.569] (-291.750) * (-290.461) (-290.658) (-289.414) [-294.282] -- 0:01:09
440000 -- (-290.734) (-294.469) [-290.822] (-290.694) * (-289.590) (-290.297) (-290.033) [-290.249] -- 0:01:08
Average standard deviation of split frequencies: 0.017758
441000 -- (-293.332) (-293.348) [-292.929] (-290.377) * (-296.065) (-290.102) (-291.058) [-292.327] -- 0:01:08
442000 -- [-293.333] (-289.984) (-291.122) (-290.801) * (-291.122) (-290.194) (-289.466) [-289.572] -- 0:01:08
443000 -- [-291.078] (-295.092) (-293.013) (-292.273) * (-293.607) (-291.898) (-293.228) [-289.846] -- 0:01:07
444000 -- (-291.522) (-290.482) (-292.095) [-291.233] * (-290.490) (-293.808) (-292.310) [-290.223] -- 0:01:07
445000 -- (-291.694) (-290.787) (-291.089) [-293.131] * (-290.078) (-292.156) (-291.140) [-289.404] -- 0:01:07
Average standard deviation of split frequencies: 0.016143
446000 -- (-292.929) (-290.249) (-293.286) [-292.275] * (-292.043) (-289.550) (-291.775) [-290.088] -- 0:01:08
447000 -- [-290.693] (-291.888) (-292.096) (-291.492) * (-296.416) (-291.730) (-291.701) [-289.596] -- 0:01:08
448000 -- (-291.930) (-290.999) [-293.669] (-292.877) * (-290.598) (-292.395) (-290.114) [-292.711] -- 0:01:07
449000 -- (-292.139) (-290.832) (-289.235) [-292.392] * (-289.615) (-290.658) (-294.231) [-289.894] -- 0:01:07
450000 -- (-290.335) (-289.609) (-291.319) [-290.324] * (-289.880) (-298.267) (-291.380) [-289.202] -- 0:01:07
Average standard deviation of split frequencies: 0.016039
451000 -- [-290.196] (-290.881) (-289.525) (-290.605) * (-295.598) (-294.920) (-291.968) [-289.391] -- 0:01:06
452000 -- (-294.442) [-289.455] (-289.721) (-289.031) * (-290.126) (-289.372) (-290.268) [-291.266] -- 0:01:06
453000 -- (-292.482) (-293.862) (-290.321) [-289.684] * (-290.277) (-290.114) (-297.148) [-292.481] -- 0:01:06
454000 -- (-291.936) (-293.194) [-290.564] (-294.788) * (-293.192) (-294.412) (-291.130) [-290.395] -- 0:01:07
455000 -- [-291.111] (-291.940) (-291.347) (-289.787) * (-290.828) (-293.076) (-291.184) [-291.774] -- 0:01:07
Average standard deviation of split frequencies: 0.017471
456000 -- (-292.296) [-292.729] (-293.332) (-291.298) * (-293.492) (-291.331) (-293.262) [-290.698] -- 0:01:06
457000 -- (-291.431) (-295.343) [-289.816] (-293.127) * (-289.129) (-290.011) (-290.878) [-291.472] -- 0:01:06
458000 -- [-293.081] (-296.886) (-291.110) (-289.087) * (-290.484) (-290.705) (-292.233) [-291.761] -- 0:01:06
459000 -- (-291.126) [-290.274] (-289.920) (-298.530) * (-291.535) (-294.315) (-292.323) [-291.321] -- 0:01:06
460000 -- (-289.702) [-290.699] (-293.791) (-290.112) * (-290.082) (-290.264) (-292.583) [-290.954] -- 0:01:05
Average standard deviation of split frequencies: 0.018317
461000 -- [-289.781] (-290.189) (-290.531) (-290.027) * (-294.404) (-293.875) (-290.511) [-290.673] -- 0:01:05
462000 -- (-290.556) (-296.286) [-291.215] (-292.659) * (-292.755) (-292.123) (-290.620) [-291.276] -- 0:01:05
463000 -- (-292.031) (-293.504) (-289.892) [-291.340] * (-292.576) (-289.007) (-289.695) [-292.208] -- 0:01:06
464000 -- (-294.782) (-289.866) (-291.195) [-291.421] * (-291.567) (-291.085) (-290.322) [-291.309] -- 0:01:05
465000 -- [-290.676] (-291.469) (-290.557) (-292.181) * (-295.862) (-291.181) (-294.643) [-291.162] -- 0:01:05
Average standard deviation of split frequencies: 0.018025
466000 -- (-291.191) (-289.732) (-289.820) [-290.110] * (-290.397) (-289.387) (-290.125) [-294.264] -- 0:01:05
467000 -- (-291.560) (-297.735) (-290.160) [-295.047] * (-289.290) (-291.865) (-290.445) [-291.879] -- 0:01:05
468000 -- [-290.872] (-290.790) (-290.556) (-295.711) * (-290.632) (-289.812) (-292.315) [-288.941] -- 0:01:04
469000 -- [-291.183] (-292.363) (-294.891) (-291.551) * (-295.765) (-290.474) (-291.662) [-296.316] -- 0:01:04
470000 -- [-291.408] (-291.762) (-290.727) (-290.528) * (-292.910) (-290.366) (-294.010) [-293.242] -- 0:01:04
Average standard deviation of split frequencies: 0.018028
471000 -- (-291.364) (-292.051) [-290.520] (-293.064) * (-292.564) (-292.026) (-292.423) [-293.751] -- 0:01:05
472000 -- (-291.378) (-289.498) [-290.866] (-293.465) * (-295.503) (-291.585) (-294.225) [-291.052] -- 0:01:04
473000 -- (-293.790) [-290.607] (-290.781) (-293.371) * (-289.766) (-291.342) (-291.887) [-293.457] -- 0:01:04
474000 -- [-290.498] (-297.375) (-291.827) (-290.723) * (-288.936) (-293.804) (-291.612) [-289.782] -- 0:01:04
475000 -- (-291.476) (-290.401) (-290.935) [-292.900] * (-290.585) (-289.873) (-291.551) [-292.022] -- 0:01:04
Average standard deviation of split frequencies: 0.017249
476000 -- (-293.283) (-294.996) [-289.361] (-290.342) * (-289.339) (-297.845) (-290.414) [-290.287] -- 0:01:03
477000 -- (-289.845) [-291.963] (-290.617) (-290.803) * (-292.395) (-291.297) (-290.264) [-290.319] -- 0:01:03
478000 -- (-293.987) (-292.102) (-289.289) [-291.730] * (-290.509) (-290.244) (-289.212) [-292.521] -- 0:01:03
479000 -- (-291.522) (-292.713) (-291.069) [-292.109] * (-294.910) (-291.167) (-291.471) [-294.894] -- 0:01:04
480000 -- (-290.352) (-291.897) [-291.253] (-291.776) * (-292.544) (-290.819) (-289.976) [-291.741] -- 0:01:03
Average standard deviation of split frequencies: 0.016100
481000 -- [-289.696] (-290.081) (-290.363) (-291.999) * (-292.600) (-289.551) (-291.024) [-291.112] -- 0:01:03
482000 -- (-291.400) (-291.122) [-292.372] (-289.540) * (-292.005) (-291.256) (-293.235) [-289.698] -- 0:01:03
483000 -- (-293.905) (-290.360) (-291.635) [-292.637] * (-291.862) (-295.720) (-290.866) [-289.324] -- 0:01:03
484000 -- [-292.541] (-294.469) (-290.389) (-291.372) * (-291.300) (-292.285) (-291.756) [-290.057] -- 0:01:02
485000 -- [-291.044] (-289.836) (-291.854) (-289.609) * (-290.802) (-290.470) (-291.291) [-291.016] -- 0:01:02
Average standard deviation of split frequencies: 0.015519
486000 -- (-290.003) [-289.818] (-290.683) (-291.120) * (-291.302) (-296.323) (-290.809) [-290.826] -- 0:01:02
487000 -- [-289.872] (-290.175) (-291.214) (-292.223) * (-290.678) (-293.226) (-290.663) [-293.335] -- 0:01:03
488000 -- [-293.756] (-291.176) (-295.943) (-292.384) * (-291.098) (-290.066) (-291.801) [-293.961] -- 0:01:02
489000 -- [-294.260] (-289.942) (-292.633) (-293.264) * (-293.215) (-291.708) (-290.184) [-290.001] -- 0:01:02
490000 -- [-291.981] (-294.542) (-289.876) (-293.633) * (-295.418) (-292.873) (-289.819) [-293.289] -- 0:01:02
Average standard deviation of split frequencies: 0.013968
491000 -- (-290.278) (-289.895) (-290.526) [-290.534] * (-290.138) (-293.403) (-290.218) [-290.041] -- 0:01:02
492000 -- (-291.582) (-291.113) [-291.098] (-292.648) * (-289.952) (-294.702) (-291.690) [-289.389] -- 0:01:01
493000 -- (-289.695) (-289.874) (-290.497) [-291.177] * (-290.184) (-293.794) (-292.890) [-293.634] -- 0:01:01
494000 -- (-297.027) (-290.353) (-290.384) [-291.677] * (-289.809) (-289.964) (-291.821) [-292.547] -- 0:01:01
495000 -- (-290.303) (-294.143) (-290.177) [-292.225] * (-297.506) [-289.907] (-295.065) (-291.045) -- 0:01:02
Average standard deviation of split frequencies: 0.014329
496000 -- [-291.105] (-289.813) (-290.646) (-290.498) * (-290.687) [-292.300] (-296.984) (-291.161) -- 0:01:01
497000 -- (-291.470) (-289.490) [-291.582] (-292.415) * [-292.669] (-291.687) (-294.763) (-290.655) -- 0:01:01
498000 -- (-290.412) (-290.678) (-290.791) [-291.537] * (-290.357) (-291.343) (-290.060) [-289.798] -- 0:01:01
499000 -- (-290.504) [-289.416] (-292.603) (-291.558) * (-291.876) (-292.585) [-291.094] (-294.749) -- 0:01:01
500000 -- (-292.170) (-292.623) [-290.860] (-289.585) * (-292.068) (-289.719) (-291.497) [-290.679] -- 0:01:01
Average standard deviation of split frequencies: 0.016006
501000 -- (-291.024) (-291.704) [-291.271] (-290.898) * (-289.345) (-291.249) (-290.122) [-290.876] -- 0:01:00
502000 -- (-290.380) [-293.509] (-290.068) (-290.401) * (-292.148) [-290.744] (-289.235) (-290.833) -- 0:01:00
503000 -- (-290.256) (-294.798) (-290.467) [-293.190] * (-291.804) (-290.575) (-295.342) [-290.093] -- 0:01:00
504000 -- (-292.808) (-291.767) (-291.170) [-291.263] * [-291.642] (-291.824) (-291.669) (-290.179) -- 0:01:01
505000 -- (-289.318) (-292.872) [-289.992] (-291.299) * [-290.591] (-290.235) (-292.197) (-291.857) -- 0:01:00
Average standard deviation of split frequencies: 0.014518
506000 -- [-290.357] (-292.545) (-296.817) (-294.500) * [-292.051] (-298.700) (-293.147) (-293.259) -- 0:01:00
507000 -- (-293.083) (-290.521) (-291.042) [-290.589] * (-294.236) (-292.264) (-291.392) [-289.845] -- 0:01:00
508000 -- (-297.798) (-289.461) [-295.897] (-294.397) * (-290.391) (-289.635) (-290.936) [-290.197] -- 0:01:00
509000 -- [-289.402] (-289.722) (-296.244) (-291.204) * (-292.094) (-291.884) (-293.248) [-291.237] -- 0:00:59
510000 -- [-292.087] (-290.837) (-292.926) (-292.124) * (-293.160) (-292.347) (-292.573) [-290.801] -- 0:00:59
Average standard deviation of split frequencies: 0.015945
511000 -- (-289.437) (-290.275) [-291.714] (-292.371) * (-292.583) (-289.772) (-291.257) [-291.728] -- 0:00:59
512000 -- (-295.873) (-290.612) (-291.838) [-295.679] * [-290.974] (-292.544) (-290.087) (-290.490) -- 0:01:00
513000 -- (-289.426) (-290.300) [-290.179] (-299.187) * (-289.802) [-290.003] (-294.973) (-289.808) -- 0:00:59
514000 -- (-295.285) [-292.310] (-294.123) (-290.886) * [-289.544] (-292.842) (-291.330) (-289.922) -- 0:00:59
515000 -- (-290.628) (-291.714) (-289.839) [-290.937] * (-293.025) [-292.180] (-293.748) (-291.523) -- 0:00:59
Average standard deviation of split frequencies: 0.017472
516000 -- [-293.452] (-292.355) (-292.359) (-291.205) * (-289.738) (-291.194) (-292.135) [-291.066] -- 0:00:59
517000 -- (-295.364) [-289.194] (-290.287) (-291.928) * (-291.053) [-290.190] (-293.195) (-293.201) -- 0:00:58
518000 -- [-292.173] (-290.070) (-293.270) (-295.977) * (-291.178) (-293.393) (-290.715) [-290.302] -- 0:00:58
519000 -- [-291.324] (-290.343) (-290.357) (-294.457) * (-290.047) (-293.733) (-290.755) [-290.817] -- 0:00:58
520000 -- [-293.341] (-290.379) (-291.028) (-289.755) * (-291.162) (-291.467) [-289.814] (-289.646) -- 0:00:58
Average standard deviation of split frequencies: 0.016976
521000 -- [-294.667] (-292.523) (-290.133) (-293.527) * [-291.592] (-289.276) (-290.880) (-290.925) -- 0:00:58
522000 -- [-295.518] (-290.915) (-291.463) (-294.076) * (-295.488) (-290.462) [-293.942] (-291.488) -- 0:00:58
523000 -- (-293.701) [-290.095] (-290.622) (-290.505) * (-292.736) (-291.398) (-290.476) [-292.769] -- 0:00:58
524000 -- [-290.222] (-291.836) (-292.673) (-298.401) * [-289.887] (-291.423) (-289.916) (-290.946) -- 0:00:58
525000 -- (-290.941) [-291.792] (-289.360) (-293.902) * [-289.443] (-292.234) (-291.518) (-289.443) -- 0:00:57
Average standard deviation of split frequencies: 0.016530
526000 -- (-291.641) (-289.602) [-289.709] (-292.182) * (-290.539) (-292.988) (-291.725) [-290.822] -- 0:00:57
527000 -- [-292.300] (-290.587) (-290.403) (-292.609) * (-291.376) (-295.874) (-289.271) [-289.266] -- 0:00:57
528000 -- [-291.059] (-290.845) (-290.585) (-294.365) * (-292.620) (-292.590) (-290.114) [-293.837] -- 0:00:57
529000 -- (-291.907) [-290.791] (-292.568) (-293.430) * (-289.736) [-290.314] (-293.013) (-290.610) -- 0:00:57
530000 -- (-293.042) [-290.473] (-290.158) (-291.087) * (-289.927) (-294.530) (-291.509) [-290.392] -- 0:00:57
Average standard deviation of split frequencies: 0.016612
531000 -- [-289.632] (-290.691) (-291.883) (-290.479) * [-293.379] (-291.713) (-291.325) (-291.252) -- 0:00:57
532000 -- (-291.755) [-290.459] (-292.484) (-294.710) * [-290.601] (-293.181) (-290.046) (-293.574) -- 0:00:57
533000 -- (-295.031) [-289.665] (-292.818) (-293.153) * (-293.362) [-290.453] (-290.442) (-291.696) -- 0:00:56
534000 -- (-294.062) (-290.628) [-291.533] (-293.561) * (-290.823) [-290.950] (-289.727) (-290.035) -- 0:00:56
535000 -- (-290.599) (-292.290) (-291.030) [-291.418] * (-292.917) (-293.831) [-291.634] (-290.943) -- 0:00:56
Average standard deviation of split frequencies: 0.015538
536000 -- [-289.108] (-291.218) (-289.733) (-292.557) * (-291.480) (-292.951) (-292.699) [-290.284] -- 0:00:56
537000 -- [-289.453] (-291.961) (-297.522) (-289.928) * (-291.616) (-290.317) [-291.516] (-292.699) -- 0:00:56
538000 -- (-291.263) [-289.748] (-290.407) (-290.658) * (-291.109) (-292.882) (-294.812) [-290.774] -- 0:00:56
539000 -- [-291.721] (-289.995) (-289.513) (-292.742) * (-289.984) (-292.729) [-290.520] (-295.419) -- 0:00:56
540000 -- [-293.268] (-291.063) (-291.725) (-292.287) * [-289.477] (-289.108) (-289.701) (-289.494) -- 0:00:56
Average standard deviation of split frequencies: 0.015084
541000 -- [-292.506] (-290.138) (-290.135) (-289.919) * [-289.747] (-289.925) (-295.252) (-293.686) -- 0:00:55
542000 -- [-292.995] (-293.015) (-292.059) (-291.454) * (-290.266) (-291.409) [-293.650] (-289.066) -- 0:00:55
543000 -- (-291.682) (-293.239) (-293.092) [-290.995] * [-289.853] (-292.079) (-289.995) (-289.834) -- 0:00:55
544000 -- [-289.708] (-294.558) (-292.045) (-291.598) * (-289.418) (-291.348) (-290.628) [-289.394] -- 0:00:55
545000 -- (-291.659) (-290.773) [-293.839] (-292.484) * (-292.116) (-291.738) (-291.358) [-293.276] -- 0:00:55
Average standard deviation of split frequencies: 0.014206
546000 -- [-290.852] (-291.511) (-290.692) (-289.343) * (-290.900) [-289.716] (-292.119) (-291.729) -- 0:00:55
547000 -- (-292.648) (-291.835) (-293.557) [-290.590] * (-291.542) [-292.695] (-291.413) (-289.985) -- 0:00:55
548000 -- (-291.677) (-293.705) (-290.686) [-292.700] * (-291.205) [-293.819] (-290.768) (-292.728) -- 0:00:55
549000 -- (-293.072) [-290.809] (-289.543) (-302.332) * (-291.455) [-289.559] (-290.912) (-291.561) -- 0:00:55
550000 -- (-292.576) (-292.069) (-289.176) [-292.431] * (-289.708) (-291.287) (-288.918) [-289.358] -- 0:00:54
Average standard deviation of split frequencies: 0.014810
551000 -- (-294.786) (-291.224) (-291.743) [-293.129] * (-290.891) (-290.264) [-293.964] (-291.350) -- 0:00:54
552000 -- (-291.958) (-293.055) (-294.327) [-291.581] * (-293.041) (-293.489) (-289.696) [-290.796] -- 0:00:54
553000 -- [-289.178] (-290.795) (-289.833) (-295.611) * (-294.537) (-293.645) (-289.654) [-291.123] -- 0:00:54
554000 -- (-291.544) (-295.039) [-289.703] (-293.942) * (-297.544) (-291.536) (-290.976) [-292.444] -- 0:00:53
555000 -- (-289.260) (-292.401) [-290.813] (-289.245) * [-290.493] (-293.707) (-290.342) (-291.804) -- 0:00:54
Average standard deviation of split frequencies: 0.015897
556000 -- [-293.236] (-291.216) (-290.895) (-290.405) * [-290.090] (-293.581) (-291.677) (-295.240) -- 0:00:54
557000 -- (-291.472) [-289.795] (-291.820) (-290.202) * [-291.819] (-291.029) (-293.568) (-295.014) -- 0:00:54
558000 -- (-289.379) [-290.984] (-291.306) (-293.827) * (-291.051) (-289.248) (-292.619) [-290.643] -- 0:00:53
559000 -- [-290.819] (-294.696) (-290.773) (-295.507) * (-290.618) [-290.943] (-290.145) (-291.841) -- 0:00:53
560000 -- (-291.432) (-290.847) (-289.637) [-293.111] * [-289.841] (-289.309) (-293.886) (-289.093) -- 0:00:53
Average standard deviation of split frequencies: 0.015695
561000 -- (-293.119) (-291.106) [-289.586] (-292.589) * [-291.380] (-291.983) (-292.285) (-290.094) -- 0:00:53
562000 -- (-291.136) (-291.419) (-291.300) [-289.398] * (-290.949) (-293.518) [-292.814] (-293.222) -- 0:00:52
563000 -- [-289.342] (-290.231) (-290.957) (-291.839) * [-290.997] (-290.788) (-291.168) (-290.867) -- 0:00:53
564000 -- (-290.037) [-293.433] (-290.193) (-292.486) * [-291.154] (-291.512) (-292.242) (-291.152) -- 0:00:53
565000 -- [-289.048] (-291.402) (-297.636) (-290.905) * (-291.462) (-291.458) (-293.000) [-289.704] -- 0:00:53
Average standard deviation of split frequencies: 0.013992
566000 -- (-289.928) (-289.852) [-291.990] (-290.764) * (-291.647) (-292.341) (-292.360) [-289.517] -- 0:00:52
567000 -- [-291.655] (-290.514) (-291.249) (-291.872) * (-290.646) (-289.836) (-293.490) [-289.583] -- 0:00:52
568000 -- (-291.238) (-292.653) (-296.459) [-290.380] * [-290.900] (-289.711) (-292.247) (-293.707) -- 0:00:52
569000 -- [-292.438] (-292.319) (-301.009) (-289.357) * (-289.859) (-290.666) [-291.753] (-291.292) -- 0:00:52
570000 -- [-291.891] (-292.029) (-292.871) (-289.739) * (-289.825) (-290.967) [-290.418] (-292.461) -- 0:00:52
Average standard deviation of split frequencies: 0.012917
571000 -- (-291.062) (-290.139) [-291.043] (-290.603) * [-291.162] (-292.752) (-289.301) (-290.915) -- 0:00:52
572000 -- [-291.829] (-291.367) (-290.177) (-290.639) * (-299.969) (-293.948) [-292.152] (-288.886) -- 0:00:52
573000 -- (-290.972) (-292.305) (-293.846) [-294.794] * [-292.244] (-290.923) (-290.965) (-292.877) -- 0:00:52
574000 -- (-291.098) (-291.801) [-290.859] (-289.278) * [-291.322] (-292.706) (-290.479) (-289.780) -- 0:00:51
575000 -- [-292.039] (-289.972) (-290.205) (-289.673) * (-293.027) (-290.742) (-294.596) [-291.790] -- 0:00:51
Average standard deviation of split frequencies: 0.013367
576000 -- [-291.523] (-291.440) (-291.263) (-293.362) * (-289.506) [-292.712] (-293.687) (-289.914) -- 0:00:51
577000 -- [-293.582] (-291.042) (-294.254) (-289.086) * [-289.342] (-293.335) (-290.175) (-292.484) -- 0:00:51
578000 -- (-290.152) (-294.805) [-291.676] (-289.273) * [-291.288] (-292.300) (-292.069) (-291.776) -- 0:00:51
579000 -- (-291.594) (-290.931) [-294.962] (-290.296) * [-290.011] (-289.947) (-294.971) (-291.978) -- 0:00:50
580000 -- (-290.560) (-289.549) [-290.474] (-291.205) * (-291.415) (-289.898) [-291.508] (-290.618) -- 0:00:51
Average standard deviation of split frequencies: 0.013497
581000 -- (-290.782) (-292.897) (-293.813) [-290.658] * (-292.479) (-303.073) [-290.948] (-291.838) -- 0:00:51
582000 -- (-292.325) (-296.556) (-293.876) [-292.632] * (-292.827) (-289.551) [-290.671] (-291.112) -- 0:00:50
583000 -- (-292.172) (-292.211) [-290.034] (-291.724) * [-292.772] (-291.402) (-295.943) (-289.313) -- 0:00:50
584000 -- [-294.641] (-292.457) (-293.170) (-290.131) * (-292.511) (-293.118) [-290.531] (-290.675) -- 0:00:50
585000 -- (-291.329) [-291.766] (-290.336) (-295.312) * (-298.848) (-292.245) (-289.597) [-289.110] -- 0:00:50
Average standard deviation of split frequencies: 0.012514
586000 -- (-294.665) (-298.958) [-289.735] (-293.457) * (-293.424) (-295.858) (-291.351) [-290.983] -- 0:00:50
587000 -- (-294.005) (-289.985) [-290.659] (-292.549) * (-291.526) (-291.304) (-290.395) [-289.444] -- 0:00:49
588000 -- [-291.336] (-290.097) (-293.570) (-292.098) * (-294.426) (-291.880) (-289.272) [-291.585] -- 0:00:50
589000 -- (-292.645) (-291.548) (-293.727) [-289.838] * (-292.627) (-296.219) (-289.711) [-290.145] -- 0:00:50
590000 -- [-293.144] (-293.178) (-290.006) (-290.866) * (-292.110) (-296.643) (-289.926) [-289.880] -- 0:00:50
Average standard deviation of split frequencies: 0.012415
591000 -- (-289.681) [-290.028] (-289.979) (-294.479) * (-292.332) [-293.106] (-290.600) (-291.710) -- 0:00:49
592000 -- (-291.394) (-293.640) (-291.974) [-290.325] * (-290.167) (-289.143) (-295.738) [-289.505] -- 0:00:49
593000 -- (-290.765) (-292.999) (-293.102) [-289.678] * [-289.850] (-290.913) (-292.213) (-290.972) -- 0:00:49
594000 -- [-289.503] (-289.299) (-290.897) (-293.092) * (-290.499) [-289.785] (-291.089) (-291.803) -- 0:00:49
595000 -- (-291.138) (-290.608) (-291.669) [-293.997] * (-290.918) [-290.917] (-294.208) (-291.773) -- 0:00:49
Average standard deviation of split frequencies: 0.011785
596000 -- (-293.029) [-290.715] (-289.964) (-295.608) * (-292.364) [-289.473] (-290.534) (-293.099) -- 0:00:49
597000 -- (-290.891) (-290.889) (-290.597) [-289.997] * (-293.150) [-292.025] (-290.087) (-293.287) -- 0:00:49
598000 -- (-290.103) (-291.289) (-290.797) [-291.394] * (-292.375) [-292.270] (-292.691) (-293.309) -- 0:00:49
599000 -- (-293.491) (-291.942) (-291.907) [-292.213] * [-290.884] (-295.117) (-291.294) (-292.461) -- 0:00:48
600000 -- (-290.970) (-290.392) (-292.573) [-290.308] * (-290.395) [-290.743] (-292.196) (-290.709) -- 0:00:48
Average standard deviation of split frequencies: 0.012669
601000 -- [-289.722] (-291.602) (-294.854) (-291.292) * (-290.456) (-292.382) [-292.028] (-290.956) -- 0:00:48
602000 -- (-291.154) [-289.828] (-294.019) (-292.417) * (-290.975) (-292.727) (-290.329) [-291.676] -- 0:00:48
603000 -- (-290.408) [-289.918] (-290.712) (-293.768) * [-289.851] (-296.610) (-289.688) (-294.189) -- 0:00:48
604000 -- (-292.030) (-298.044) (-291.319) [-290.873] * (-290.644) (-289.947) (-290.155) [-290.876] -- 0:00:47
605000 -- (-289.318) (-294.823) (-291.502) [-292.002] * (-293.978) (-289.810) (-294.809) [-292.523] -- 0:00:48
Average standard deviation of split frequencies: 0.011409
606000 -- (-292.490) (-291.139) (-292.097) [-289.978] * (-295.287) (-293.116) (-291.351) [-290.767] -- 0:00:48
607000 -- (-289.956) (-292.008) (-290.197) [-292.195] * (-290.953) (-293.580) [-289.645] (-292.572) -- 0:00:47
608000 -- (-291.072) [-291.713] (-294.501) (-293.040) * (-291.526) (-294.635) (-291.953) [-289.384] -- 0:00:47
609000 -- [-290.083] (-292.779) (-290.585) (-289.759) * (-292.238) (-297.202) [-290.618] (-290.686) -- 0:00:47
610000 -- [-290.955] (-290.870) (-290.886) (-291.949) * (-289.215) (-290.965) (-292.423) [-292.277] -- 0:00:47
Average standard deviation of split frequencies: 0.011800
611000 -- (-290.082) (-290.640) (-289.378) [-290.288] * (-293.896) (-289.901) [-293.753] (-293.578) -- 0:00:47
612000 -- (-294.207) [-292.159] (-289.609) (-292.114) * [-289.762] (-290.338) (-289.746) (-290.912) -- 0:00:46
613000 -- [-291.814] (-290.611) (-291.797) (-291.076) * [-290.488] (-293.930) (-292.003) (-292.475) -- 0:00:47
614000 -- (-292.274) [-291.596] (-291.094) (-289.987) * (-289.566) (-295.388) [-290.434] (-291.350) -- 0:00:47
615000 -- [-294.150] (-290.894) (-289.757) (-291.275) * [-291.288] (-290.604) (-290.008) (-290.745) -- 0:00:46
Average standard deviation of split frequencies: 0.013775
616000 -- (-292.781) (-289.204) [-291.357] (-289.708) * (-290.936) (-291.105) [-293.563] (-291.022) -- 0:00:46
617000 -- (-291.915) [-293.666] (-291.636) (-295.029) * (-291.545) (-293.456) (-290.211) [-295.088] -- 0:00:46
618000 -- (-289.670) (-294.140) (-292.998) [-290.115] * [-293.159] (-291.972) (-292.560) (-290.406) -- 0:00:46
619000 -- (-291.536) (-291.041) (-295.752) [-293.471] * (-292.219) [-290.732] (-290.333) (-290.636) -- 0:00:46
620000 -- (-289.717) (-291.523) (-289.737) [-292.445] * (-291.703) (-295.476) [-293.310] (-290.028) -- 0:00:45
Average standard deviation of split frequencies: 0.012152
621000 -- (-291.229) (-293.492) (-292.654) [-292.529] * (-291.246) [-290.055] (-293.136) (-290.344) -- 0:00:45
622000 -- (-294.021) [-292.015] (-291.695) (-291.524) * (-290.517) (-291.918) (-291.139) [-289.785] -- 0:00:46
623000 -- (-292.897) (-292.176) (-291.461) [-291.038] * [-292.171] (-293.546) (-290.502) (-290.941) -- 0:00:45
624000 -- (-297.678) (-291.328) [-291.616] (-291.276) * (-292.100) (-294.398) [-291.396] (-290.132) -- 0:00:45
625000 -- (-292.510) (-291.803) [-289.681] (-292.707) * (-294.516) (-291.122) (-289.196) [-289.828] -- 0:00:45
Average standard deviation of split frequencies: 0.013931
626000 -- (-289.871) [-290.371] (-290.265) (-292.942) * (-295.689) [-290.720] (-293.325) (-291.364) -- 0:00:45
627000 -- [-289.879] (-290.335) (-290.215) (-291.675) * (-289.303) (-291.528) (-290.487) [-290.386] -- 0:00:45
628000 -- (-292.817) (-297.796) [-293.955] (-291.517) * [-291.138] (-291.150) (-290.574) (-291.174) -- 0:00:45
629000 -- (-295.501) (-290.124) [-289.125] (-292.590) * (-289.540) (-291.683) [-290.091] (-294.229) -- 0:00:44
630000 -- [-291.540] (-292.133) (-290.876) (-294.398) * (-290.989) (-289.434) (-290.425) [-290.854] -- 0:00:45
Average standard deviation of split frequencies: 0.013641
631000 -- [-291.660] (-289.791) (-299.704) (-294.402) * [-290.640] (-295.774) (-289.292) (-292.059) -- 0:00:45
632000 -- [-292.003] (-292.848) (-291.768) (-290.561) * (-290.971) (-290.755) (-291.292) [-290.632] -- 0:00:44
633000 -- (-290.889) (-293.021) (-290.403) [-290.441] * (-297.372) [-291.166] (-292.425) (-295.500) -- 0:00:44
634000 -- (-293.036) (-293.145) [-291.747] (-292.377) * (-290.033) [-291.222] (-291.780) (-290.910) -- 0:00:44
635000 -- (-290.750) [-290.302] (-289.020) (-292.369) * (-289.616) [-290.542] (-292.552) (-289.476) -- 0:00:44
Average standard deviation of split frequencies: 0.013527
636000 -- (-295.757) (-295.193) (-289.587) [-289.359] * (-290.223) [-289.868] (-289.914) (-293.110) -- 0:00:44
637000 -- [-292.110] (-293.272) (-289.307) (-289.775) * (-295.562) [-289.535] (-288.974) (-292.064) -- 0:00:43
638000 -- (-292.938) (-296.821) (-289.473) [-291.425] * (-293.324) (-293.213) [-291.356] (-291.602) -- 0:00:43
639000 -- (-292.626) (-293.019) [-292.306] (-290.621) * (-291.222) [-289.968] (-290.281) (-292.770) -- 0:00:44
640000 -- (-290.586) (-290.914) (-291.379) [-289.266] * (-292.302) [-289.959] (-294.563) (-290.668) -- 0:00:43
Average standard deviation of split frequencies: 0.013122
641000 -- (-289.635) [-291.299] (-290.954) (-288.980) * (-292.739) (-289.905) [-289.598] (-289.775) -- 0:00:43
642000 -- (-290.588) (-293.057) [-292.388] (-292.244) * [-289.322] (-292.185) (-289.365) (-290.451) -- 0:00:43
643000 -- (-292.057) (-294.010) [-291.831] (-294.665) * [-291.192] (-289.948) (-290.482) (-290.151) -- 0:00:43
644000 -- [-290.911] (-295.714) (-290.942) (-290.047) * (-291.197) (-290.780) (-292.521) [-290.992] -- 0:00:43
645000 -- (-290.308) [-293.122] (-289.205) (-290.446) * (-292.092) (-290.622) [-291.639] (-293.125) -- 0:00:42
Average standard deviation of split frequencies: 0.012197
646000 -- (-290.722) (-290.880) (-291.053) [-290.345] * [-289.932] (-292.759) (-293.194) (-296.091) -- 0:00:42
647000 -- [-291.095] (-289.622) (-291.088) (-289.038) * (-290.451) (-289.876) [-291.469] (-292.731) -- 0:00:43
648000 -- (-293.922) (-290.008) [-289.666] (-295.225) * (-290.065) (-289.724) (-290.716) [-291.950] -- 0:00:42
649000 -- [-289.160] (-293.768) (-290.691) (-290.798) * [-289.398] (-291.861) (-291.425) (-292.934) -- 0:00:42
650000 -- (-289.413) (-291.221) [-290.674] (-291.629) * (-290.608) [-292.240] (-292.987) (-289.754) -- 0:00:42
Average standard deviation of split frequencies: 0.012679
651000 -- (-293.445) [-292.401] (-291.105) (-290.742) * (-290.861) (-293.035) [-290.717] (-290.035) -- 0:00:42
652000 -- (-290.592) (-294.161) (-291.855) [-290.767] * (-292.350) (-296.745) (-292.076) [-294.838] -- 0:00:42
653000 -- (-290.097) [-289.214] (-290.731) (-290.999) * (-295.131) (-294.981) (-290.895) [-292.379] -- 0:00:41
654000 -- [-289.434] (-291.473) (-290.804) (-291.254) * (-292.547) (-292.880) (-289.546) [-291.931] -- 0:00:41
655000 -- (-297.225) [-290.906] (-294.914) (-293.544) * (-296.673) [-289.717] (-293.895) (-291.265) -- 0:00:41
Average standard deviation of split frequencies: 0.012336
656000 -- (-292.496) [-293.502] (-289.927) (-291.264) * (-292.445) (-289.276) [-289.609] (-292.610) -- 0:00:41
657000 -- [-292.971] (-291.466) (-290.544) (-293.508) * [-293.592] (-292.180) (-292.001) (-292.009) -- 0:00:41
658000 -- [-290.022] (-290.491) (-292.865) (-291.784) * [-290.122] (-289.382) (-291.682) (-295.167) -- 0:00:41
659000 -- (-289.883) (-293.887) [-291.392] (-290.061) * [-290.304] (-290.824) (-295.622) (-289.465) -- 0:00:41
660000 -- (-294.067) (-291.899) [-290.804] (-290.309) * (-293.594) [-289.480] (-290.741) (-293.213) -- 0:00:41
Average standard deviation of split frequencies: 0.013200
661000 -- [-293.829] (-290.902) (-289.522) (-295.995) * (-289.929) (-293.653) [-290.800] (-289.245) -- 0:00:41
662000 -- (-293.962) [-289.483] (-290.213) (-291.921) * (-290.455) [-289.912] (-289.466) (-291.270) -- 0:00:40
663000 -- (-290.507) (-293.593) (-295.468) [-291.256] * (-290.445) (-292.580) (-290.507) [-289.736] -- 0:00:40
664000 -- (-289.996) (-295.706) [-289.815] (-292.051) * (-294.819) [-294.239] (-290.825) (-293.633) -- 0:00:40
665000 -- (-291.356) (-295.721) (-292.785) [-293.412] * [-290.508] (-290.486) (-292.450) (-290.485) -- 0:00:40
Average standard deviation of split frequencies: 0.013213
666000 -- (-291.375) [-294.203] (-289.287) (-294.167) * (-290.838) (-291.618) [-292.080] (-292.390) -- 0:00:40
667000 -- (-290.028) [-290.898] (-290.351) (-290.085) * (-291.649) (-290.209) [-289.428] (-290.424) -- 0:00:40
668000 -- (-290.664) (-291.154) (-291.853) [-289.420] * [-295.353] (-290.995) (-293.213) (-290.626) -- 0:00:40
669000 -- (-291.171) (-289.888) (-297.802) [-289.026] * (-292.101) (-299.541) (-290.211) [-290.576] -- 0:00:40
670000 -- (-291.377) (-291.296) (-294.633) [-292.131] * [-291.588] (-291.163) (-289.970) (-292.573) -- 0:00:39
Average standard deviation of split frequencies: 0.013121
671000 -- (-291.194) (-292.305) (-290.009) [-293.336] * [-290.805] (-291.578) (-294.240) (-289.698) -- 0:00:39
672000 -- (-291.959) (-291.203) [-292.301] (-290.383) * (-289.987) (-294.194) [-290.874] (-292.626) -- 0:00:40
673000 -- (-291.162) (-291.210) (-292.173) [-289.692] * (-291.112) (-290.563) [-290.922] (-292.813) -- 0:00:39
674000 -- [-290.424] (-289.822) (-294.298) (-292.846) * (-292.145) (-290.842) (-291.564) [-290.111] -- 0:00:39
675000 -- (-289.154) (-292.592) [-295.214] (-290.146) * (-292.710) (-292.084) [-290.030] (-289.630) -- 0:00:39
Average standard deviation of split frequencies: 0.013598
676000 -- [-291.463] (-289.825) (-297.135) (-290.875) * (-291.819) (-291.262) [-289.973] (-290.574) -- 0:00:39
677000 -- [-292.514] (-291.118) (-296.192) (-289.402) * (-291.754) (-289.830) [-290.389] (-290.148) -- 0:00:39
678000 -- (-295.277) (-290.339) (-291.223) [-289.920] * (-290.989) (-289.815) [-290.161] (-290.697) -- 0:00:38
679000 -- (-295.609) [-290.923] (-290.724) (-299.769) * [-290.671] (-290.285) (-291.082) (-290.025) -- 0:00:38
680000 -- (-292.660) (-290.975) (-291.321) [-292.727] * (-292.786) (-291.965) (-291.255) [-291.822] -- 0:00:38
Average standard deviation of split frequencies: 0.012928
681000 -- (-293.147) (-292.672) (-292.025) [-290.612] * (-289.822) (-291.049) [-290.639] (-295.058) -- 0:00:38
682000 -- [-292.040] (-290.642) (-292.048) (-290.581) * (-293.529) [-290.603] (-290.557) (-293.307) -- 0:00:38
683000 -- (-293.824) [-290.899] (-291.856) (-291.559) * (-297.380) (-291.527) [-291.305] (-292.166) -- 0:00:38
684000 -- [-292.172] (-291.078) (-290.308) (-293.057) * [-291.625] (-291.199) (-291.674) (-290.149) -- 0:00:38
685000 -- (-292.036) (-292.811) [-291.745] (-294.177) * (-298.147) (-292.533) (-295.545) [-292.871] -- 0:00:38
Average standard deviation of split frequencies: 0.012827
686000 -- [-292.961] (-289.903) (-289.235) (-290.040) * (-293.739) [-291.140] (-294.700) (-297.527) -- 0:00:37
687000 -- (-292.841) (-289.671) [-291.864] (-290.187) * (-293.550) (-291.046) [-289.770] (-293.930) -- 0:00:37
688000 -- (-292.903) (-290.277) [-289.140] (-291.048) * [-292.889] (-292.620) (-290.467) (-290.097) -- 0:00:37
689000 -- (-290.044) (-294.938) [-294.618] (-292.173) * (-289.607) [-289.846] (-290.276) (-292.669) -- 0:00:37
690000 -- (-292.267) (-291.267) (-290.337) [-296.968] * [-290.943] (-293.066) (-291.432) (-289.594) -- 0:00:37
Average standard deviation of split frequencies: 0.012627
691000 -- (-290.894) [-291.237] (-289.317) (-293.892) * (-293.615) (-290.855) (-290.491) [-289.977] -- 0:00:37
692000 -- (-291.689) (-291.261) [-291.261] (-289.758) * (-292.093) (-290.611) (-290.874) [-289.581] -- 0:00:37
693000 -- (-289.816) (-292.854) (-293.720) [-291.679] * (-292.126) (-292.136) [-289.271] (-291.066) -- 0:00:37
694000 -- (-292.743) (-292.089) (-291.188) [-293.120] * (-295.731) (-290.417) (-295.508) [-293.904] -- 0:00:37
695000 -- (-291.740) (-290.287) (-292.905) [-292.050] * (-290.749) [-294.598] (-290.489) (-290.397) -- 0:00:36
Average standard deviation of split frequencies: 0.012869
696000 -- [-292.677] (-290.720) (-295.424) (-293.642) * [-296.231] (-290.860) (-289.488) (-290.098) -- 0:00:36
697000 -- (-295.002) (-289.124) (-289.458) [-291.963] * [-289.104] (-290.502) (-292.645) (-289.445) -- 0:00:36
698000 -- (-291.809) [-289.399] (-289.990) (-289.587) * (-291.068) (-295.609) (-293.237) [-290.151] -- 0:00:36
699000 -- (-292.096) (-292.364) [-291.753] (-289.457) * (-291.167) (-295.671) (-290.314) [-291.561] -- 0:00:36
700000 -- [-290.406] (-290.557) (-293.435) (-293.250) * (-291.193) [-294.090] (-291.916) (-292.078) -- 0:00:36
Average standard deviation of split frequencies: 0.011998
701000 -- (-290.275) (-290.457) (-293.096) [-291.287] * (-290.036) (-294.667) (-292.369) [-289.538] -- 0:00:36
702000 -- (-291.843) [-289.188] (-293.586) (-291.364) * (-290.389) (-293.399) [-290.804] (-293.818) -- 0:00:36
703000 -- (-293.192) [-291.660] (-293.428) (-295.637) * [-292.912] (-291.566) (-291.502) (-292.822) -- 0:00:35
704000 -- [-294.355] (-292.815) (-290.353) (-290.383) * (-290.863) (-289.501) [-289.043] (-291.979) -- 0:00:35
705000 -- (-290.370) [-292.240] (-293.223) (-292.260) * [-290.862] (-290.866) (-295.449) (-290.092) -- 0:00:35
Average standard deviation of split frequencies: 0.012591
706000 -- (-291.544) (-290.447) (-291.479) [-290.079] * (-290.831) (-290.888) [-290.034] (-289.932) -- 0:00:35
707000 -- (-293.275) [-291.257] (-294.617) (-290.861) * [-292.776] (-289.583) (-289.794) (-296.016) -- 0:00:35
708000 -- (-297.848) (-293.486) (-292.419) [-291.882] * (-293.607) (-291.200) (-292.164) [-290.527] -- 0:00:35
709000 -- (-295.652) (-296.738) [-291.916] (-294.637) * (-290.737) [-290.084] (-289.456) (-293.407) -- 0:00:35
710000 -- (-290.233) (-295.883) (-292.411) [-291.229] * [-293.120] (-294.025) (-293.175) (-292.485) -- 0:00:35
Average standard deviation of split frequencies: 0.012869
711000 -- [-294.772] (-292.464) (-290.782) (-292.027) * [-289.050] (-290.971) (-294.227) (-291.644) -- 0:00:34
712000 -- [-290.809] (-290.993) (-289.186) (-294.180) * (-290.532) [-290.027] (-292.603) (-290.797) -- 0:00:34
713000 -- (-291.782) [-295.842] (-290.732) (-293.287) * (-293.859) (-289.393) (-289.960) [-292.118] -- 0:00:34
714000 -- (-289.364) [-294.389] (-289.859) (-292.702) * (-292.110) (-290.468) (-290.589) [-291.870] -- 0:00:34
715000 -- (-291.638) [-289.663] (-295.259) (-293.235) * [-294.816] (-293.464) (-294.558) (-292.789) -- 0:00:34
Average standard deviation of split frequencies: 0.014155
716000 -- (-291.915) [-293.026] (-292.527) (-290.620) * (-290.415) (-293.716) (-293.220) [-291.482] -- 0:00:34
717000 -- (-291.166) [-290.474] (-291.005) (-289.668) * (-290.305) [-294.826] (-295.491) (-294.166) -- 0:00:34
718000 -- (-290.553) (-291.382) [-290.847] (-295.420) * [-289.997] (-291.555) (-289.893) (-290.881) -- 0:00:34
719000 -- (-292.921) [-290.701] (-294.101) (-294.193) * (-291.459) (-295.506) (-289.649) [-291.871] -- 0:00:34
720000 -- (-295.523) (-292.212) (-297.214) [-289.959] * [-292.252] (-291.534) (-289.488) (-289.876) -- 0:00:33
Average standard deviation of split frequencies: 0.014129
721000 -- [-290.575] (-289.544) (-289.361) (-291.498) * (-291.504) (-290.488) [-293.379] (-291.996) -- 0:00:33
722000 -- (-291.157) [-291.607] (-290.471) (-290.845) * [-291.175] (-290.539) (-289.826) (-293.426) -- 0:00:33
723000 -- (-289.501) [-291.489] (-295.388) (-293.135) * (-289.458) (-290.702) (-291.016) [-292.181] -- 0:00:33
724000 -- (-290.854) (-293.771) [-290.091] (-293.802) * (-293.474) (-291.278) [-293.430] (-290.367) -- 0:00:33
725000 -- (-292.735) [-291.409] (-293.796) (-291.339) * (-299.261) [-293.872] (-289.930) (-292.903) -- 0:00:33
Average standard deviation of split frequencies: 0.013895
726000 -- (-293.865) (-292.573) (-290.167) [-290.332] * (-290.847) (-289.857) (-291.145) [-291.365] -- 0:00:33
727000 -- (-290.684) [-291.027] (-293.822) (-295.550) * (-292.780) (-296.181) (-292.687) [-292.186] -- 0:00:33
728000 -- [-290.021] (-294.602) (-289.597) (-290.328) * (-296.549) (-291.894) (-289.839) [-291.642] -- 0:00:32
729000 -- (-290.734) (-300.526) (-289.926) [-290.245] * (-295.553) [-289.107] (-291.242) (-294.540) -- 0:00:32
730000 -- (-289.892) (-290.467) [-291.220] (-291.156) * (-294.246) (-290.065) (-293.233) [-290.018] -- 0:00:32
Average standard deviation of split frequencies: 0.013710
731000 -- (-290.124) [-290.541] (-289.526) (-290.426) * (-292.717) [-289.630] (-289.169) (-294.263) -- 0:00:32
732000 -- [-290.011] (-290.371) (-292.253) (-290.961) * [-290.590] (-290.957) (-290.238) (-290.399) -- 0:00:32
733000 -- (-291.495) (-292.121) [-292.774] (-294.382) * (-289.441) (-292.775) (-292.782) [-289.213] -- 0:00:32
734000 -- [-290.216] (-291.471) (-290.700) (-294.733) * [-289.628] (-293.701) (-290.037) (-291.955) -- 0:00:32
735000 -- [-289.965] (-290.055) (-292.516) (-290.212) * (-291.308) (-295.846) [-292.959] (-290.886) -- 0:00:32
Average standard deviation of split frequencies: 0.013707
736000 -- (-294.130) (-295.084) (-289.358) [-292.886] * (-291.539) [-294.269] (-290.493) (-292.076) -- 0:00:31
737000 -- (-290.939) (-292.342) [-292.877] (-290.001) * (-292.010) [-292.020] (-290.156) (-291.542) -- 0:00:31
738000 -- (-294.788) [-292.417] (-290.579) (-293.404) * (-290.890) (-290.541) (-292.726) [-289.871] -- 0:00:31
739000 -- (-291.543) [-289.424] (-291.807) (-290.460) * (-289.676) (-289.881) [-292.278] (-290.245) -- 0:00:31
740000 -- (-289.518) [-291.250] (-292.351) (-295.760) * [-291.060] (-292.077) (-291.772) (-289.806) -- 0:00:31
Average standard deviation of split frequencies: 0.012729
741000 -- (-291.171) (-292.155) [-291.246] (-297.903) * (-291.929) (-290.151) (-293.975) [-293.596] -- 0:00:31
742000 -- [-290.486] (-290.637) (-292.271) (-289.869) * (-290.358) [-293.068] (-295.023) (-291.262) -- 0:00:31
743000 -- (-289.326) [-291.311] (-290.708) (-294.606) * [-290.751] (-291.947) (-291.852) (-289.969) -- 0:00:31
744000 -- (-293.499) (-290.036) (-291.005) [-291.265] * (-291.433) (-290.787) (-290.535) [-289.947] -- 0:00:30
745000 -- (-291.429) (-293.872) (-290.102) [-294.985] * (-292.540) (-290.337) (-291.344) [-291.118] -- 0:00:30
Average standard deviation of split frequencies: 0.012322
746000 -- [-291.017] (-294.569) (-290.914) (-289.900) * (-289.855) (-290.036) [-292.657] (-291.962) -- 0:00:30
747000 -- (-293.203) [-292.750] (-291.146) (-288.898) * (-290.083) (-290.498) [-289.888] (-291.789) -- 0:00:30
748000 -- (-290.957) [-291.392] (-293.260) (-292.044) * (-294.135) (-290.146) [-289.743] (-293.435) -- 0:00:30
749000 -- [-290.633] (-292.101) (-290.006) (-292.339) * (-293.401) [-293.218] (-291.644) (-288.962) -- 0:00:30
750000 -- (-292.128) [-290.663] (-292.229) (-290.643) * (-290.223) (-290.993) (-291.316) [-292.711] -- 0:00:30
Average standard deviation of split frequencies: 0.012036
751000 -- (-289.322) (-291.096) [-293.069] (-290.789) * [-289.930] (-291.494) (-292.247) (-292.215) -- 0:00:30
752000 -- (-290.075) (-292.866) (-294.263) [-292.805] * (-292.899) (-289.750) (-291.081) [-292.128] -- 0:00:30
753000 -- (-289.133) [-293.843] (-295.662) (-292.820) * [-289.810] (-289.668) (-291.068) (-292.618) -- 0:00:29
754000 -- [-289.662] (-292.109) (-290.410) (-290.509) * (-291.339) [-292.819] (-289.220) (-289.365) -- 0:00:29
755000 -- [-290.032] (-289.554) (-292.751) (-289.846) * (-291.165) (-292.077) (-294.430) [-291.949] -- 0:00:29
Average standard deviation of split frequencies: 0.011224
756000 -- (-292.120) [-289.275] (-289.964) (-298.194) * (-292.648) (-291.399) (-292.099) [-289.682] -- 0:00:29
757000 -- (-292.072) (-292.585) [-292.237] (-289.616) * (-293.326) (-293.760) [-292.200] (-293.192) -- 0:00:29
758000 -- (-292.408) (-290.269) [-292.786] (-292.976) * (-293.117) (-295.312) (-291.720) [-289.387] -- 0:00:29
759000 -- (-291.796) (-297.805) [-291.045] (-290.962) * (-292.278) (-293.674) [-292.177] (-295.581) -- 0:00:29
760000 -- (-291.378) (-295.763) [-292.289] (-290.068) * [-290.300] (-290.545) (-292.390) (-293.311) -- 0:00:29
Average standard deviation of split frequencies: 0.012023
761000 -- (-288.997) (-290.891) [-292.374] (-293.006) * (-290.883) (-291.298) (-290.914) [-290.241] -- 0:00:28
762000 -- (-291.065) [-292.860] (-290.261) (-292.627) * (-291.716) (-290.653) (-292.673) [-290.520] -- 0:00:28
763000 -- [-293.552] (-289.338) (-289.525) (-290.569) * [-291.615] (-291.418) (-293.812) (-291.600) -- 0:00:28
764000 -- (-294.269) (-290.641) (-292.128) [-289.421] * [-290.521] (-293.481) (-292.625) (-292.525) -- 0:00:28
765000 -- [-289.823] (-290.728) (-289.320) (-290.632) * [-290.026] (-289.486) (-292.321) (-292.438) -- 0:00:28
Average standard deviation of split frequencies: 0.011283
766000 -- (-294.147) [-290.761] (-290.531) (-292.796) * (-291.691) (-293.242) (-291.573) [-296.017] -- 0:00:28
767000 -- (-292.649) [-292.134] (-291.650) (-290.584) * (-290.353) (-292.394) [-291.511] (-292.896) -- 0:00:28
768000 -- (-290.607) [-290.079] (-295.107) (-291.394) * (-296.181) (-291.414) (-291.901) [-289.089] -- 0:00:28
769000 -- (-298.335) [-289.680] (-294.243) (-293.310) * (-292.652) [-289.435] (-292.263) (-292.506) -- 0:00:27
770000 -- (-292.651) (-290.471) (-293.332) [-291.822] * (-290.629) [-291.952] (-292.032) (-289.810) -- 0:00:27
Average standard deviation of split frequencies: 0.011867
771000 -- (-292.367) [-292.385] (-291.354) (-292.599) * (-296.442) [-290.759] (-290.444) (-290.815) -- 0:00:27
772000 -- (-294.036) (-290.019) (-290.682) [-291.405] * [-292.594] (-289.168) (-291.060) (-289.865) -- 0:00:27
773000 -- [-291.026] (-289.983) (-294.974) (-291.922) * (-291.541) (-293.356) (-291.591) [-291.182] -- 0:00:27
774000 -- (-292.835) (-292.592) (-294.017) [-289.822] * (-292.511) (-290.337) (-290.968) [-290.199] -- 0:00:27
775000 -- [-291.685] (-289.257) (-292.943) (-292.100) * (-291.791) (-290.942) (-295.083) [-295.855] -- 0:00:27
Average standard deviation of split frequencies: 0.011137
776000 -- (-291.398) [-290.029] (-291.067) (-291.870) * (-290.493) [-289.035] (-289.266) (-293.432) -- 0:00:27
777000 -- (-289.361) (-291.825) (-289.745) [-291.957] * (-293.120) [-290.632] (-292.873) (-293.433) -- 0:00:26
778000 -- [-293.720] (-292.453) (-290.020) (-292.680) * [-289.798] (-289.640) (-293.194) (-297.089) -- 0:00:26
779000 -- [-289.840] (-289.926) (-290.547) (-293.206) * [-290.587] (-290.377) (-295.248) (-292.203) -- 0:00:26
780000 -- (-289.763) (-292.188) (-292.046) [-290.428] * (-291.718) [-289.190] (-289.426) (-290.307) -- 0:00:26
Average standard deviation of split frequencies: 0.010869
781000 -- (-289.302) (-297.343) [-293.225] (-293.520) * [-291.741] (-293.338) (-289.256) (-292.674) -- 0:00:26
782000 -- (-290.478) (-291.084) [-291.883] (-289.840) * (-292.435) [-290.367] (-290.710) (-292.649) -- 0:00:26
783000 -- [-289.996] (-291.534) (-290.234) (-289.400) * [-293.294] (-291.100) (-290.052) (-292.339) -- 0:00:26
784000 -- (-291.080) (-290.260) [-290.424] (-289.817) * [-291.058] (-289.525) (-290.689) (-290.056) -- 0:00:26
785000 -- [-292.763] (-293.622) (-291.496) (-289.718) * [-290.316] (-295.072) (-289.707) (-292.524) -- 0:00:26
Average standard deviation of split frequencies: 0.010076
786000 -- [-290.025] (-289.916) (-289.112) (-292.804) * [-293.143] (-292.335) (-294.589) (-290.571) -- 0:00:25
787000 -- (-289.503) (-289.752) (-292.838) [-289.891] * (-294.693) (-293.602) [-290.141] (-291.137) -- 0:00:25
788000 -- (-290.070) [-292.621] (-290.272) (-290.737) * [-291.306] (-292.133) (-293.117) (-296.574) -- 0:00:25
789000 -- (-289.400) (-289.370) (-290.055) [-289.511] * (-289.714) (-292.346) (-292.144) [-291.729] -- 0:00:25
790000 -- [-290.908] (-297.558) (-292.011) (-292.390) * [-290.305] (-290.401) (-293.406) (-291.785) -- 0:00:25
Average standard deviation of split frequencies: 0.010016
791000 -- (-291.645) (-290.888) [-291.046] (-289.476) * (-290.192) [-290.558] (-291.649) (-290.924) -- 0:00:25
792000 -- (-294.582) (-290.330) [-289.879] (-291.542) * (-291.925) (-293.118) (-291.184) [-291.011] -- 0:00:25
793000 -- (-290.720) (-289.911) [-293.682] (-290.596) * [-290.869] (-292.668) (-290.935) (-291.273) -- 0:00:25
794000 -- [-289.679] (-292.834) (-291.185) (-291.659) * (-290.144) (-293.918) (-293.345) [-290.209] -- 0:00:24
795000 -- (-290.294) [-290.047] (-290.089) (-291.948) * [-292.579] (-294.966) (-289.679) (-291.257) -- 0:00:24
Average standard deviation of split frequencies: 0.010216
796000 -- (-291.779) (-294.128) [-289.787] (-289.713) * (-292.343) (-290.266) [-291.266] (-289.119) -- 0:00:24
797000 -- (-292.962) (-290.142) [-290.070] (-292.838) * [-290.143] (-291.020) (-295.122) (-291.996) -- 0:00:24
798000 -- (-293.965) (-291.739) [-290.690] (-290.535) * (-290.019) [-290.315] (-289.513) (-292.292) -- 0:00:24
799000 -- (-291.172) (-291.885) (-291.849) [-289.478] * [-293.438] (-289.583) (-292.731) (-293.345) -- 0:00:24
800000 -- (-291.655) (-289.169) (-290.751) [-292.583] * (-290.763) (-292.074) (-297.225) [-294.155] -- 0:00:24
Average standard deviation of split frequencies: 0.010009
801000 -- (-292.352) (-291.296) [-290.354] (-292.163) * (-290.204) [-290.285] (-292.803) (-290.640) -- 0:00:24
802000 -- (-291.600) [-289.960] (-289.673) (-290.858) * (-289.993) (-289.916) (-289.364) [-289.703] -- 0:00:23
803000 -- [-293.561] (-291.969) (-291.806) (-293.398) * (-291.532) [-291.360] (-290.419) (-291.609) -- 0:00:23
804000 -- (-291.385) (-290.359) (-291.356) [-291.255] * [-290.894] (-292.063) (-292.148) (-293.531) -- 0:00:23
805000 -- (-291.916) [-292.893] (-289.326) (-293.184) * (-293.213) (-290.142) [-290.126] (-290.875) -- 0:00:23
Average standard deviation of split frequencies: 0.010411
806000 -- (-289.432) [-290.368] (-290.652) (-289.681) * (-290.768) [-291.440] (-289.895) (-290.054) -- 0:00:23
807000 -- (-291.691) [-290.260] (-292.993) (-289.554) * (-289.697) (-290.878) [-290.121] (-291.287) -- 0:00:23
808000 -- (-292.948) (-290.881) (-292.741) [-292.695] * (-292.072) [-292.146] (-291.329) (-291.131) -- 0:00:23
809000 -- [-291.769] (-294.017) (-293.411) (-292.260) * (-291.178) (-291.007) (-291.511) [-289.632] -- 0:00:23
810000 -- (-291.977) (-293.361) (-291.374) [-292.641] * (-290.825) (-291.523) (-289.847) [-289.879] -- 0:00:22
Average standard deviation of split frequencies: 0.011339
811000 -- (-294.590) (-290.101) (-292.379) [-290.261] * (-289.749) [-292.371] (-293.796) (-297.321) -- 0:00:22
812000 -- (-292.732) (-290.177) (-292.283) [-292.049] * (-290.207) (-290.148) [-289.337] (-290.360) -- 0:00:22
813000 -- (-290.113) [-289.223] (-293.319) (-296.989) * (-290.751) [-291.333] (-291.788) (-290.534) -- 0:00:22
814000 -- [-289.378] (-290.520) (-290.974) (-290.594) * (-294.256) (-289.831) [-289.795] (-294.302) -- 0:00:22
815000 -- (-294.560) (-294.756) (-289.608) [-290.858] * (-296.576) [-292.068] (-291.722) (-292.351) -- 0:00:22
Average standard deviation of split frequencies: 0.012324
816000 -- (-290.866) (-294.908) [-290.099] (-289.777) * (-291.501) (-291.199) [-290.014] (-292.371) -- 0:00:22
817000 -- (-290.368) (-291.531) [-291.000] (-290.620) * (-289.928) (-291.707) (-293.113) [-291.946] -- 0:00:22
818000 -- (-291.160) [-290.561] (-290.494) (-293.302) * (-292.474) [-289.640] (-290.066) (-293.109) -- 0:00:22
819000 -- [-296.278] (-289.987) (-289.847) (-291.878) * (-291.831) (-290.649) [-291.727] (-290.468) -- 0:00:21
820000 -- [-289.966] (-289.897) (-293.084) (-289.653) * (-290.491) [-290.569] (-293.268) (-292.239) -- 0:00:21
Average standard deviation of split frequencies: 0.012446
821000 -- (-291.679) (-295.691) (-290.684) [-289.141] * [-291.647] (-290.950) (-289.796) (-289.794) -- 0:00:21
822000 -- [-290.861] (-291.695) (-291.580) (-291.875) * (-293.177) (-292.799) (-291.443) [-292.185] -- 0:00:21
823000 -- (-291.647) (-292.260) (-291.740) [-292.068] * (-291.568) (-291.162) (-293.522) [-291.740] -- 0:00:21
824000 -- (-291.049) [-289.956] (-290.155) (-289.625) * (-296.056) (-293.748) (-292.027) [-293.238] -- 0:00:21
825000 -- (-290.283) (-289.077) [-292.872] (-290.000) * (-291.004) [-290.739] (-291.140) (-290.443) -- 0:00:21
Average standard deviation of split frequencies: 0.011985
826000 -- (-293.321) (-292.310) (-290.367) [-291.419] * [-289.116] (-294.050) (-292.438) (-290.843) -- 0:00:21
827000 -- [-293.937] (-290.110) (-291.129) (-290.381) * (-290.554) (-290.088) (-290.069) [-292.910] -- 0:00:20
828000 -- (-293.894) [-290.433] (-291.316) (-293.007) * (-290.143) (-292.158) (-291.352) [-289.947] -- 0:00:20
829000 -- [-291.398] (-292.410) (-290.862) (-293.217) * [-290.974] (-291.678) (-289.168) (-291.397) -- 0:00:20
830000 -- (-292.584) (-293.662) [-291.054] (-290.777) * [-292.143] (-291.740) (-290.525) (-292.912) -- 0:00:20
Average standard deviation of split frequencies: 0.011728
831000 -- (-289.690) (-290.258) (-292.799) [-290.465] * [-290.159] (-292.540) (-290.695) (-289.914) -- 0:00:20
832000 -- (-291.767) (-290.244) [-293.306] (-293.154) * (-291.446) [-290.075] (-290.408) (-294.721) -- 0:00:20
833000 -- (-294.565) (-291.780) [-299.322] (-291.297) * (-291.355) (-292.236) (-293.365) [-294.294] -- 0:00:20
834000 -- (-297.327) (-289.143) [-290.295] (-290.544) * (-291.567) (-289.651) [-292.005] (-290.911) -- 0:00:20
835000 -- (-293.606) (-291.323) [-292.993] (-294.161) * (-291.704) (-290.294) [-294.157] (-291.731) -- 0:00:19
Average standard deviation of split frequencies: 0.011466
836000 -- (-292.006) [-292.464] (-290.192) (-289.523) * (-289.269) (-289.682) [-289.801] (-292.634) -- 0:00:19
837000 -- [-289.896] (-294.264) (-295.411) (-293.273) * [-294.676] (-290.309) (-291.422) (-292.196) -- 0:00:19
838000 -- (-291.237) (-294.604) (-289.846) [-292.639] * (-289.056) [-292.016] (-289.697) (-291.630) -- 0:00:19
839000 -- (-291.280) (-295.166) [-292.241] (-292.213) * (-290.269) [-291.372] (-293.140) (-289.408) -- 0:00:19
840000 -- (-291.182) (-290.519) [-291.197] (-292.108) * (-291.738) (-290.220) [-289.135] (-292.185) -- 0:00:19
Average standard deviation of split frequencies: 0.010654
841000 -- (-292.830) (-289.193) [-292.044] (-292.136) * [-292.487] (-290.440) (-290.827) (-295.541) -- 0:00:19
842000 -- (-290.569) [-289.715] (-294.481) (-293.367) * (-293.241) (-294.084) (-292.480) [-289.148] -- 0:00:19
843000 -- (-296.917) [-289.507] (-292.080) (-292.368) * (-291.085) [-292.829] (-292.609) (-292.391) -- 0:00:18
844000 -- (-291.943) [-289.557] (-290.704) (-290.084) * (-290.205) (-291.203) (-293.813) [-289.601] -- 0:00:18
845000 -- (-289.620) [-291.183] (-292.030) (-292.553) * (-290.679) (-290.809) [-289.587] (-290.994) -- 0:00:18
Average standard deviation of split frequencies: 0.010959
846000 -- (-289.999) [-289.519] (-289.803) (-293.382) * (-291.964) (-292.898) (-291.799) [-289.710] -- 0:00:18
847000 -- (-296.910) [-291.422] (-291.937) (-293.839) * [-291.318] (-290.682) (-290.945) (-290.515) -- 0:00:18
848000 -- (-295.100) (-290.677) (-290.839) [-292.563] * [-293.152] (-293.532) (-290.179) (-292.592) -- 0:00:18
849000 -- (-293.475) (-291.777) [-292.636] (-290.276) * (-291.913) (-292.312) (-291.248) [-290.563] -- 0:00:18
850000 -- [-292.526] (-292.918) (-299.000) (-290.126) * (-290.109) [-291.710] (-291.542) (-290.848) -- 0:00:18
Average standard deviation of split frequencies: 0.009790
851000 -- (-292.381) [-289.622] (-290.145) (-292.417) * (-290.269) [-291.318] (-290.648) (-293.458) -- 0:00:18
852000 -- (-293.321) (-290.247) (-290.495) [-291.265] * (-291.284) (-290.580) [-290.325] (-289.804) -- 0:00:17
853000 -- (-291.206) (-291.419) [-291.492] (-290.116) * (-293.917) [-290.980] (-292.020) (-289.717) -- 0:00:17
854000 -- (-295.785) [-292.215] (-290.047) (-291.206) * (-289.796) [-291.392] (-292.801) (-289.567) -- 0:00:17
855000 -- (-291.517) (-291.675) [-290.709] (-291.518) * [-292.621] (-290.383) (-293.274) (-292.587) -- 0:00:17
Average standard deviation of split frequencies: 0.009913
856000 -- (-293.836) (-291.935) [-290.061] (-290.473) * (-291.733) [-289.802] (-294.369) (-291.826) -- 0:00:17
857000 -- [-290.917] (-291.211) (-291.533) (-294.887) * (-291.875) [-289.876] (-290.982) (-290.433) -- 0:00:17
858000 -- (-290.333) [-291.243] (-291.128) (-291.189) * (-293.455) (-289.121) [-289.398] (-289.894) -- 0:00:17
859000 -- (-291.230) (-289.924) [-290.208] (-291.638) * (-290.796) (-292.747) [-290.516] (-290.614) -- 0:00:17
860000 -- (-290.412) [-290.380] (-290.929) (-292.514) * [-293.490] (-291.324) (-289.554) (-290.713) -- 0:00:16
Average standard deviation of split frequencies: 0.009859
861000 -- (-292.264) (-291.205) [-297.133] (-290.378) * [-289.688] (-292.883) (-289.763) (-290.311) -- 0:00:16
862000 -- (-289.710) (-290.662) (-294.543) [-289.548] * (-290.940) (-290.590) (-291.282) [-291.911] -- 0:00:16
863000 -- (-290.991) [-292.421] (-291.385) (-291.362) * [-290.516] (-290.632) (-293.175) (-298.266) -- 0:00:16
864000 -- (-294.932) [-290.795] (-292.121) (-292.870) * (-290.399) [-291.253] (-291.668) (-293.100) -- 0:00:16
865000 -- (-289.575) (-292.754) [-289.290] (-291.384) * (-291.168) (-291.310) [-289.432] (-290.769) -- 0:00:16
Average standard deviation of split frequencies: 0.009526
866000 -- (-289.375) (-290.080) (-291.687) [-294.660] * (-291.368) [-290.807] (-292.263) (-290.670) -- 0:00:16
867000 -- [-290.579] (-299.870) (-292.581) (-289.946) * [-296.458] (-290.039) (-290.371) (-290.669) -- 0:00:16
868000 -- (-289.801) (-291.061) (-290.354) [-289.788] * (-290.925) (-290.965) [-291.604] (-296.738) -- 0:00:15
869000 -- (-289.880) [-290.042] (-292.615) (-292.723) * [-290.272] (-292.183) (-290.879) (-289.315) -- 0:00:15
870000 -- [-291.500] (-290.885) (-291.115) (-290.166) * [-293.914] (-290.401) (-290.425) (-291.712) -- 0:00:15
Average standard deviation of split frequencies: 0.009926
871000 -- (-290.236) [-290.114] (-292.812) (-289.864) * (-294.017) (-291.363) (-290.099) [-290.893] -- 0:00:15
872000 -- (-294.621) (-290.975) (-290.506) [-291.499] * (-293.510) [-290.544] (-294.205) (-290.280) -- 0:00:15
873000 -- (-292.060) [-290.888] (-290.549) (-290.181) * (-292.833) [-292.980] (-290.898) (-289.602) -- 0:00:15
874000 -- (-295.752) (-291.036) [-289.405] (-291.853) * [-293.451] (-289.736) (-290.014) (-289.759) -- 0:00:15
875000 -- (-290.966) (-291.010) (-290.294) [-289.903] * (-291.691) (-290.037) [-289.143] (-293.546) -- 0:00:15
Average standard deviation of split frequencies: 0.010045
876000 -- (-290.876) (-289.952) (-292.274) [-290.960] * [-289.050] (-291.467) (-290.359) (-289.716) -- 0:00:15
877000 -- (-294.835) (-291.504) (-291.483) [-291.817] * [-290.804] (-291.991) (-291.164) (-294.275) -- 0:00:14
878000 -- (-291.735) (-290.045) (-293.104) [-291.385] * (-293.652) [-290.549] (-290.312) (-292.675) -- 0:00:14
879000 -- (-292.338) [-290.540] (-294.048) (-292.097) * (-292.623) (-289.143) (-291.033) [-289.598] -- 0:00:14
880000 -- [-289.445] (-294.268) (-290.431) (-290.789) * (-292.307) (-289.344) (-294.113) [-290.451] -- 0:00:14
Average standard deviation of split frequencies: 0.010349
881000 -- [-291.147] (-291.071) (-289.974) (-293.490) * [-294.174] (-289.807) (-293.093) (-291.539) -- 0:00:14
882000 -- (-290.877) (-290.353) [-291.426] (-289.281) * [-289.401] (-290.797) (-289.978) (-296.455) -- 0:00:14
883000 -- (-290.413) (-289.837) [-289.373] (-291.442) * (-293.960) [-289.628] (-289.695) (-290.397) -- 0:00:14
884000 -- (-289.228) (-289.652) [-290.087] (-290.324) * (-291.165) [-290.245] (-291.615) (-293.357) -- 0:00:14
885000 -- [-289.558] (-291.924) (-295.613) (-295.002) * [-293.702] (-292.430) (-291.180) (-290.374) -- 0:00:13
Average standard deviation of split frequencies: 0.009045
886000 -- (-292.542) (-289.855) [-291.878] (-291.180) * (-291.831) [-293.021] (-290.802) (-290.053) -- 0:00:13
887000 -- (-289.792) [-290.615] (-290.750) (-291.724) * (-291.777) [-292.502] (-291.578) (-290.840) -- 0:00:13
888000 -- (-292.021) (-290.726) [-290.283] (-292.166) * (-290.148) (-290.890) (-290.426) [-289.836] -- 0:00:13
889000 -- (-296.130) (-291.806) [-289.755] (-296.846) * [-290.172] (-292.992) (-289.652) (-290.824) -- 0:00:13
890000 -- (-291.435) (-293.283) [-290.978] (-289.107) * (-290.784) (-293.727) (-292.940) [-291.067] -- 0:00:13
Average standard deviation of split frequencies: 0.010762
891000 -- (-290.223) (-291.694) [-295.599] (-289.862) * (-290.327) [-292.161] (-291.466) (-292.881) -- 0:00:13
892000 -- (-289.738) (-290.390) [-292.254] (-297.247) * (-289.753) [-290.633] (-289.649) (-292.263) -- 0:00:13
893000 -- (-289.462) (-292.397) [-294.094] (-291.417) * (-290.858) (-290.785) (-289.957) [-293.248] -- 0:00:12
894000 -- (-292.242) (-291.329) [-296.710] (-291.426) * (-297.130) (-292.460) (-294.893) [-290.062] -- 0:00:12
895000 -- (-291.898) (-290.109) [-296.056] (-291.075) * (-291.755) (-291.439) (-294.044) [-292.602] -- 0:00:12
Average standard deviation of split frequencies: 0.009733
896000 -- (-294.186) (-290.693) [-290.686] (-292.824) * (-290.947) (-291.036) (-292.573) [-293.042] -- 0:00:12
897000 -- (-291.401) (-289.744) [-289.886] (-291.135) * (-290.874) (-292.198) [-290.814] (-293.255) -- 0:00:12
898000 -- (-290.018) (-290.027) [-289.480] (-291.292) * (-291.587) [-292.945] (-296.037) (-294.529) -- 0:00:12
899000 -- (-293.302) (-290.661) [-289.872] (-291.847) * (-293.580) (-293.200) [-292.054] (-291.589) -- 0:00:12
900000 -- (-292.576) (-293.418) [-296.448] (-290.963) * (-290.941) (-294.222) (-290.902) [-289.438] -- 0:00:12
Average standard deviation of split frequencies: 0.009945
901000 -- (-290.509) (-291.045) [-294.682] (-290.476) * (-293.765) [-291.224] (-303.300) (-292.800) -- 0:00:11
902000 -- (-295.319) (-292.303) [-292.077] (-289.300) * (-290.038) [-289.067] (-293.926) (-290.440) -- 0:00:11
903000 -- (-290.260) (-293.924) [-291.452] (-289.523) * (-290.944) [-290.142] (-291.923) (-290.365) -- 0:00:11
904000 -- (-292.147) (-291.177) [-291.098] (-292.972) * [-289.639] (-291.875) (-289.792) (-295.408) -- 0:00:11
905000 -- (-290.057) (-290.001) [-292.697] (-289.929) * (-290.593) (-290.388) [-290.145] (-289.142) -- 0:00:11
Average standard deviation of split frequencies: 0.009886
906000 -- (-289.614) (-292.215) [-292.668] (-290.807) * [-291.586] (-292.955) (-289.857) (-290.787) -- 0:00:11
907000 -- (-295.494) (-291.869) [-291.776] (-291.865) * [-290.159] (-291.527) (-290.243) (-292.541) -- 0:00:11
908000 -- (-294.221) (-293.341) [-293.052] (-294.307) * [-291.029] (-290.791) (-290.540) (-289.270) -- 0:00:11
909000 -- (-291.548) (-295.008) [-292.006] (-294.132) * (-290.764) (-292.036) [-290.505] (-293.082) -- 0:00:11
910000 -- (-290.159) (-292.872) [-296.484] (-291.065) * (-292.281) (-291.597) [-291.684] (-294.147) -- 0:00:10
Average standard deviation of split frequencies: 0.010094
911000 -- (-292.045) (-290.608) [-291.063] (-294.624) * (-289.947) (-290.545) [-291.033] (-290.010) -- 0:00:10
912000 -- (-290.286) (-290.113) [-294.519] (-292.332) * (-298.013) (-289.362) (-291.725) [-290.916] -- 0:00:10
913000 -- (-290.062) (-291.852) [-290.243] (-290.903) * (-293.638) (-292.211) [-294.580] (-291.401) -- 0:00:10
914000 -- (-292.585) (-290.408) (-291.094) [-290.920] * (-292.407) (-296.108) (-289.257) [-294.221] -- 0:00:10
915000 -- (-291.645) (-290.556) (-289.334) [-292.483] * (-289.746) [-289.147] (-291.419) (-292.817) -- 0:00:10
Average standard deviation of split frequencies: 0.010035
916000 -- (-289.552) (-291.718) (-291.528) [-290.371] * [-291.430] (-289.857) (-293.698) (-289.851) -- 0:00:10
917000 -- (-294.250) [-290.081] (-290.866) (-292.160) * (-290.300) (-298.905) [-291.231] (-289.993) -- 0:00:10
918000 -- (-291.615) (-291.170) (-289.984) [-294.491] * (-290.413) (-290.935) (-292.196) [-290.494] -- 0:00:09
919000 -- (-292.725) [-294.102] (-290.313) (-293.279) * (-290.541) (-290.014) (-291.042) [-290.205] -- 0:00:09
920000 -- (-290.309) (-290.543) (-291.699) [-290.717] * (-291.170) [-290.225] (-290.920) (-290.843) -- 0:00:09
Average standard deviation of split frequencies: 0.010923
921000 -- (-290.242) [-289.492] (-291.401) (-297.504) * (-291.613) (-290.855) (-295.685) [-291.321] -- 0:00:09
922000 -- [-293.779] (-291.248) (-289.487) (-293.692) * (-289.415) (-292.032) [-290.187] (-297.711) -- 0:00:09
923000 -- (-293.881) [-289.441] (-294.867) (-291.932) * [-291.053] (-290.399) (-293.007) (-288.923) -- 0:00:09
924000 -- (-290.310) (-289.855) (-290.341) [-290.342] * (-290.963) [-293.661] (-289.946) (-290.405) -- 0:00:09
925000 -- (-291.282) (-292.550) (-289.612) [-290.284] * (-289.976) (-290.798) (-292.178) [-290.467] -- 0:00:09
Average standard deviation of split frequencies: 0.011200
926000 -- (-290.017) (-291.823) [-290.907] (-292.308) * (-291.816) (-292.540) [-292.387] (-289.702) -- 0:00:08
927000 -- (-290.094) [-292.570] (-289.792) (-289.645) * (-291.228) (-290.274) (-291.394) [-290.994] -- 0:00:08
928000 -- (-295.302) [-289.513] (-292.868) (-294.237) * [-290.264] (-291.068) (-290.244) (-292.037) -- 0:00:08
929000 -- (-291.640) [-291.165] (-292.342) (-293.411) * (-289.566) [-293.284] (-291.231) (-290.838) -- 0:00:08
930000 -- (-291.623) (-290.370) (-291.445) [-291.515] * (-291.094) (-293.440) (-291.215) [-292.787] -- 0:00:08
Average standard deviation of split frequencies: 0.010764
931000 -- (-292.669) (-290.283) (-290.181) [-290.490] * (-289.286) (-292.613) [-290.217] (-290.216) -- 0:00:08
932000 -- (-292.667) (-291.393) (-289.755) [-290.840] * (-293.506) [-289.517] (-289.681) (-297.191) -- 0:00:08
933000 -- (-296.560) (-293.001) (-292.492) [-291.800] * (-290.022) (-290.018) (-292.466) [-289.611] -- 0:00:08
934000 -- (-292.735) (-297.802) [-291.302] (-290.623) * [-289.496] (-291.353) (-291.403) (-292.463) -- 0:00:07
935000 -- (-296.380) [-290.749] (-291.825) (-290.114) * [-295.443] (-291.471) (-290.048) (-293.506) -- 0:00:07
Average standard deviation of split frequencies: 0.010828
936000 -- [-291.477] (-289.604) (-290.528) (-297.590) * (-290.074) (-291.312) (-295.376) [-291.498] -- 0:00:07
937000 -- (-292.099) (-289.551) (-290.654) [-290.346] * (-291.951) (-290.947) [-292.809] (-292.137) -- 0:00:07
938000 -- (-291.323) (-292.147) (-289.307) [-292.588] * (-290.555) [-290.475] (-290.388) (-289.680) -- 0:00:07
939000 -- (-294.404) [-290.482] (-290.370) (-291.569) * (-291.769) (-289.705) [-289.416] (-290.418) -- 0:00:07
940000 -- (-290.326) (-289.769) (-290.425) [-293.435] * (-292.513) (-291.093) (-292.544) [-294.474] -- 0:00:07
Average standard deviation of split frequencies: 0.010900
941000 -- (-291.399) (-290.795) [-289.298] (-290.669) * (-294.788) [-289.996] (-292.400) (-295.356) -- 0:00:07
942000 -- (-290.248) (-289.398) (-291.902) [-289.735] * (-292.563) (-291.611) [-289.448] (-293.728) -- 0:00:07
943000 -- (-289.464) (-289.930) [-289.603] (-289.753) * (-290.618) (-297.399) [-292.235] (-291.999) -- 0:00:06
944000 -- [-290.847] (-289.059) (-298.293) (-294.028) * (-290.964) (-290.714) (-291.222) [-290.718] -- 0:00:06
945000 -- [-290.144] (-290.192) (-289.796) (-293.045) * (-289.879) (-292.698) (-292.236) [-291.252] -- 0:00:06
Average standard deviation of split frequencies: 0.011960
946000 -- (-290.414) (-291.383) [-291.023] (-293.686) * (-291.029) [-290.121] (-289.811) (-289.499) -- 0:00:06
947000 -- [-289.547] (-293.423) (-291.769) (-291.057) * (-291.362) (-291.146) (-291.940) [-292.630] -- 0:00:06
948000 -- [-290.367] (-290.790) (-292.802) (-292.005) * [-292.368] (-293.768) (-289.982) (-289.909) -- 0:00:06
949000 -- (-292.691) (-291.066) (-294.342) [-291.329] * (-290.155) (-296.145) (-293.309) [-290.360] -- 0:00:06
950000 -- (-291.616) (-290.830) (-289.366) [-293.097] * [-293.532] (-293.985) (-293.115) (-290.026) -- 0:00:06
Average standard deviation of split frequencies: 0.011033
951000 -- (-289.537) [-290.306] (-291.354) (-293.850) * (-290.488) [-291.530] (-293.258) (-289.603) -- 0:00:05
952000 -- [-291.645] (-290.970) (-289.290) (-293.456) * (-289.256) (-297.851) [-291.778] (-290.965) -- 0:00:05
953000 -- (-295.031) (-294.762) [-290.706] (-289.490) * (-292.675) (-291.741) [-291.150] (-290.367) -- 0:00:05
954000 -- (-293.795) [-290.557] (-292.782) (-291.076) * (-293.927) (-290.396) [-292.016] (-291.958) -- 0:00:05
955000 -- (-292.849) [-295.605] (-289.586) (-290.887) * (-290.931) (-289.855) [-294.683] (-293.815) -- 0:00:05
Average standard deviation of split frequencies: 0.010848
956000 -- (-290.065) (-293.978) [-291.399] (-290.811) * (-291.239) (-293.759) [-291.285] (-289.434) -- 0:00:05
957000 -- [-293.111] (-291.522) (-290.464) (-290.725) * (-292.421) (-292.959) [-289.570] (-293.943) -- 0:00:05
958000 -- (-291.147) (-293.121) (-290.374) [-293.097] * (-291.331) [-290.785] (-289.124) (-292.624) -- 0:00:05
959000 -- [-289.876] (-298.116) (-296.290) (-291.086) * [-289.636] (-294.551) (-290.902) (-291.574) -- 0:00:04
960000 -- (-293.640) [-293.106] (-291.911) (-290.553) * [-293.721] (-291.325) (-293.938) (-290.589) -- 0:00:04
Average standard deviation of split frequencies: 0.011450
961000 -- [-290.613] (-289.784) (-289.191) (-290.017) * (-289.898) (-293.803) [-292.565] (-293.144) -- 0:00:04
962000 -- (-290.776) [-290.639] (-290.822) (-293.904) * (-288.935) (-291.081) [-290.387] (-290.350) -- 0:00:04
963000 -- (-291.404) (-291.311) (-291.716) [-290.706] * [-293.081] (-291.251) (-293.586) (-290.663) -- 0:00:04
964000 -- (-289.788) [-291.249] (-295.460) (-289.690) * (-291.345) (-291.238) [-293.208] (-291.845) -- 0:00:04
965000 -- (-290.208) (-291.410) [-296.537] (-289.859) * (-290.487) [-291.664] (-293.159) (-296.740) -- 0:00:04
Average standard deviation of split frequencies: 0.010614
966000 -- (-291.713) (-290.201) [-291.570] (-293.852) * (-292.141) (-293.705) (-298.678) [-292.370] -- 0:00:04
967000 -- (-294.221) [-291.908] (-298.292) (-291.406) * (-294.077) [-290.650] (-292.096) (-290.999) -- 0:00:03
968000 -- (-292.373) (-292.334) [-290.488] (-293.544) * (-294.067) [-291.215] (-291.887) (-292.501) -- 0:00:03
969000 -- [-292.170] (-292.459) (-291.663) (-293.268) * (-300.532) (-291.053) (-291.033) [-291.768] -- 0:00:03
970000 -- (-290.585) (-292.332) (-291.518) [-293.414] * (-291.291) (-290.413) (-290.075) [-291.532] -- 0:00:03
Average standard deviation of split frequencies: 0.010393
971000 -- (-291.382) (-290.259) (-297.354) [-289.246] * (-291.046) (-291.698) (-293.522) [-291.252] -- 0:00:03
972000 -- (-290.060) (-292.055) (-293.485) [-289.820] * (-289.677) (-291.611) (-299.524) [-289.688] -- 0:00:03
973000 -- (-289.800) (-291.442) [-289.508] (-295.091) * (-292.235) [-293.696] (-289.422) (-291.015) -- 0:00:03
974000 -- (-290.474) [-291.049] (-291.092) (-291.938) * (-296.169) (-291.551) (-289.713) [-289.701] -- 0:00:03
975000 -- (-295.078) [-292.318] (-291.001) (-294.365) * [-290.241] (-291.258) (-292.604) (-289.581) -- 0:00:03
Average standard deviation of split frequencies: 0.011028
976000 -- (-289.959) (-291.547) [-292.840] (-291.005) * (-290.432) (-292.433) (-290.013) [-292.373] -- 0:00:02
977000 -- [-289.644] (-295.668) (-292.332) (-289.770) * [-290.255] (-291.896) (-292.913) (-291.846) -- 0:00:02
978000 -- (-294.850) [-293.688] (-289.743) (-291.862) * [-291.044] (-289.818) (-293.605) (-291.025) -- 0:00:02
979000 -- (-290.243) (-289.384) (-289.186) [-289.865] * (-293.295) [-289.487] (-290.114) (-290.581) -- 0:00:02
980000 -- [-292.273] (-289.670) (-292.941) (-294.015) * (-293.374) [-290.772] (-291.322) (-293.355) -- 0:00:02
Average standard deviation of split frequencies: 0.011377
981000 -- (-289.675) (-289.900) [-289.223] (-292.691) * (-291.850) [-289.503] (-290.185) (-298.557) -- 0:00:02
982000 -- (-290.538) (-292.222) (-298.282) [-292.247] * (-292.155) [-292.174] (-294.958) (-293.865) -- 0:00:02
983000 -- [-290.592] (-290.426) (-292.167) (-290.644) * (-290.734) (-290.708) [-291.169] (-292.362) -- 0:00:02
984000 -- (-294.344) (-290.019) [-290.913] (-291.184) * (-292.628) (-289.756) [-292.627] (-290.300) -- 0:00:01
985000 -- (-294.443) [-290.106] (-289.720) (-294.638) * (-290.922) (-291.773) [-292.153] (-291.185) -- 0:00:01
Average standard deviation of split frequencies: 0.011283
986000 -- (-290.843) (-290.224) (-294.023) [-291.046] * [-291.043] (-291.486) (-293.468) (-289.267) -- 0:00:01
987000 -- (-291.605) (-291.925) [-290.048] (-291.224) * (-289.285) [-291.264] (-290.206) (-290.574) -- 0:00:01
988000 -- (-290.543) (-291.255) (-290.367) [-289.529] * (-294.062) (-291.659) (-290.927) [-292.197] -- 0:00:01
989000 -- (-289.752) (-293.086) (-290.229) [-290.877] * [-292.789] (-300.684) (-292.313) (-290.392) -- 0:00:01
990000 -- (-291.079) (-289.997) (-293.913) [-291.552] * [-295.383] (-291.701) (-296.012) (-295.207) -- 0:00:01
Average standard deviation of split frequencies: 0.011420
991000 -- [-293.930] (-290.119) (-294.231) (-293.245) * (-290.076) (-289.424) [-290.076] (-289.707) -- 0:00:01
992000 -- [-289.212] (-290.489) (-294.491) (-292.058) * (-289.475) (-292.937) [-290.461] (-289.423) -- 0:00:00
993000 -- (-290.637) (-293.491) [-291.578] (-290.369) * [-289.927] (-293.381) (-295.326) (-294.558) -- 0:00:00
994000 -- (-292.728) (-289.521) (-291.593) [-291.061] * (-292.600) [-290.147] (-293.244) (-291.240) -- 0:00:00
995000 -- [-292.863] (-290.804) (-291.161) (-297.113) * [-292.889] (-289.712) (-291.413) (-293.455) -- 0:00:00
Average standard deviation of split frequencies: 0.011832
996000 -- [-293.061] (-292.752) (-290.725) (-292.822) * (-290.442) [-290.173] (-290.734) (-291.587) -- 0:00:00
997000 -- (-293.746) [-290.757] (-292.571) (-291.102) * (-295.180) (-291.345) [-290.408] (-291.152) -- 0:00:00
998000 -- [-292.706] (-292.081) (-290.088) (-293.452) * (-292.145) [-290.594] (-291.841) (-289.963) -- 0:00:00
999000 -- [-289.705] (-290.904) (-291.204) (-290.393) * [-290.004] (-294.527) (-291.627) (-290.317) -- 0:00:00
1000000 -- (-290.903) (-290.578) [-290.945] (-292.670) * (-293.210) [-290.507] (-290.699) (-294.033) -- 0:00:00
Average standard deviation of split frequencies: 0.012719
Analysis completed in 2 mins 1 seconds
Analysis used 120.20 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -288.88
Likelihood of best state for "cold" chain of run 2 was -288.88
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.4 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
46.7 % ( 39 %) Dirichlet(Pi{all})
43.0 % ( 28 %) Slider(Pi{all})
80.9 % ( 67 %) Multiplier(Alpha{1,2})
80.8 % ( 65 %) Multiplier(Alpha{3})
35.1 % ( 26 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
98.3 % ( 99 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
93.3 % ( 93 %) ParsSPR(Tau{all},V{all})
27.8 % ( 32 %) Multiplier(V{all})
96.8 % ( 98 %) Nodeslider(V{all})
40.8 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
46.5 % ( 37 %) Dirichlet(Pi{all})
44.0 % ( 24 %) Slider(Pi{all})
81.0 % ( 47 %) Multiplier(Alpha{1,2})
80.5 % ( 59 %) Multiplier(Alpha{3})
33.9 % ( 34 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
98.3 % ( 99 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
93.1 % ( 93 %) ParsSPR(Tau{all},V{all})
28.0 % ( 22 %) Multiplier(V{all})
96.7 % ( 97 %) Nodeslider(V{all})
41.2 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.39 0.16 0.07
2 | 166745 0.55 0.30
3 | 166231 167224 0.66
4 | 166376 166304 167120
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.36 0.15 0.07
2 | 165826 0.58 0.32
3 | 167251 166293 0.66
4 | 167176 166963 166491
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -290.66
| 1 1 2 2 2 1 |
|1 * 1 1 |
| 22 2 2 2 2 1 2 * 2 22 |
| 1 1 22 11 2 211 22 * 2 1 2 1 1 1 |
| 1 211 2 2 121 2 2 22 2 2 |
| 1 221 2 21 21 11 11 12 2* 1 2|
|2 *1 111 21 1 1 12 2 |
| 2 22 * 2 1 1 2 22 1|
| 1 2 * 1 |
| 2 11 1 2 1 1 |
| 1 |
| |
| |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -292.62
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -290.58 -294.71
2 -290.55 -293.07
--------------------------------------
TOTAL -290.57 -294.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 8.803618 97.945221 0.000004 28.539790 5.756821 243.91 381.41 1.000
r(A<->C){all} 0.155064 0.016987 0.000004 0.419258 0.122201 191.94 239.33 1.000
r(A<->G){all} 0.161628 0.018658 0.000103 0.432568 0.125444 101.82 150.70 1.000
r(A<->T){all} 0.178465 0.023202 0.000001 0.486067 0.134419 105.69 123.61 1.005
r(C<->G){all} 0.163775 0.019277 0.000006 0.440523 0.124338 131.07 185.38 1.003
r(C<->T){all} 0.174810 0.021618 0.000313 0.470862 0.138058 109.91 174.30 1.000
r(G<->T){all} 0.166259 0.018852 0.000046 0.430731 0.133882 139.48 192.46 1.002
pi(A){all} 0.283943 0.000843 0.224475 0.339072 0.283198 1091.33 1282.11 1.001
pi(C){all} 0.122505 0.000448 0.082847 0.164546 0.121574 1231.58 1298.53 1.000
pi(G){all} 0.178791 0.000650 0.127935 0.229106 0.178006 1084.02 1170.00 1.001
pi(T){all} 0.414761 0.001030 0.350167 0.474762 0.414714 1005.24 1068.80 1.000
alpha{1,2} 0.914205 0.990830 0.000316 2.812838 0.601827 1016.32 1108.77 1.000
alpha{3} 0.960329 1.011446 0.000666 3.012459 0.641850 1106.19 1137.09 1.002
pinvar{all} 0.966101 0.011349 0.711975 0.999996 0.995926 15.69 31.20 1.003
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- ..*....*
10 -- ...*.*..
11 -- ......**
12 -- ...**...
13 -- ....*..*
14 -- ..*..*..
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 293 0.097602 0.013662 0.087941 0.107262 2
10 288 0.095936 0.011306 0.087941 0.103931 2
11 286 0.095270 0.010364 0.087941 0.102598 2
12 286 0.095270 0.008480 0.089274 0.101266 2
13 274 0.091272 0.016959 0.079280 0.103264 2
14 271 0.090273 0.015546 0.079280 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.659077 1.389973 0.000000 2.859086 0.235254 1.000 2
length{all}[2] 0.678453 1.751568 0.000000 2.844491 0.230260 1.001 2
length{all}[3] 0.659042 1.190724 0.000000 2.799411 0.253375 1.000 2
length{all}[4] 0.688589 1.427345 0.000000 2.980286 0.258735 1.000 2
length{all}[5] 0.706212 1.653615 0.000000 2.936837 0.247081 1.001 2
length{all}[6] 0.686299 1.405345 0.000000 2.788765 0.245001 1.000 2
length{all}[7] 0.669012 1.405719 0.000000 2.634347 0.238642 1.000 2
length{all}[8] 0.680604 1.501884 0.000000 2.752583 0.245079 1.000 2
length{all}[9] 0.759698 2.766930 0.000002 3.586239 0.220681 1.010 2
length{all}[10] 0.631122 0.785174 0.000005 2.515160 0.269706 0.997 2
length{all}[11] 0.706692 1.102784 0.000001 3.224757 0.265425 0.997 2
length{all}[12] 0.651211 0.960627 0.000002 2.570928 0.313361 0.997 2
length{all}[13] 0.715040 1.346517 0.000000 3.132344 0.200470 0.997 2
length{all}[14] 0.659498 1.047043 0.000001 2.294079 0.290029 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.012719
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
|
|------------------------------------------------------------------------ C4 (4)
+
|------------------------------------------------------------------------ C5 (5)
|
|------------------------------------------------------------------------ C6 (6)
|
|------------------------------------------------------------------------ C7 (7)
|
\------------------------------------------------------------------------ C8 (8)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
|
|------------------------------------------------------------------------ C4 (4)
+
|--------------------------------------------------------------------- C5 (5)
|
|-------------------------------------------------------------------- C6 (6)
|
|------------------------------------------------------------------ C7 (7)
|
\-------------------------------------------------------------------- C8 (8)
|------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (2624 trees sampled):
50 % credible set contains 1123 trees
90 % credible set contains 2324 trees
95 % credible set contains 2474 trees
99 % credible set contains 2594 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Thu Oct 20 00:46:20 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=8, Len=75
C1 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C2 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C3 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C4 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C5 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C6 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C7 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C8 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
**************************************************
C1 YVPVYSAYVMYKNFMQIDPCPVIDV
C2 YVPVYSAYVMYKNFMQIDPCPVIDV
C3 YVPVYSAYVMYKNFMQIDPCPVIDV
C4 YVPVYSAYVMYKNFMQIDPCPVIDV
C5 YVPVYSAYVMYKNFMQIDPCPVIDV
C6 YVPVYSAYVMYKNFMQIDPCPVIDV
C7 YVPVYSAYVMYKNFMQIDPCPVIDV
C8 YVPVYSAYVMYKNFMQIDPCPVIDV
*************************
-- Starting log on Thu Oct 20 01:04:19 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/codeml,175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 225 sites
reading seq# 2 C2 225 sites
reading seq# 3 C3 225 sites
reading seq# 4 C4 225 sites
reading seq# 5 C5 225 sites
reading seq# 6 C6 225 sites
reading seq# 7 C7 225 sites
reading seq# 8 C8 225 sitesns = 8 ls = 225
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Sequences read..
Counting site patterns.. 0:00
Compressing, 33 patterns at 75 / 75 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 33 patterns at 75 / 75 sites (100.0%), 0:00
Counting codons..
224 bytes for distance
32208 bytes for conP
2904 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6, 7, 8); MP score: 0
0.033928 0.091211 0.047974 0.048735 0.099804 0.068761 0.073204 0.031281 0.300000 0.798248 0.173998
ntime & nrate & np: 8 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.466517
np = 11
lnL0 = -309.222665
Iterating by ming2
Initial: fx= 309.222665
x= 0.03393 0.09121 0.04797 0.04874 0.09980 0.06876 0.07320 0.03128 0.30000 0.79825 0.17400
1 h-m-p 0.0000 0.0005 166.6010 +++ 294.069138 m 0.0005 17 | 1/11
2 h-m-p 0.0000 0.0000 307.1535 ++ 292.840895 m 0.0000 31 | 2/11
3 h-m-p 0.0000 0.0001 459.1049 ++ 287.606335 m 0.0001 45 | 3/11
4 h-m-p 0.0000 0.0000 301.4778 ++ 287.352661 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0001 884.0705 ++ 281.973970 m 0.0001 73 | 5/11
6 h-m-p 0.0000 0.0000 977.8607 ++ 281.008192 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0000 8431.2767 ++ 278.283535 m 0.0000 101 | 7/11
8 h-m-p 0.0000 0.0000 2396.9404 ++ 277.851262 m 0.0000 115 | 8/11
9 h-m-p 0.0006 0.0030 11.1191 ++ 277.579550 m 0.0030 129 | 9/11
10 h-m-p 1.6000 8.0000 0.0003 ++ 277.579549 m 8.0000 143 | 9/11
11 h-m-p 0.0129 4.2854 0.1966 ----------Y 277.579549 0 0.0000 169 | 9/11
12 h-m-p 0.0160 8.0000 0.0071 +++++ 277.579509 m 8.0000 188 | 9/11
13 h-m-p 0.2587 4.1740 0.2190 -------------C 277.579509 0 0.0000 217 | 9/11
14 h-m-p 0.0160 8.0000 0.0009 +++++ 277.579503 m 8.0000 236 | 9/11
15 h-m-p 0.0438 5.2920 0.1707 ------------C 277.579503 0 0.0000 264 | 9/11
16 h-m-p 0.0160 8.0000 0.0003 -------Y 277.579503 0 0.0000 287 | 9/11
17 h-m-p 0.0160 8.0000 0.0002 -------------.. | 9/11
18 h-m-p 0.0160 8.0000 0.0009 +++++ 277.579496 m 8.0000 333 | 9/11
19 h-m-p 0.0425 5.4640 0.1669 --------------.. | 9/11
20 h-m-p 0.0160 8.0000 0.0009 +++++ 277.579489 m 8.0000 380 | 9/11
21 h-m-p 0.0454 5.6244 0.1635 -------------C 277.579489 0 0.0000 409 | 9/11
22 h-m-p 0.0160 8.0000 0.0110 +++++ 277.579377 m 8.0000 428 | 9/11
23 h-m-p 0.4610 5.5913 0.1913 ---------------N 277.579377 0 0.0000 459 | 9/11
24 h-m-p 0.0160 8.0000 0.0001 +++++ 277.579377 m 8.0000 478 | 9/11
25 h-m-p 0.0086 4.2784 0.1348 ------------C 277.579377 0 0.0000 506 | 9/11
26 h-m-p 0.0160 8.0000 0.0001 ---------Y 277.579377 0 0.0000 531 | 9/11
27 h-m-p 0.0160 8.0000 0.0000 +++++ 277.579377 m 8.0000 550 | 9/11
28 h-m-p 0.0140 7.0172 0.1243 ------------Y 277.579377 0 0.0000 578 | 9/11
29 h-m-p 0.0160 8.0000 0.0001 -------------.. | 9/11
30 h-m-p 0.0001 0.0326 0.0018 +++++ 277.579376 m 0.0326 624 | 10/11
31 h-m-p 0.0160 8.0000 0.0093 -------------.. | 10/11
32 h-m-p 0.0160 8.0000 0.0001 +++++ 277.579376 m 8.0000 669 | 10/11
33 h-m-p 0.0160 8.0000 0.9990 -------------.. | 10/11
34 h-m-p 0.0160 8.0000 0.0001 +++++ 277.579376 m 8.0000 713 | 10/11
35 h-m-p 0.0160 8.0000 0.9395 -----------Y 277.579376 0 0.0000 739 | 10/11
36 h-m-p 0.0160 8.0000 0.0000 +++++ 277.579376 m 8.0000 757 | 10/11
37 h-m-p 0.0160 8.0000 0.9574 -----------C 277.579376 0 0.0000 783 | 10/11
38 h-m-p 0.0160 8.0000 0.0000 ----C 277.579376 0 0.0000 802 | 10/11
39 h-m-p 0.0160 8.0000 0.0000 +++++ 277.579376 m 8.0000 820 | 10/11
40 h-m-p 0.0160 8.0000 0.9431 -----------C 277.579376 0 0.0000 846 | 10/11
41 h-m-p 0.0160 8.0000 0.0001 +++++ 277.579376 m 8.0000 864 | 10/11
42 h-m-p 0.0160 8.0000 1.1041 ------------C 277.579376 0 0.0000 891 | 10/11
43 h-m-p 0.0160 8.0000 0.0000 +++++ 277.579376 m 8.0000 908 | 10/11
44 h-m-p 0.0160 8.0000 0.0003 +++++ 277.579376 m 8.0000 926 | 10/11
45 h-m-p 0.0160 8.0000 0.9469 -----------C 277.579376 0 0.0000 952 | 10/11
46 h-m-p 0.0160 8.0000 0.0001 -------C 277.579376 0 0.0000 974 | 10/11
47 h-m-p 0.0160 8.0000 0.0000 +++++ 277.579376 m 8.0000 992 | 10/11
48 h-m-p 0.0008 0.3768 0.6942 +++++ 277.579338 m 0.3768 1010 | 11/11
49 h-m-p 0.0160 8.0000 0.0000 Y 277.579338 0 0.0160 1025 | 11/11
50 h-m-p 0.0160 8.0000 0.0000 Y 277.579338 0 0.0160 1039
Out..
lnL = -277.579338
1040 lfun, 3120 eigenQcodon, 16640 P(t)
end of tree file.
Time used: 0:06
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6, 7, 8); MP score: 0
0.106054 0.053732 0.051176 0.013824 0.060992 0.085133 0.045374 0.030302 0.000100 1.061636 0.556996 0.329129 1.391478
ntime & nrate & np: 8 3 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.517218
np = 13
lnL0 = -308.041341
Iterating by ming2
Initial: fx= 308.041341
x= 0.10605 0.05373 0.05118 0.01382 0.06099 0.08513 0.04537 0.03030 0.00011 1.06164 0.55700 0.32913 1.39148
1 h-m-p 0.0000 0.0000 180.9589 ++ 307.780986 m 0.0000 18 | 1/13
2 h-m-p 0.0000 0.0006 129.9982 +++ 300.387783 m 0.0006 35 | 2/13
3 h-m-p 0.0002 0.0010 43.1460 ++ 293.802755 m 0.0010 51 | 3/13
4 h-m-p 0.0020 0.0108 19.8347 ++ 285.457570 m 0.0108 67 | 4/13
5 h-m-p 0.0000 0.0001 367.3431 ++ 283.411531 m 0.0001 83 | 5/13
6 h-m-p 0.0001 0.0003 136.1431 ++ 282.568329 m 0.0003 99 | 6/13
7 h-m-p 0.0000 0.0001 506.0260 ++ 281.159088 m 0.0001 115 | 7/13
8 h-m-p 0.0000 0.0001 1186.5684 ++ 280.077246 m 0.0001 131 | 8/13
9 h-m-p 0.0077 0.2558 6.4687 -------------.. | 8/13
10 h-m-p 0.0000 0.0002 97.3421 ++ 278.568317 m 0.0002 174 | 9/13
11 h-m-p 0.0035 0.4995 3.0565 ------------.. | 9/13
12 h-m-p 0.0000 0.0002 70.3244 +++ 277.579650 m 0.0002 217 | 10/13
13 h-m-p 0.7048 8.0000 0.0000 ++ 277.579650 m 8.0000 233 | 10/13
14 h-m-p 0.0160 8.0000 0.0100 +++++ 277.579649 m 8.0000 255 | 10/13
15 h-m-p 0.0396 8.0000 2.0189 --------------.. | 10/13
16 h-m-p 0.0160 8.0000 0.0001 +++++ 277.579649 m 8.0000 305 | 10/13
17 h-m-p 0.0008 0.4218 0.8084 +++++ 277.579619 m 0.4218 327 | 11/13
18 h-m-p 0.1955 8.0000 1.5266 --------------Y 277.579619 0 0.0000 360 | 11/13
19 h-m-p 0.0042 2.0845 53.3264 ++++Y 277.579338 0 1.0672 380 | 11/13
20 h-m-p 1.6000 8.0000 0.0000 Y 277.579338 0 1.6000 396 | 11/13
21 h-m-p 0.0160 8.0000 0.0000 Y 277.579338 0 0.0160 414
Out..
lnL = -277.579338
415 lfun, 1660 eigenQcodon, 9960 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -277.606747 S = -277.579890 -0.010319
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 33 patterns 0:09
did 20 / 33 patterns 0:09
did 30 / 33 patterns 0:09
did 33 / 33 patterns 0:09end of tree file.
Time used: 0:09
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6, 7, 8); MP score: 0
0.029131 0.098157 0.019937 0.072797 0.053692 0.098789 0.051827 0.091540 0.000100 0.724535 1.086388
ntime & nrate & np: 8 1 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 12.983657
np = 11
lnL0 = -311.219353
Iterating by ming2
Initial: fx= 311.219353
x= 0.02913 0.09816 0.01994 0.07280 0.05369 0.09879 0.05183 0.09154 0.00011 0.72453 1.08639
1 h-m-p 0.0000 0.0000 169.3667 ++ 311.117240 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0072 43.4473 +++++ 299.662020 m 0.0072 33 | 2/11
3 h-m-p 0.0001 0.0003 73.5972 ++ 298.203070 m 0.0003 47 | 3/11
4 h-m-p 0.0000 0.0004 552.0042 ++ 292.685674 m 0.0004 61 | 4/11
5 h-m-p 0.0000 0.0001 651.4093 ++ 291.509227 m 0.0001 75 | 5/11
6 h-m-p 0.0000 0.0001 1214.2052 ++ 287.360934 m 0.0001 89 | 6/11
7 h-m-p 0.0001 0.0007 116.9111 ++ 285.338065 m 0.0007 103 | 7/11
8 h-m-p 0.0006 0.0032 17.9025 ++ 284.310689 m 0.0032 117 | 8/11
9 h-m-p 0.0092 0.0461 4.5020 -------------.. | 8/11
10 h-m-p 0.0000 0.0010 79.2040 ++++ 277.956498 m 0.0010 158 | 9/11
11 h-m-p 0.0919 8.0000 0.5846 --------------.. | 9/11
12 h-m-p 0.0000 0.0001 61.3582 ++ 277.579338 m 0.0001 200 | 10/11
13 h-m-p 1.6000 8.0000 0.0000 ++ 277.579338 m 8.0000 214 | 10/11
14 h-m-p 1.6000 8.0000 0.0000 --N 277.579338 0 0.0250 231
Out..
lnL = -277.579338
232 lfun, 2552 eigenQcodon, 18560 P(t)
end of tree file.
Time used: 0:15
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6, 7, 8); MP score: 0
0.085674 0.016823 0.054858 0.021306 0.100625 0.099700 0.025349 0.077962 0.000100 0.900000 0.200607 1.896143 1.300000
ntime & nrate & np: 8 2 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.588724
np = 13
lnL0 = -304.187820
Iterating by ming2
Initial: fx= 304.187820
x= 0.08567 0.01682 0.05486 0.02131 0.10063 0.09970 0.02535 0.07796 0.00011 0.90000 0.20061 1.89614 1.30000
1 h-m-p 0.0000 0.0000 132.6406 ++ 304.156175 m 0.0000 18 | 1/13
2 h-m-p 0.0000 0.0004 178.3542 +++ 297.612068 m 0.0004 35 | 2/13
3 h-m-p 0.0000 0.0002 78.1138 ++ 295.886224 m 0.0002 51 | 3/13
4 h-m-p 0.0001 0.0003 129.9271 ++ 294.156718 m 0.0003 67 | 4/13
5 h-m-p 0.0001 0.0006 193.2218 ++ 287.300491 m 0.0006 83 | 5/13
6 h-m-p 0.0000 0.0001 396.7149 ++ 286.482040 m 0.0001 99 | 6/13
7 h-m-p 0.0008 0.0141 10.6461 +++ 285.273211 m 0.0141 116 | 7/13
8 h-m-p 0.0000 0.0002 53.8491 ++ 284.701335 m 0.0002 132 | 8/13
9 h-m-p 0.0009 0.0254 12.7771 +++ 283.379516 m 0.0254 149 | 9/13
10 h-m-p 0.0182 0.0911 6.2764 -------------.. | 9/13
11 h-m-p 0.0000 0.0020 49.6004 ++++ 277.579528 m 0.0020 194 | 10/13
12 h-m-p 1.6000 8.0000 0.0001 ++ 277.579528 m 8.0000 210 | 10/13
13 h-m-p 0.0042 2.1067 5.6140 ------------.. | 10/13
14 h-m-p 0.0160 8.0000 0.0013 +++++ 277.579514 m 8.0000 258 | 10/13
15 h-m-p 0.0949 8.0000 0.1098 --------------.. | 10/13
16 h-m-p 0.0160 8.0000 0.0014 +++++ 277.579496 m 8.0000 311 | 10/13
17 h-m-p 0.1098 8.0000 0.1048 --------------N 277.579496 0 0.0000 344 | 10/13
18 h-m-p 0.0160 8.0000 0.0040 +++++ 277.579446 m 8.0000 366 | 10/13
19 h-m-p 0.2759 8.0000 0.1174 ---------------.. | 10/13
20 h-m-p 0.0160 8.0000 0.0022 +++++ 277.579402 m 8.0000 420 | 10/13
21 h-m-p 0.2048 8.0000 0.0862 ---------------.. | 10/13
22 h-m-p 0.0143 7.1466 0.0028 +++++ 277.579338 m 7.1466 474 | 11/13
23 h-m-p 1.6000 8.0000 0.0000 N 277.579338 0 0.8000 493 | 11/13
24 h-m-p 0.0247 8.0000 0.0000 -----N 277.579338 0 0.0000 516
Out..
lnL = -277.579338
517 lfun, 6204 eigenQcodon, 45496 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -277.614879 S = -277.579890 -0.015450
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 33 patterns 0:29
did 20 / 33 patterns 0:29
did 30 / 33 patterns 0:30
did 33 / 33 patterns 0:30end of tree file.
Time used: 0:30
The loglikelihoods for models M1, M2, M7 and M8 are -277.579338 -277.579338 -277.579338 -277.579338 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVM
183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVM
LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVM
SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVM
TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVM
TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVM
TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVM
TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVM
************************************************************
175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10 YKNFMQIDPCPVIDV
183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10 YKNFMQIDPCPVIDV
LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YKNFMQIDPCPVIDV
SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YKNFMQIDPCPVIDV
TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 YKNFMQIDPCPVIDV
TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 YKNFMQIDPCPVIDV
TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YKNFMQIDPCPVIDV
TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 YKNFMQIDPCPVIDV
***************
>175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC
>175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVMYKNFMQIDPCPVIDV >183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVMYKNFMQIDPCPVIDV >LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVMYKNFMQIDPCPVIDV >SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVMYKNFMQIDPCPVIDV >TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVMYKNFMQIDPCPVIDV >TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVMYKNFMQIDPCPVIDV >TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVMYKNFMQIDPCPVIDV >TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTIYVPVYSAYVMYKNFMQIDPCPVIDV
Reading sequence file /data//pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/codeml/fasta/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1 Found 8 sequences of length 225 Alignment looks like a valid DNA alignment. Estimated diversity is (pairwise deletion - ignoring missing/ambig): 0.0% Found 0 informative sites. Writing alignment of informative sites to: Phi.inf.sites Writing list of informative sites to: Phi.inf.list Calculating all pairwise incompatibilities... 100.0% Using a window size of 80 with k as 1 Too few informative sites to use normal approximation. Try doing a permutation test or increasing alignment length Can also try decreasing windowsize.
#NEXUS
[ID: 5405429103]
begin taxa;
dimensions ntax=8;
taxlabels
175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10
183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10
LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
end;
begin trees;
translate
1 175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
2 183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
3 LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
4 SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
5 TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10,
6 TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10,
7 TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
8 TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:2.352539e-01,2:2.302602e-01,3:2.533751e-01,4:2.587348e-01,5:2.470812e-01,6:2.450012e-01,7:2.386418e-01,8:2.450786e-01);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:2.352539e-01,2:2.302602e-01,3:2.533751e-01,4:2.587348e-01,5:2.470812e-01,6:2.450012e-01,7:2.386418e-01,8:2.450786e-01);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -290.58 -294.71
2 -290.55 -293.07
--------------------------------------
TOTAL -290.57 -294.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 8.803618 97.945221 0.000004 28.539790 5.756821 243.91 381.41 1.000
r(A<->C){all} 0.155064 0.016987 0.000004 0.419258 0.122201 191.94 239.33 1.000
r(A<->G){all} 0.161628 0.018658 0.000103 0.432568 0.125444 101.82 150.70 1.000
r(A<->T){all} 0.178465 0.023202 0.000001 0.486067 0.134419 105.69 123.61 1.005
r(C<->G){all} 0.163775 0.019277 0.000006 0.440523 0.124338 131.07 185.38 1.003
r(C<->T){all} 0.174810 0.021618 0.000313 0.470862 0.138058 109.91 174.30 1.000
r(G<->T){all} 0.166259 0.018852 0.000046 0.430731 0.133882 139.48 192.46 1.002
pi(A){all} 0.283943 0.000843 0.224475 0.339072 0.283198 1091.33 1282.11 1.001
pi(C){all} 0.122505 0.000448 0.082847 0.164546 0.121574 1231.58 1298.53 1.000
pi(G){all} 0.178791 0.000650 0.127935 0.229106 0.178006 1084.02 1170.00 1.001
pi(T){all} 0.414761 0.001030 0.350167 0.474762 0.414714 1005.24 1068.80 1.000
alpha{1,2} 0.914205 0.990830 0.000316 2.812838 0.601827 1016.32 1108.77 1.000
alpha{3} 0.960329 1.011446 0.000666 3.012459 0.641850 1106.19 1137.09 1.002
pinvar{all} 0.966101 0.011349 0.711975 0.999996 0.995926 15.69 31.20 1.003
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 8 ls = 75
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 4 4 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 2 2 2 2 2 2
Leu TTA 4 4 4 4 4 4 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 0 0 0 0 0 0
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 2 2 2 2 2 2
ATC 1 1 1 1 1 1 | ACC 0 0 0 0 0 0 | AAC 1 1 1 1 1 1 | AGC 1 1 1 1 1 1
ATA 2 2 2 2 2 2 | ACA 3 3 3 3 3 3 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 0 0 0 0 0 0 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 6 6 6 6 6 | Ala GCT 2 2 2 2 2 2 | Asp GAT 3 3 3 3 3 3 | Gly GGT 1 1 1 1 1 1
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 0 0 0 0 0 0 | GGC 0 0 0 0 0 0
GTA 2 2 2 2 2 2 | GCA 1 1 1 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 0 0 0 0 0 0
GTG 3 3 3 3 3 3 | GCG 0 0 0 0 0 0 | GAG 0 0 0 0 0 0 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------
Phe TTT 4 4 | Ser TCT 0 0 | Tyr TAT 4 4 | Cys TGT 1 1
TTC 0 0 | TCC 0 0 | TAC 0 0 | TGC 2 2
Leu TTA 4 4 | TCA 0 0 | *** TAA 0 0 | *** TGA 0 0
TTG 2 2 | TCG 0 0 | TAG 0 0 | Trp TGG 1 1
----------------------------------------------------------------------
Leu CTT 2 2 | Pro CCT 2 2 | His CAT 0 0 | Arg CGT 0 0
CTC 0 0 | CCC 0 0 | CAC 1 1 | CGC 0 0
CTA 2 2 | CCA 1 1 | Gln CAA 2 2 | CGA 0 0
CTG 0 0 | CCG 0 0 | CAG 0 0 | CGG 0 0
----------------------------------------------------------------------
Ile ATT 5 5 | Thr ACT 1 1 | Asn AAT 3 3 | Ser AGT 2 2
ATC 1 1 | ACC 0 0 | AAC 1 1 | AGC 1 1
ATA 2 2 | ACA 3 3 | Lys AAA 2 2 | Arg AGA 0 0
Met ATG 6 6 | ACG 0 0 | AAG 1 1 | AGG 0 0
----------------------------------------------------------------------
Val GTT 6 6 | Ala GCT 2 2 | Asp GAT 3 3 | Gly GGT 1 1
GTC 1 1 | GCC 0 0 | GAC 0 0 | GGC 0 0
GTA 2 2 | GCA 1 1 | Glu GAA 0 0 | GGA 0 0
GTG 3 3 | GCG 0 0 | GAG 0 0 | GGG 0 0
----------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.24000 C:0.13333 A:0.37333 G:0.25333
position 2: T:0.53333 C:0.13333 A:0.22667 G:0.10667
position 3: T:0.48000 C:0.09333 A:0.25333 G:0.17333
Average T:0.41778 C:0.12000 A:0.28444 G:0.17778
#2: C2
position 1: T:0.24000 C:0.13333 A:0.37333 G:0.25333
position 2: T:0.53333 C:0.13333 A:0.22667 G:0.10667
position 3: T:0.48000 C:0.09333 A:0.25333 G:0.17333
Average T:0.41778 C:0.12000 A:0.28444 G:0.17778
#3: C3
position 1: T:0.24000 C:0.13333 A:0.37333 G:0.25333
position 2: T:0.53333 C:0.13333 A:0.22667 G:0.10667
position 3: T:0.48000 C:0.09333 A:0.25333 G:0.17333
Average T:0.41778 C:0.12000 A:0.28444 G:0.17778
#4: C4
position 1: T:0.24000 C:0.13333 A:0.37333 G:0.25333
position 2: T:0.53333 C:0.13333 A:0.22667 G:0.10667
position 3: T:0.48000 C:0.09333 A:0.25333 G:0.17333
Average T:0.41778 C:0.12000 A:0.28444 G:0.17778
#5: C5
position 1: T:0.24000 C:0.13333 A:0.37333 G:0.25333
position 2: T:0.53333 C:0.13333 A:0.22667 G:0.10667
position 3: T:0.48000 C:0.09333 A:0.25333 G:0.17333
Average T:0.41778 C:0.12000 A:0.28444 G:0.17778
#6: C6
position 1: T:0.24000 C:0.13333 A:0.37333 G:0.25333
position 2: T:0.53333 C:0.13333 A:0.22667 G:0.10667
position 3: T:0.48000 C:0.09333 A:0.25333 G:0.17333
Average T:0.41778 C:0.12000 A:0.28444 G:0.17778
#7: C7
position 1: T:0.24000 C:0.13333 A:0.37333 G:0.25333
position 2: T:0.53333 C:0.13333 A:0.22667 G:0.10667
position 3: T:0.48000 C:0.09333 A:0.25333 G:0.17333
Average T:0.41778 C:0.12000 A:0.28444 G:0.17778
#8: C8
position 1: T:0.24000 C:0.13333 A:0.37333 G:0.25333
position 2: T:0.53333 C:0.13333 A:0.22667 G:0.10667
position 3: T:0.48000 C:0.09333 A:0.25333 G:0.17333
Average T:0.41778 C:0.12000 A:0.28444 G:0.17778
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 32 | Ser S TCT 0 | Tyr Y TAT 32 | Cys C TGT 8
TTC 0 | TCC 0 | TAC 0 | TGC 16
Leu L TTA 32 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 16 | TCG 0 | TAG 0 | Trp W TGG 8
------------------------------------------------------------------------------
Leu L CTT 16 | Pro P CCT 16 | His H CAT 0 | Arg R CGT 0
CTC 0 | CCC 0 | CAC 8 | CGC 0
CTA 16 | CCA 8 | Gln Q CAA 16 | CGA 0
CTG 0 | CCG 0 | CAG 0 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 40 | Thr T ACT 8 | Asn N AAT 24 | Ser S AGT 16
ATC 8 | ACC 0 | AAC 8 | AGC 8
ATA 16 | ACA 24 | Lys K AAA 16 | Arg R AGA 0
Met M ATG 48 | ACG 0 | AAG 8 | AGG 0
------------------------------------------------------------------------------
Val V GTT 48 | Ala A GCT 16 | Asp D GAT 24 | Gly G GGT 8
GTC 8 | GCC 0 | GAC 0 | GGC 0
GTA 16 | GCA 8 | Glu E GAA 0 | GGA 0
GTG 24 | GCG 0 | GAG 0 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.24000 C:0.13333 A:0.37333 G:0.25333
position 2: T:0.53333 C:0.13333 A:0.22667 G:0.10667
position 3: T:0.48000 C:0.09333 A:0.25333 G:0.17333
Average T:0.41778 C:0.12000 A:0.28444 G:0.17778
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6, 7, 8); MP score: 0
lnL(ntime: 8 np: 11): -277.579338 +0.000000
9..1 9..2 9..3 9..4 9..5 9..6 9..7 9..8
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000032
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004, 7: 0.000004, 8: 0.000004);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C4: 0.000004, C5: 0.000004, C6: 0.000004, C7: 0.000004, C8: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..2 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..3 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..4 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..5 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..6 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..7 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..8 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6, 7, 8); MP score: 0
lnL(ntime: 8 np: 13): -277.579338 +0.000000
9..1 9..2 9..3 9..4 9..5 9..6 9..7 9..8
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000032
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004, 7: 0.000004, 8: 0.000004);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C4: 0.000004, C5: 0.000004, C6: 0.000004, C7: 0.000004, C8: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..2 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..3 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..4 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..5 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..6 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..7 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..8 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:09
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6, 7, 8); MP score: 0
lnL(ntime: 8 np: 11): -277.579338 +0.000000
9..1 9..2 9..3 9..4 9..5 9..6 9..7 9..8
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.916124
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000032
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004, 7: 0.000004, 8: 0.000004);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C4: 0.000004, C5: 0.000004, C6: 0.000004, C7: 0.000004, C8: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.91612
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..2 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..3 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..4 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..5 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..6 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..7 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..8 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:15
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6, 7, 8); MP score: 0
lnL(ntime: 8 np: 13): -277.579338 +0.000000
9..1 9..2 9..3 9..4 9..5 9..6 9..7 9..8
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 2.021738 1.773202
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000032
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004, 7: 0.000004, 8: 0.000004);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C4: 0.000004, C5: 0.000004, C6: 0.000004, C7: 0.000004, C8: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.02174
(p1 = 0.00001) w = 1.77320
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.77320
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..2 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..3 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..4 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..5 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..6 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..7 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
9..8 0.000 184.1 40.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:30
Model 1: NearlyNeutral -277.579338 Model 2: PositiveSelection -277.579338 Model 7: beta -277.579338 Model 8: beta&w>1 -277.579338 Model 2 vs 1 0 Model 8 vs 7 0
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
