--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1939.39 -1951.79
2 -1939.65 -1950.64
--------------------------------------
TOTAL -1939.51 -1951.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 9.359770 17.346309 3.801414 17.337440 8.299917 1042.03 1042.74 1.000
r(A<->C){all} 0.095462 0.001593 0.018056 0.172554 0.092652 574.10 606.93 1.007
r(A<->G){all} 0.289586 0.003011 0.184123 0.391569 0.287680 633.07 761.77 1.003
r(A<->T){all} 0.124411 0.001055 0.061570 0.188272 0.122730 750.69 756.81 1.000
r(C<->G){all} 0.215149 0.002679 0.117893 0.319172 0.212132 499.42 575.51 1.001
r(C<->T){all} 0.221506 0.001744 0.144979 0.303931 0.218476 653.69 790.97 1.000
r(G<->T){all} 0.053886 0.000855 0.001834 0.108546 0.050386 675.80 706.99 1.000
pi(A){all} 0.257980 0.000226 0.230808 0.289110 0.257683 1181.37 1245.02 1.000
pi(C){all} 0.224931 0.000208 0.198144 0.253001 0.224249 957.58 1049.73 1.000
pi(G){all} 0.169224 0.000170 0.143341 0.194449 0.168816 885.14 1080.63 1.000
pi(T){all} 0.347865 0.000292 0.313205 0.379268 0.347720 1020.78 1126.36 1.001
alpha{1,2} 0.449771 0.011952 0.262566 0.662106 0.437718 891.02 934.64 1.000
alpha{3} 3.548336 1.840352 1.231004 6.214059 3.342433 1045.30 1208.60 1.000
pinvar{all} 0.027413 0.000468 0.000003 0.069589 0.022549 1225.54 1292.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -1751.676216
Model 2: PositiveSelection -1751.676216
Model 7: beta -1750.075272
Model 8: beta&w>1 -1745.725326
Model 2 vs 1 0
Model 8 vs 7 8.699892
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
32 E 0.981* 1.480
51 N 0.970* 1.465
52 K 0.924 1.399
58 I 0.918 1.391
60 T 0.968* 1.461
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
32 E 0.640 3.499 +- 3.135
51 N 0.536 2.873 +- 2.934
52 K 0.623 3.252 +- 3.025
99 I 0.573 3.529 +- 3.519
-- Starting log on Thu Oct 27 00:04:00 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=6, Len=131
C1 MKIILFSILIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
C2 MRVVALLLLISPVFS--RQVFHYIDCVAGSSTTFGLPC-EGLIQTQSSVQ
C3 MRVILLLAVLYVALATSREVHHYIDCVRGTSRTLQLPC-DGTVESTTPVQ
C4 MRVLILLSLLSVALTAAPEIHHYIDCVRGTSTTILQPC-DGVIESTSPVQ
C5 MRVLLLLSLCAFALS--KEIHYYVDCISGTSTTVNQPC-DGVIESTSPVQ
C6 MKIILFLTLIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
*::: : : . ::.:* :*: *:: . ** .* : :..:
C1 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
C2 FVPDQQYGRVGVLCISNYVQTFRISCPHGN-HTFIIR-----STTYRTNV
C3 FTPDYAYGSIAVPC--NVVFQMRISCPLGN-YTYHVR-----PVSFRTHT
C4 FTPNTQYGSLAVSC--SLVTQIRISCPHGN-HTFHVR-----PVSFRTHT
C5 FTPNYAYGSLAVAC--NSVVQIRILCPRGN-YTFHIR-----PVSFRTHT
C6 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
.: : .: * : : *. *. :*: :* . : :
C1 KVYQELYSPLFLIVIALVFIILCFTIKRKIE
C2 RVTQPQSGDLMMLILCFLIILVLYVCLWR--
C3 RYSQPQGNELQCLIVFLLILIVFYLVFRRR-
C4 RYSQPQGNELQCLIVTLLIVIVLYLFFRRR-
C5 RYSQPQGNEVQCLVVTLLLVILLILLFRRR-
C6 KVYQELYSPLFLIVAALVFIILCFTIKRKIE
: * . : :: :::::: :
-- Starting log on Thu Oct 27 00:04:20 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=731, Nseq=6, Len=131
C1 MKIILFSILIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
C2 MRVVALLLLISPVFS--RQVFHYIDCVAGSSTTFGLPC-EGLIQTQSSVQ
C3 MRVILLLAVLYVALATSREVHHYIDCVRGTSRTLQLPC-DGTVESTTPVQ
C4 MRVLILLSLLSVALTAAPEIHHYIDCVRGTSTTILQPC-DGVIESTSPVQ
C5 MRVLLLLSLCAFALS--KEIHYYVDCISGTSTTVNQPC-DGVIESTSPVQ
C6 MKIILFLTLIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
*::: : : . ::.:* :*: *:: . ** .* : :..:
C1 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
C2 FVPDQQYGRVGVLCISNYVQTFRISCPHGN-HTFIIR-----STTYRTNV
C3 FTPDYAYGSIAVPC--NVVFQMRISCPLGN-YTYHVR-----PVSFRTHT
C4 FTPNTQYGSLAVSC--SLVTQIRISCPHGN-HTFHVR-----PVSFRTHT
C5 FTPNYAYGSLAVAC--NSVVQIRILCPRGN-YTFHIR-----PVSFRTHT
C6 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
.: : .: * : : *. *. :*: :* . : :
C1 KVYQELYSPLFLIVIALVFIILCFTIKRKIE
C2 RVTQPQSGDLMMLILCFLIILVLYVCLWR--
C3 RYSQPQGNELQCLIVFLLILIVFYLVFRRR-
C4 RYSQPQGNELQCLIVTLLIVIVLYLFFRRR-
C5 RYSQPQGNEVQCLVVTLLLVILLILLFRRR-
C6 KVYQELYSPLFLIVAALVFIILCFTIKRKIE
: * . : :: :::::: :
-- Starting log on Thu Oct 27 01:12:17 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/gapped_alignment/codeml,JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 393 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666833139
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 316395022
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2300683947
Seed = 804114621
Swapseed = 1666833139
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 80 unique site patterns
Division 2 has 57 unique site patterns
Division 3 has 103 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3262.431524 -- 21.927696
Chain 2 -- -3207.329083 -- 21.927696
Chain 3 -- -3257.973409 -- 21.927696
Chain 4 -- -3025.350364 -- 21.927696
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -3336.557556 -- 21.927696
Chain 2 -- -3269.045049 -- 21.927696
Chain 3 -- -3119.074897 -- 21.927696
Chain 4 -- -3277.633403 -- 21.927696
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3262.432] (-3207.329) (-3257.973) (-3025.350) * [-3336.558] (-3269.045) (-3119.075) (-3277.633)
1000 -- (-1957.537) [-1954.111] (-1961.327) (-1949.630) * [-1951.083] (-1953.810) (-1960.031) (-1947.482) -- 0:00:00
2000 -- (-1950.559) (-1942.921) [-1944.739] (-1942.224) * (-1942.368) (-1942.057) (-1945.694) [-1947.672] -- 0:00:00
3000 -- (-1949.045) (-1944.284) (-1936.677) [-1953.804] * (-1948.140) (-1939.262) [-1940.720] (-1945.690) -- 0:05:32
4000 -- (-1947.051) [-1944.469] (-1941.260) (-1945.643) * (-1944.071) [-1950.995] (-1938.492) (-1947.729) -- 0:04:09
5000 -- [-1950.139] (-1941.749) (-1947.060) (-1941.720) * (-1943.187) (-1945.090) (-1948.013) [-1942.657] -- 0:06:38
Average standard deviation of split frequencies: 0.094281
6000 -- [-1946.899] (-1941.230) (-1942.555) (-1943.390) * (-1944.752) (-1945.270) (-1946.046) [-1942.028] -- 0:05:31
7000 -- [-1944.552] (-1946.159) (-1944.899) (-1941.125) * (-1951.775) (-1938.880) [-1946.439] (-1941.513) -- 0:07:05
8000 -- [-1946.031] (-1942.953) (-1938.418) (-1940.675) * (-1955.055) [-1944.329] (-1943.738) (-1944.672) -- 0:06:12
9000 -- (-1948.862) (-1947.868) [-1948.445] (-1946.547) * (-1948.358) (-1952.341) (-1943.543) [-1941.952] -- 0:07:20
10000 -- [-1943.098] (-1953.303) (-1947.336) (-1951.014) * (-1947.876) (-1942.507) [-1944.742] (-1937.972) -- 0:06:36
Average standard deviation of split frequencies: 0.083478
11000 -- (-1944.684) [-1942.348] (-1946.588) (-1946.833) * (-1945.854) (-1945.134) [-1942.640] (-1938.783) -- 0:07:29
12000 -- [-1942.866] (-1941.349) (-1941.756) (-1949.482) * [-1952.131] (-1945.670) (-1952.811) (-1948.834) -- 0:06:51
13000 -- (-1946.066) (-1953.030) [-1942.004] (-1944.546) * (-1938.786) [-1939.440] (-1944.779) (-1944.063) -- 0:07:35
14000 -- (-1942.139) [-1945.955] (-1939.333) (-1955.145) * [-1945.050] (-1939.895) (-1945.804) (-1938.015) -- 0:07:02
15000 -- (-1948.419) (-1958.960) (-1941.851) [-1941.556] * (-1938.960) (-1939.538) [-1940.698] (-1950.023) -- 0:07:39
Average standard deviation of split frequencies: 0.084705
16000 -- [-1940.123] (-1948.319) (-1941.927) (-1941.032) * [-1943.971] (-1948.887) (-1939.118) (-1946.798) -- 0:07:10
17000 -- (-1943.046) (-1955.182) (-1938.888) [-1938.548] * (-1945.378) (-1942.340) (-1947.683) [-1946.226] -- 0:07:42
18000 -- (-1943.207) (-1951.939) (-1938.335) [-1944.430] * [-1941.255] (-1941.644) (-1950.463) (-1937.163) -- 0:07:16
19000 -- [-1940.094] (-1963.152) (-1940.557) (-1941.453) * [-1940.962] (-1943.885) (-1943.755) (-1946.627) -- 0:06:53
20000 -- (-1945.124) [-1941.158] (-1956.301) (-1938.621) * [-1942.810] (-1941.239) (-1947.774) (-1945.093) -- 0:07:21
Average standard deviation of split frequencies: 0.083636
21000 -- [-1954.205] (-1942.528) (-1943.129) (-1943.585) * [-1946.598] (-1944.711) (-1939.464) (-1946.258) -- 0:06:59
22000 -- (-1943.193) [-1939.847] (-1939.110) (-1946.641) * (-1943.548) (-1950.645) [-1943.489] (-1944.221) -- 0:07:24
23000 -- (-1956.555) [-1945.107] (-1948.156) (-1945.707) * (-1952.583) [-1938.713] (-1940.812) (-1947.729) -- 0:07:04
24000 -- (-1941.911) [-1939.243] (-1943.343) (-1941.993) * [-1943.087] (-1940.610) (-1945.149) (-1943.992) -- 0:07:27
25000 -- (-1944.890) (-1950.870) (-1942.351) [-1941.238] * (-1945.449) (-1939.071) (-1939.453) [-1936.051] -- 0:07:09
Average standard deviation of split frequencies: 0.080582
26000 -- [-1942.586] (-1945.773) (-1940.696) (-1948.185) * (-1946.531) [-1947.007] (-1944.715) (-1939.168) -- 0:07:29
27000 -- [-1947.187] (-1943.816) (-1944.016) (-1946.238) * [-1942.934] (-1943.945) (-1943.678) (-1947.727) -- 0:07:12
28000 -- (-1940.569) (-1942.306) [-1941.201] (-1943.699) * [-1946.295] (-1945.547) (-1948.496) (-1948.748) -- 0:07:31
29000 -- (-1946.515) [-1941.985] (-1940.394) (-1952.137) * (-1943.876) [-1940.792] (-1941.864) (-1943.628) -- 0:07:15
30000 -- (-1951.069) [-1942.238] (-1946.356) (-1937.363) * [-1944.268] (-1946.402) (-1942.889) (-1941.419) -- 0:07:32
Average standard deviation of split frequencies: 0.066612
31000 -- (-1940.155) (-1947.419) [-1943.150] (-1942.221) * (-1941.212) [-1947.344] (-1939.681) (-1946.209) -- 0:07:17
32000 -- [-1940.763] (-1947.806) (-1947.178) (-1963.014) * (-1940.125) (-1945.165) [-1936.824] (-1943.028) -- 0:07:33
33000 -- (-1941.467) (-1939.564) [-1947.995] (-1955.712) * (-1944.875) (-1949.023) [-1943.003] (-1951.307) -- 0:07:19
34000 -- (-1950.206) (-1940.163) (-1955.191) [-1941.635] * (-1944.539) (-1940.237) [-1946.461] (-1940.968) -- 0:07:34
35000 -- (-1949.822) (-1946.661) [-1941.180] (-1945.215) * (-1958.219) (-1948.246) [-1938.086] (-1950.912) -- 0:07:21
Average standard deviation of split frequencies: 0.081477
36000 -- (-1938.597) (-1945.571) (-1942.152) [-1940.390] * (-1942.330) (-1947.944) [-1942.990] (-1949.004) -- 0:07:08
37000 -- (-1948.061) (-1941.483) [-1943.057] (-1951.864) * [-1942.160] (-1950.407) (-1945.372) (-1947.916) -- 0:07:22
38000 -- (-1948.845) (-1941.004) [-1946.151] (-1948.028) * (-1942.473) [-1944.273] (-1950.545) (-1947.546) -- 0:07:10
39000 -- [-1940.358] (-1939.063) (-1947.210) (-1952.610) * [-1949.794] (-1947.406) (-1944.738) (-1944.917) -- 0:07:23
40000 -- [-1943.050] (-1942.528) (-1950.420) (-1942.892) * [-1939.663] (-1942.691) (-1951.100) (-1950.235) -- 0:07:12
Average standard deviation of split frequencies: 0.050232
41000 -- (-1940.249) (-1946.350) (-1942.390) [-1946.508] * [-1951.916] (-1947.877) (-1944.652) (-1947.489) -- 0:07:24
42000 -- [-1940.847] (-1945.711) (-1939.152) (-1946.780) * (-1943.650) (-1942.488) [-1944.002] (-1942.152) -- 0:07:13
43000 -- [-1940.146] (-1945.132) (-1942.393) (-1938.265) * (-1946.298) (-1948.132) (-1945.084) [-1940.790] -- 0:07:25
44000 -- (-1957.036) [-1945.649] (-1942.031) (-1938.995) * (-1948.336) (-1946.349) [-1947.490] (-1937.649) -- 0:07:14
45000 -- (-1941.210) (-1946.110) [-1941.711] (-1958.471) * (-1949.800) [-1938.112] (-1945.224) (-1942.317) -- 0:07:25
Average standard deviation of split frequencies: 0.040992
46000 -- (-1941.408) (-1950.934) [-1947.636] (-1952.301) * (-1952.778) (-1937.669) (-1943.369) [-1937.427] -- 0:07:15
47000 -- (-1948.440) (-1944.560) (-1950.212) [-1939.034] * (-1949.084) (-1942.812) [-1940.583] (-1939.992) -- 0:07:26
48000 -- [-1941.652] (-1939.319) (-1946.775) (-1942.751) * (-1945.965) (-1948.705) (-1948.975) [-1940.205] -- 0:07:16
49000 -- (-1942.607) (-1939.413) (-1937.703) [-1941.330] * (-1945.470) (-1946.646) [-1943.193] (-1939.343) -- 0:07:26
50000 -- (-1942.483) [-1944.207] (-1942.317) (-1948.798) * (-1942.722) [-1944.862] (-1946.055) (-1943.555) -- 0:07:17
Average standard deviation of split frequencies: 0.051172
51000 -- (-1948.556) (-1944.500) [-1936.687] (-1946.386) * (-1939.573) [-1947.729] (-1942.774) (-1939.997) -- 0:07:26
52000 -- (-1945.829) (-1949.309) [-1937.342] (-1940.221) * [-1940.228] (-1940.393) (-1947.013) (-1940.593) -- 0:07:17
53000 -- [-1942.662] (-1946.299) (-1944.236) (-1945.672) * [-1941.024] (-1945.135) (-1950.108) (-1953.963) -- 0:07:26
54000 -- (-1946.425) [-1950.445] (-1938.746) (-1945.400) * [-1942.730] (-1947.681) (-1946.149) (-1942.277) -- 0:07:17
55000 -- (-1946.493) (-1942.964) (-1937.946) [-1948.047] * (-1945.848) (-1936.646) [-1943.579] (-1945.926) -- 0:07:09
Average standard deviation of split frequencies: 0.050508
56000 -- [-1941.041] (-1944.230) (-1939.755) (-1942.319) * (-1949.824) [-1946.314] (-1942.121) (-1944.316) -- 0:07:18
57000 -- [-1942.358] (-1944.652) (-1947.671) (-1949.433) * (-1942.682) (-1943.699) [-1939.503] (-1944.165) -- 0:07:10
58000 -- (-1951.226) [-1943.494] (-1944.519) (-1941.737) * (-1950.370) (-1947.295) [-1941.627] (-1948.210) -- 0:07:18
59000 -- (-1949.108) (-1948.083) [-1945.032] (-1943.716) * [-1943.857] (-1951.650) (-1945.013) (-1947.258) -- 0:07:10
60000 -- (-1951.740) (-1949.836) [-1948.041] (-1941.389) * (-1952.867) (-1944.185) (-1942.881) [-1944.725] -- 0:07:18
Average standard deviation of split frequencies: 0.047594
61000 -- (-1942.701) (-1945.824) (-1950.362) [-1944.698] * (-1941.773) [-1942.589] (-1943.014) (-1941.529) -- 0:07:11
62000 -- (-1949.753) (-1953.500) (-1945.048) [-1943.111] * (-1949.766) [-1942.809] (-1939.227) (-1942.121) -- 0:07:18
63000 -- (-1949.496) [-1945.590] (-1941.613) (-1944.650) * [-1944.040] (-1948.080) (-1946.966) (-1958.348) -- 0:07:11
64000 -- (-1952.396) (-1942.085) (-1941.489) [-1944.800] * [-1947.586] (-1951.185) (-1944.285) (-1959.104) -- 0:07:18
65000 -- (-1945.976) (-1944.768) (-1945.540) [-1940.460] * [-1951.574] (-1941.882) (-1953.501) (-1949.626) -- 0:07:11
Average standard deviation of split frequencies: 0.045236
66000 -- (-1940.097) [-1939.694] (-1948.006) (-1941.847) * [-1947.276] (-1943.148) (-1943.272) (-1945.731) -- 0:07:18
67000 -- (-1946.279) (-1953.284) (-1946.823) [-1946.210] * [-1946.811] (-1941.743) (-1945.409) (-1946.441) -- 0:07:11
68000 -- [-1948.308] (-1944.965) (-1941.031) (-1939.393) * (-1945.836) (-1947.643) (-1948.026) [-1938.324] -- 0:07:18
69000 -- (-1947.108) (-1945.832) (-1940.238) [-1951.950] * (-1943.910) (-1943.502) [-1941.024] (-1948.221) -- 0:07:11
70000 -- (-1945.449) (-1946.166) [-1949.112] (-1950.200) * (-1946.664) (-1953.576) [-1940.164] (-1950.475) -- 0:07:18
Average standard deviation of split frequencies: 0.035022
71000 -- (-1944.235) [-1944.092] (-1943.891) (-1952.769) * (-1939.833) [-1943.828] (-1946.292) (-1944.290) -- 0:07:11
72000 -- (-1946.843) [-1949.262] (-1947.033) (-1952.086) * (-1944.134) [-1951.794] (-1947.231) (-1946.361) -- 0:07:18
73000 -- (-1946.148) (-1946.916) (-1946.864) [-1941.687] * (-1945.979) [-1944.240] (-1939.928) (-1943.390) -- 0:07:11
74000 -- (-1947.571) [-1948.748] (-1945.840) (-1942.194) * [-1946.270] (-1942.534) (-1946.128) (-1944.125) -- 0:07:17
75000 -- (-1951.341) [-1942.426] (-1943.873) (-1949.111) * (-1944.375) (-1941.281) (-1950.997) [-1943.571] -- 0:07:11
Average standard deviation of split frequencies: 0.028257
76000 -- (-1947.116) (-1946.635) (-1942.332) [-1944.808] * (-1939.098) (-1943.238) [-1947.996] (-1940.308) -- 0:07:05
77000 -- [-1943.658] (-1943.282) (-1945.533) (-1945.689) * (-1940.762) [-1943.666] (-1944.305) (-1939.284) -- 0:07:11
78000 -- (-1948.097) [-1939.694] (-1943.954) (-1943.448) * (-1944.376) [-1943.299] (-1941.026) (-1942.543) -- 0:07:05
79000 -- (-1948.108) [-1945.211] (-1948.764) (-1944.587) * (-1939.576) [-1942.351] (-1937.744) (-1945.056) -- 0:07:11
80000 -- (-1948.571) (-1943.655) [-1944.239] (-1952.887) * (-1940.538) [-1938.124] (-1946.584) (-1948.111) -- 0:07:05
Average standard deviation of split frequencies: 0.025567
81000 -- (-1941.381) (-1945.896) [-1942.141] (-1942.435) * (-1939.167) (-1942.409) [-1935.988] (-1955.400) -- 0:07:11
82000 -- (-1940.854) [-1935.639] (-1950.921) (-1949.031) * [-1946.749] (-1943.406) (-1945.291) (-1950.108) -- 0:07:05
83000 -- (-1942.602) (-1939.945) (-1944.772) [-1944.675] * (-1944.191) (-1938.113) (-1944.025) [-1943.722] -- 0:07:10
84000 -- (-1939.111) (-1945.823) (-1948.059) [-1944.039] * (-1947.765) (-1937.796) [-1939.838] (-1944.778) -- 0:07:05
85000 -- (-1943.727) [-1948.575] (-1945.057) (-1945.166) * (-1948.077) (-1941.221) [-1945.084] (-1945.961) -- 0:07:10
Average standard deviation of split frequencies: 0.021241
86000 -- (-1950.452) [-1939.728] (-1943.353) (-1944.804) * (-1948.737) (-1947.017) [-1942.065] (-1949.334) -- 0:07:05
87000 -- (-1943.739) [-1946.501] (-1954.019) (-1945.966) * [-1941.201] (-1941.827) (-1941.435) (-1938.263) -- 0:07:10
88000 -- (-1944.801) [-1943.646] (-1946.963) (-1943.350) * (-1938.561) (-1946.760) [-1940.463] (-1945.614) -- 0:07:04
89000 -- (-1951.029) (-1939.643) (-1939.932) [-1938.974] * (-1938.420) (-1943.455) (-1944.279) [-1945.404] -- 0:07:09
90000 -- [-1939.711] (-1945.054) (-1952.947) (-1952.338) * (-1945.126) (-1947.798) (-1943.879) [-1939.194] -- 0:07:04
Average standard deviation of split frequencies: 0.016898
91000 -- (-1942.752) (-1940.053) [-1943.466] (-1947.005) * [-1941.422] (-1946.930) (-1947.204) (-1941.807) -- 0:07:09
92000 -- (-1955.597) [-1942.188] (-1948.113) (-1944.041) * (-1941.208) [-1943.282] (-1948.069) (-1942.483) -- 0:07:04
93000 -- (-1945.122) (-1940.950) (-1945.213) [-1942.244] * (-1947.808) (-1944.235) [-1940.458] (-1946.011) -- 0:07:09
94000 -- (-1943.247) (-1943.529) (-1956.107) [-1942.763] * (-1951.923) (-1938.847) (-1950.211) [-1940.723] -- 0:07:04
95000 -- (-1945.446) (-1949.828) [-1948.904] (-1944.544) * [-1941.057] (-1943.651) (-1949.671) (-1948.177) -- 0:07:08
Average standard deviation of split frequencies: 0.020256
96000 -- [-1942.724] (-1953.620) (-1947.006) (-1942.326) * (-1945.291) (-1946.346) (-1948.675) [-1943.936] -- 0:07:03
97000 -- (-1947.391) (-1953.452) (-1945.746) [-1946.011] * (-1945.225) [-1942.595] (-1948.861) (-1944.119) -- 0:06:58
98000 -- (-1944.885) (-1950.995) [-1942.657] (-1943.572) * (-1943.513) [-1938.903] (-1943.765) (-1941.324) -- 0:07:03
99000 -- (-1945.555) [-1944.544] (-1940.099) (-1941.215) * (-1945.152) [-1940.328] (-1951.360) (-1953.486) -- 0:06:58
100000 -- [-1944.513] (-1949.502) (-1943.897) (-1947.004) * (-1945.826) [-1940.359] (-1946.165) (-1949.146) -- 0:07:03
Average standard deviation of split frequencies: 0.017561
101000 -- (-1945.002) (-1945.063) [-1939.329] (-1939.912) * (-1952.108) (-1946.139) (-1938.772) [-1938.008] -- 0:06:58
102000 -- (-1946.094) (-1949.934) (-1946.354) [-1943.687] * (-1951.733) [-1940.834] (-1943.356) (-1941.191) -- 0:07:02
103000 -- (-1947.285) (-1944.815) (-1944.485) [-1939.728] * (-1954.476) (-1941.325) (-1943.106) [-1942.237] -- 0:06:58
104000 -- (-1944.281) (-1952.009) (-1946.472) [-1946.282] * (-1948.326) (-1944.706) [-1947.241] (-1943.178) -- 0:07:02
105000 -- (-1946.954) (-1948.794) (-1943.055) [-1939.497] * [-1942.856] (-1948.779) (-1938.308) (-1937.346) -- 0:06:57
Average standard deviation of split frequencies: 0.016677
106000 -- (-1946.336) (-1947.920) (-1944.078) [-1942.393] * (-1940.231) (-1948.177) (-1942.377) [-1940.387] -- 0:07:01
107000 -- [-1943.167] (-1945.326) (-1942.087) (-1948.857) * (-1943.429) [-1944.461] (-1942.489) (-1947.520) -- 0:06:57
108000 -- (-1952.264) (-1950.081) [-1939.368] (-1943.020) * (-1946.523) (-1949.209) (-1941.559) [-1943.758] -- 0:07:01
109000 -- (-1944.390) (-1948.650) (-1949.016) [-1940.576] * (-1946.100) [-1940.803] (-1944.906) (-1944.255) -- 0:06:56
110000 -- (-1945.168) [-1947.277] (-1946.160) (-1949.846) * (-1943.092) (-1950.900) [-1938.687] (-1947.882) -- 0:07:00
Average standard deviation of split frequencies: 0.015441
111000 -- (-1943.129) (-1945.955) [-1947.334] (-1951.379) * (-1939.311) (-1946.293) [-1937.676] (-1951.000) -- 0:06:56
112000 -- [-1950.954] (-1947.587) (-1941.911) (-1950.391) * (-1941.207) (-1950.568) [-1941.279] (-1947.274) -- 0:07:00
113000 -- (-1946.759) (-1941.087) [-1938.536] (-1946.054) * (-1945.901) [-1954.945] (-1947.366) (-1948.799) -- 0:06:56
114000 -- [-1940.169] (-1940.071) (-1942.244) (-1938.588) * (-1946.258) [-1945.561] (-1950.708) (-1940.299) -- 0:06:59
115000 -- (-1939.262) [-1945.496] (-1942.123) (-1946.595) * (-1949.965) (-1947.867) [-1943.378] (-1944.387) -- 0:06:55
Average standard deviation of split frequencies: 0.015239
116000 -- (-1936.600) (-1946.338) [-1942.373] (-1942.554) * (-1944.148) (-1938.626) [-1946.370] (-1940.786) -- 0:06:51
117000 -- (-1938.773) (-1940.414) (-1942.387) [-1948.221] * [-1938.725] (-1941.498) (-1937.800) (-1941.991) -- 0:06:55
118000 -- (-1945.710) (-1939.842) (-1940.068) [-1945.135] * (-1946.192) (-1941.554) (-1943.850) [-1944.228] -- 0:06:51
119000 -- [-1948.590] (-1938.487) (-1944.810) (-1951.096) * (-1946.843) (-1937.591) (-1946.206) [-1944.759] -- 0:06:54
120000 -- (-1950.542) [-1942.423] (-1941.815) (-1940.716) * (-1940.262) (-1950.192) [-1940.563] (-1944.611) -- 0:06:50
Average standard deviation of split frequencies: 0.015627
121000 -- (-1943.188) (-1943.109) (-1940.651) [-1943.237] * (-1948.263) [-1949.944] (-1951.414) (-1945.866) -- 0:06:54
122000 -- [-1942.964] (-1950.090) (-1937.660) (-1943.805) * [-1942.352] (-1946.185) (-1941.407) (-1940.445) -- 0:06:50
123000 -- (-1952.541) (-1943.632) [-1940.282] (-1946.304) * (-1945.500) (-1941.253) [-1938.656] (-1946.909) -- 0:06:53
124000 -- (-1945.120) [-1945.519] (-1944.999) (-1953.563) * (-1940.265) (-1940.549) (-1935.959) [-1940.334] -- 0:06:49
125000 -- (-1946.843) (-1949.683) [-1940.695] (-1950.271) * (-1945.643) [-1938.471] (-1945.736) (-1944.357) -- 0:06:53
Average standard deviation of split frequencies: 0.015433
126000 -- (-1943.000) [-1941.663] (-1939.664) (-1943.313) * (-1942.663) (-1940.526) [-1937.032] (-1943.584) -- 0:06:49
127000 -- (-1943.935) (-1946.110) [-1940.202] (-1952.606) * (-1949.639) [-1939.731] (-1938.631) (-1943.106) -- 0:06:52
128000 -- (-1944.178) (-1944.155) (-1942.674) [-1945.750] * (-1944.729) (-1945.902) [-1938.396] (-1946.533) -- 0:06:48
129000 -- (-1947.073) (-1942.071) (-1945.744) [-1943.180] * [-1943.515] (-1944.803) (-1944.834) (-1950.137) -- 0:06:51
130000 -- (-1945.249) (-1945.385) (-1945.729) [-1942.290] * (-1942.056) (-1943.854) [-1950.212] (-1948.143) -- 0:06:48
Average standard deviation of split frequencies: 0.012176
131000 -- (-1951.626) [-1950.393] (-1942.614) (-1942.953) * (-1944.860) [-1941.886] (-1951.364) (-1946.643) -- 0:06:51
132000 -- [-1943.809] (-1942.479) (-1947.296) (-1949.344) * (-1944.013) (-1942.683) [-1941.445] (-1945.896) -- 0:06:47
133000 -- (-1943.705) (-1952.140) [-1945.678] (-1948.168) * (-1942.952) (-1947.076) [-1945.008] (-1942.508) -- 0:06:50
134000 -- (-1939.603) [-1941.620] (-1944.434) (-1943.755) * (-1954.180) (-1942.989) [-1942.354] (-1954.807) -- 0:06:47
135000 -- (-1946.549) (-1942.760) [-1950.987] (-1940.965) * [-1944.222] (-1946.717) (-1943.941) (-1946.277) -- 0:06:43
Average standard deviation of split frequencies: 0.010832
136000 -- (-1941.901) (-1951.541) (-1945.297) [-1944.627] * (-1944.197) (-1947.877) [-1945.650] (-1946.670) -- 0:06:46
137000 -- (-1940.262) (-1946.112) (-1945.110) [-1939.779] * (-1941.219) (-1948.350) (-1947.695) [-1939.826] -- 0:06:43
138000 -- [-1940.596] (-1942.889) (-1951.767) (-1940.046) * (-1943.699) [-1942.524] (-1949.598) (-1937.418) -- 0:06:46
139000 -- (-1946.900) [-1941.643] (-1946.140) (-1945.264) * [-1940.491] (-1941.453) (-1953.545) (-1943.277) -- 0:06:42
140000 -- (-1952.752) [-1938.088] (-1941.508) (-1946.181) * (-1942.560) [-1944.986] (-1943.647) (-1938.884) -- 0:06:45
Average standard deviation of split frequencies: 0.010054
141000 -- (-1938.719) [-1937.219] (-1944.352) (-1941.813) * (-1942.271) [-1945.645] (-1938.223) (-1941.780) -- 0:06:42
142000 -- (-1944.395) (-1943.513) [-1940.798] (-1948.573) * (-1945.373) [-1941.337] (-1941.421) (-1938.429) -- 0:06:44
143000 -- (-1943.101) [-1944.383] (-1945.451) (-1940.522) * [-1951.180] (-1948.193) (-1942.054) (-1940.839) -- 0:06:41
144000 -- (-1949.043) (-1946.053) [-1943.331] (-1938.099) * (-1942.684) (-1950.836) (-1944.485) [-1944.697] -- 0:06:44
145000 -- (-1938.886) [-1945.366] (-1943.861) (-1942.608) * (-1945.204) [-1940.749] (-1939.936) (-1947.941) -- 0:06:40
Average standard deviation of split frequencies: 0.012512
146000 -- (-1947.509) (-1950.776) (-1957.132) [-1940.617] * (-1954.001) (-1939.399) [-1943.427] (-1944.971) -- 0:06:43
147000 -- (-1939.348) [-1940.441] (-1952.760) (-1941.631) * (-1945.723) (-1951.219) (-1943.243) [-1944.977] -- 0:06:40
148000 -- (-1942.869) (-1953.114) (-1940.477) [-1943.657] * [-1943.412] (-1949.681) (-1940.801) (-1945.294) -- 0:06:42
149000 -- (-1952.010) [-1949.446] (-1943.898) (-1942.585) * (-1943.983) [-1942.423] (-1944.622) (-1940.122) -- 0:06:39
150000 -- [-1944.783] (-1951.322) (-1945.799) (-1942.158) * (-1941.485) (-1947.670) [-1949.224] (-1944.426) -- 0:06:42
Average standard deviation of split frequencies: 0.011733
151000 -- (-1941.217) (-1950.426) [-1949.561] (-1948.821) * (-1938.090) (-1950.873) (-1942.643) [-1943.298] -- 0:06:39
152000 -- [-1941.151] (-1943.482) (-1941.871) (-1946.973) * [-1946.628] (-1938.490) (-1942.247) (-1940.877) -- 0:06:41
153000 -- (-1949.739) [-1940.130] (-1940.579) (-1946.336) * [-1945.868] (-1943.664) (-1948.221) (-1939.184) -- 0:06:38
154000 -- [-1951.740] (-1948.319) (-1944.167) (-1949.657) * [-1940.911] (-1942.212) (-1946.467) (-1937.202) -- 0:06:41
155000 -- (-1945.332) [-1946.002] (-1939.209) (-1945.381) * [-1939.801] (-1945.449) (-1947.239) (-1945.632) -- 0:06:37
Average standard deviation of split frequencies: 0.012465
156000 -- [-1944.937] (-1952.637) (-1949.817) (-1947.124) * (-1950.543) [-1942.248] (-1943.900) (-1942.690) -- 0:06:34
157000 -- (-1939.221) (-1946.322) [-1943.766] (-1935.954) * (-1943.786) (-1939.628) [-1942.121] (-1944.725) -- 0:06:37
158000 -- (-1945.372) [-1941.424] (-1940.017) (-1938.966) * (-1939.119) (-1942.631) (-1948.370) [-1945.717] -- 0:06:34
159000 -- (-1945.676) (-1949.533) (-1945.669) [-1942.499] * [-1942.890] (-1939.380) (-1951.667) (-1945.824) -- 0:06:36
160000 -- (-1945.664) [-1942.022] (-1950.630) (-1945.893) * (-1942.243) [-1942.933] (-1948.649) (-1939.564) -- 0:06:33
Average standard deviation of split frequencies: 0.010636
161000 -- [-1940.085] (-1943.767) (-1952.165) (-1947.664) * (-1942.556) (-1944.959) (-1946.346) [-1948.023] -- 0:06:36
162000 -- (-1946.779) [-1945.124] (-1943.124) (-1941.896) * (-1949.272) (-1942.575) (-1946.660) [-1941.211] -- 0:06:33
163000 -- [-1943.841] (-1947.872) (-1942.644) (-1942.908) * (-1943.370) [-1944.133] (-1945.251) (-1944.846) -- 0:06:35
164000 -- [-1940.537] (-1942.091) (-1943.169) (-1941.862) * [-1941.982] (-1939.367) (-1947.808) (-1943.452) -- 0:06:32
165000 -- (-1937.648) (-1941.970) (-1944.737) [-1943.702] * [-1943.282] (-1941.235) (-1943.695) (-1945.582) -- 0:06:34
Average standard deviation of split frequencies: 0.012779
166000 -- (-1943.101) (-1944.746) (-1943.036) [-1945.136] * (-1938.298) [-1941.483] (-1940.544) (-1942.370) -- 0:06:31
167000 -- [-1944.321] (-1949.252) (-1944.053) (-1939.512) * (-1946.380) [-1942.679] (-1940.295) (-1939.249) -- 0:06:34
168000 -- (-1941.150) (-1943.984) (-1944.818) [-1945.311] * (-1942.942) (-1942.714) [-1942.540] (-1954.073) -- 0:06:31
169000 -- (-1944.904) (-1940.334) (-1942.809) [-1946.787] * (-1942.187) [-1937.795] (-1944.364) (-1942.948) -- 0:06:33
170000 -- (-1951.165) (-1942.880) (-1942.519) [-1946.390] * (-1945.207) (-1943.298) [-1945.732] (-1944.508) -- 0:06:30
Average standard deviation of split frequencies: 0.011394
171000 -- (-1945.819) (-1947.648) (-1940.485) [-1948.171] * [-1939.941] (-1946.871) (-1942.949) (-1945.616) -- 0:06:32
172000 -- (-1950.700) [-1940.515] (-1946.282) (-1943.188) * (-1947.399) (-1941.632) [-1940.847] (-1938.681) -- 0:06:29
173000 -- [-1939.868] (-1947.760) (-1938.471) (-1946.083) * [-1944.044] (-1943.268) (-1948.824) (-1944.493) -- 0:06:27
174000 -- (-1944.048) (-1943.568) [-1952.895] (-1942.573) * (-1945.383) [-1944.873] (-1936.310) (-1945.142) -- 0:06:29
175000 -- (-1940.638) [-1944.162] (-1941.274) (-1941.333) * (-1942.790) (-1940.739) [-1941.016] (-1955.251) -- 0:06:26
Average standard deviation of split frequencies: 0.011049
176000 -- (-1951.125) [-1950.046] (-1943.800) (-1946.919) * (-1944.784) [-1944.432] (-1947.965) (-1954.079) -- 0:06:28
177000 -- (-1949.659) (-1942.361) (-1946.077) [-1941.249] * [-1942.022] (-1942.720) (-1945.050) (-1946.960) -- 0:06:25
178000 -- (-1945.746) (-1941.428) [-1941.634] (-1951.253) * (-1941.823) (-1939.918) [-1946.142] (-1944.276) -- 0:06:27
179000 -- (-1942.999) (-1943.658) (-1947.396) [-1946.817] * (-1941.583) (-1944.217) [-1944.605] (-1938.119) -- 0:06:25
180000 -- (-1945.115) [-1939.129] (-1938.397) (-1941.096) * [-1941.861] (-1944.767) (-1940.425) (-1943.434) -- 0:06:27
Average standard deviation of split frequencies: 0.012394
181000 -- (-1943.438) [-1940.583] (-1943.420) (-1952.812) * (-1944.622) (-1945.639) (-1959.261) [-1945.630] -- 0:06:24
182000 -- [-1938.297] (-1943.808) (-1945.551) (-1948.196) * (-1939.965) [-1938.768] (-1939.196) (-1942.209) -- 0:06:26
183000 -- (-1944.882) [-1939.075] (-1945.294) (-1940.013) * (-1946.523) [-1947.493] (-1939.921) (-1945.604) -- 0:06:23
184000 -- [-1946.669] (-1949.274) (-1937.952) (-1942.996) * (-1949.713) (-1943.703) (-1939.457) [-1954.008] -- 0:06:25
185000 -- [-1943.740] (-1940.423) (-1946.018) (-1944.979) * (-1940.786) [-1950.414] (-1938.774) (-1953.031) -- 0:06:23
Average standard deviation of split frequencies: 0.009187
186000 -- [-1940.823] (-1947.242) (-1947.680) (-1958.898) * (-1941.244) (-1944.527) (-1940.368) [-1945.042] -- 0:06:25
187000 -- (-1943.864) (-1943.008) [-1942.129] (-1943.898) * [-1939.573] (-1947.282) (-1944.575) (-1942.360) -- 0:06:22
188000 -- (-1943.381) (-1943.584) [-1941.681] (-1944.726) * (-1946.566) (-1947.678) [-1949.659] (-1944.916) -- 0:06:24
189000 -- (-1959.836) (-1945.179) (-1949.717) [-1940.783] * (-1949.309) (-1940.591) [-1942.302] (-1939.701) -- 0:06:21
190000 -- [-1944.290] (-1945.279) (-1943.289) (-1946.077) * (-1943.805) [-1941.157] (-1946.708) (-1940.955) -- 0:06:23
Average standard deviation of split frequencies: 0.011435
191000 -- [-1945.817] (-1943.234) (-1948.127) (-1947.917) * [-1944.862] (-1945.771) (-1950.520) (-1941.235) -- 0:06:21
192000 -- (-1940.832) (-1948.925) (-1939.255) [-1942.502] * [-1942.684] (-1945.031) (-1942.638) (-1947.046) -- 0:06:18
193000 -- (-1938.957) (-1940.199) (-1940.447) [-1942.692] * (-1949.781) [-1941.799] (-1949.436) (-1941.072) -- 0:06:20
194000 -- [-1939.913] (-1940.624) (-1943.139) (-1940.364) * (-1942.499) (-1941.196) [-1943.550] (-1938.274) -- 0:06:18
195000 -- [-1942.493] (-1939.578) (-1945.725) (-1943.202) * (-1946.898) [-1940.078] (-1942.553) (-1956.821) -- 0:06:19
Average standard deviation of split frequencies: 0.012928
196000 -- (-1939.652) (-1934.027) [-1942.314] (-1940.211) * (-1942.532) (-1954.711) [-1943.982] (-1946.288) -- 0:06:17
197000 -- (-1948.590) [-1944.868] (-1944.076) (-1944.950) * (-1953.239) [-1943.631] (-1938.228) (-1944.120) -- 0:06:19
198000 -- (-1940.547) (-1945.359) (-1941.316) [-1942.472] * (-1948.289) [-1942.282] (-1945.509) (-1950.894) -- 0:06:16
199000 -- (-1937.055) (-1945.182) (-1944.644) [-1939.039] * (-1943.744) [-1942.322] (-1942.886) (-1936.670) -- 0:06:18
200000 -- (-1939.152) (-1945.207) (-1944.622) [-1954.751] * (-1946.803) [-1941.736] (-1943.948) (-1942.591) -- 0:06:16
Average standard deviation of split frequencies: 0.011452
201000 -- (-1943.522) (-1944.431) (-1942.169) [-1947.143] * (-1946.318) (-1940.033) [-1942.633] (-1941.435) -- 0:06:17
202000 -- [-1948.683] (-1940.336) (-1935.807) (-1944.205) * (-1955.673) (-1941.313) [-1943.740] (-1943.986) -- 0:06:15
203000 -- (-1938.015) (-1939.458) [-1952.995] (-1943.240) * (-1942.315) [-1935.352] (-1941.001) (-1938.908) -- 0:06:16
204000 -- (-1948.441) (-1947.059) (-1939.409) [-1938.301] * (-1946.945) (-1941.626) [-1946.820] (-1948.838) -- 0:06:14
205000 -- [-1943.292] (-1953.490) (-1940.807) (-1940.756) * (-1938.969) [-1939.797] (-1950.066) (-1937.875) -- 0:06:16
Average standard deviation of split frequencies: 0.010012
206000 -- (-1952.525) [-1946.568] (-1943.194) (-1945.979) * (-1938.317) (-1941.555) (-1940.328) [-1941.278] -- 0:06:13
207000 -- (-1944.116) (-1944.641) (-1950.722) [-1943.158] * (-1939.324) (-1938.673) [-1940.626] (-1948.200) -- 0:06:15
208000 -- [-1949.323] (-1955.862) (-1944.296) (-1940.333) * (-1941.059) (-1944.016) (-1942.936) [-1946.735] -- 0:06:13
209000 -- (-1944.717) [-1943.815] (-1942.218) (-1944.890) * (-1947.594) [-1943.751] (-1937.125) (-1948.588) -- 0:06:10
210000 -- (-1949.310) (-1944.824) [-1941.119] (-1944.020) * [-1942.676] (-1943.595) (-1940.190) (-1940.047) -- 0:06:12
Average standard deviation of split frequencies: 0.011468
211000 -- (-1944.555) (-1950.544) (-1944.647) [-1938.903] * (-1943.908) (-1943.984) (-1939.284) [-1937.469] -- 0:06:10
212000 -- (-1942.987) [-1952.226] (-1952.197) (-1942.809) * [-1939.452] (-1947.444) (-1944.858) (-1940.748) -- 0:06:11
213000 -- (-1945.420) [-1942.407] (-1948.191) (-1942.518) * [-1940.318] (-1950.335) (-1943.225) (-1945.164) -- 0:06:09
214000 -- (-1946.181) (-1939.616) [-1941.699] (-1945.469) * (-1944.145) (-1942.246) [-1941.386] (-1939.780) -- 0:06:10
215000 -- [-1945.411] (-1940.527) (-1943.009) (-1941.995) * (-1947.737) (-1939.413) [-1939.893] (-1942.895) -- 0:06:08
Average standard deviation of split frequencies: 0.016095
216000 -- (-1942.864) [-1949.005] (-1946.148) (-1941.518) * (-1941.349) [-1941.517] (-1939.819) (-1943.578) -- 0:06:10
217000 -- (-1940.992) (-1939.307) [-1940.555] (-1945.791) * (-1944.036) (-1942.801) [-1945.232] (-1945.913) -- 0:06:08
218000 -- [-1942.545] (-1946.684) (-1946.598) (-1943.844) * [-1940.528] (-1946.612) (-1949.829) (-1944.705) -- 0:06:09
219000 -- (-1946.472) (-1946.734) (-1948.468) [-1938.822] * (-1950.139) (-1949.055) [-1959.158] (-1943.897) -- 0:06:07
220000 -- (-1942.529) [-1946.932] (-1945.569) (-1941.782) * (-1941.055) (-1944.490) (-1946.969) [-1947.838] -- 0:06:08
Average standard deviation of split frequencies: 0.016289
221000 -- (-1948.992) (-1957.635) (-1945.344) [-1939.173] * (-1949.644) [-1944.583] (-1948.093) (-1942.946) -- 0:06:06
222000 -- (-1947.646) [-1945.002] (-1944.864) (-1941.387) * (-1946.777) (-1945.092) (-1945.593) [-1941.540] -- 0:06:07
223000 -- (-1947.395) [-1942.116] (-1948.240) (-1940.098) * (-1942.751) [-1941.063] (-1952.113) (-1945.957) -- 0:06:05
224000 -- [-1941.010] (-1943.509) (-1941.757) (-1954.467) * (-1941.251) [-1949.188] (-1949.005) (-1944.642) -- 0:06:07
225000 -- [-1941.830] (-1941.123) (-1954.437) (-1949.652) * (-1944.581) (-1948.134) (-1941.750) [-1940.583] -- 0:06:05
Average standard deviation of split frequencies: 0.016165
226000 -- [-1946.134] (-1948.674) (-1954.908) (-1942.101) * (-1940.052) [-1950.496] (-1938.026) (-1941.369) -- 0:06:03
227000 -- (-1951.081) [-1937.555] (-1946.241) (-1944.408) * [-1938.883] (-1942.933) (-1944.131) (-1941.014) -- 0:06:04
228000 -- (-1944.873) (-1938.258) [-1947.494] (-1944.523) * (-1943.570) (-1948.146) [-1943.230] (-1941.319) -- 0:06:02
229000 -- (-1941.335) (-1952.090) [-1943.007] (-1950.285) * (-1943.163) (-1949.896) (-1948.364) [-1935.887] -- 0:06:03
230000 -- (-1941.444) (-1941.917) [-1938.754] (-1951.070) * [-1947.242] (-1941.493) (-1945.364) (-1941.001) -- 0:06:01
Average standard deviation of split frequencies: 0.016094
231000 -- [-1940.350] (-1940.957) (-1951.535) (-1948.793) * (-1949.285) (-1939.565) [-1950.884] (-1938.358) -- 0:06:02
232000 -- [-1938.055] (-1943.848) (-1949.304) (-1943.702) * (-1948.770) [-1938.652] (-1952.441) (-1945.378) -- 0:06:00
233000 -- (-1939.715) (-1944.560) (-1937.149) [-1941.679] * (-1949.617) [-1938.501] (-1944.472) (-1943.715) -- 0:06:02
234000 -- (-1944.534) (-1944.835) (-1945.888) [-1942.628] * [-1946.250] (-1941.953) (-1940.331) (-1952.115) -- 0:06:00
235000 -- [-1941.307] (-1942.426) (-1939.644) (-1944.297) * (-1942.909) (-1945.030) (-1941.244) [-1942.710] -- 0:06:01
Average standard deviation of split frequencies: 0.016479
236000 -- (-1950.975) (-1940.929) (-1946.088) [-1943.992] * (-1952.580) [-1946.149] (-1944.073) (-1942.099) -- 0:05:59
237000 -- (-1942.797) (-1951.423) [-1941.760] (-1943.465) * (-1942.203) [-1946.242] (-1944.977) (-1942.104) -- 0:06:00
238000 -- (-1945.343) (-1948.804) [-1946.880] (-1941.401) * (-1945.265) (-1957.617) [-1942.110] (-1944.292) -- 0:05:58
239000 -- (-1957.546) [-1946.442] (-1947.747) (-1939.044) * (-1942.886) (-1946.790) [-1945.888] (-1950.655) -- 0:05:59
240000 -- (-1941.111) (-1945.039) [-1942.524] (-1943.187) * [-1941.613] (-1946.903) (-1944.781) (-1948.310) -- 0:05:57
Average standard deviation of split frequencies: 0.018853
241000 -- [-1944.399] (-1942.397) (-1944.600) (-1943.436) * (-1945.252) (-1948.250) (-1943.879) [-1943.072] -- 0:05:59
242000 -- (-1938.455) (-1945.582) [-1944.131] (-1947.331) * (-1954.673) (-1951.489) [-1938.029] (-1945.463) -- 0:05:57
243000 -- [-1947.230] (-1939.971) (-1948.530) (-1957.727) * (-1948.279) (-1947.099) (-1944.270) [-1943.788] -- 0:05:58
244000 -- [-1944.905] (-1948.384) (-1949.132) (-1941.768) * (-1954.953) (-1945.843) [-1944.185] (-1943.791) -- 0:05:56
245000 -- (-1939.919) (-1938.260) (-1948.110) [-1946.062] * (-1947.856) [-1943.678] (-1942.197) (-1938.566) -- 0:05:54
Average standard deviation of split frequencies: 0.020360
246000 -- [-1942.153] (-1939.031) (-1941.506) (-1947.018) * (-1945.851) (-1952.407) [-1941.688] (-1947.802) -- 0:05:55
247000 -- [-1940.807] (-1943.095) (-1945.234) (-1947.443) * (-1952.192) (-1944.508) [-1941.029] (-1945.325) -- 0:05:53
248000 -- (-1941.306) [-1934.454] (-1948.593) (-1946.905) * (-1942.068) (-1951.717) [-1951.481] (-1938.702) -- 0:05:54
249000 -- (-1943.335) [-1945.839] (-1950.683) (-1944.886) * [-1940.689] (-1948.199) (-1948.798) (-1945.042) -- 0:05:52
250000 -- [-1945.018] (-1944.070) (-1943.951) (-1948.744) * (-1938.444) (-1946.873) [-1940.018] (-1949.716) -- 0:05:54
Average standard deviation of split frequencies: 0.019276
251000 -- [-1940.503] (-1946.724) (-1949.712) (-1949.194) * (-1939.645) [-1941.611] (-1939.819) (-1939.994) -- 0:05:52
252000 -- (-1940.610) (-1939.871) (-1949.149) [-1944.892] * (-1944.782) [-1941.660] (-1938.736) (-1942.975) -- 0:05:53
253000 -- (-1947.588) (-1948.755) (-1942.043) [-1939.866] * [-1943.411] (-1946.086) (-1944.721) (-1947.250) -- 0:05:51
254000 -- (-1939.753) [-1947.625] (-1937.449) (-1944.235) * [-1944.777] (-1940.955) (-1940.129) (-1944.980) -- 0:05:52
255000 -- (-1939.884) (-1941.400) [-1938.402] (-1944.735) * (-1940.962) (-1941.554) [-1942.141] (-1941.303) -- 0:05:50
Average standard deviation of split frequencies: 0.018414
256000 -- [-1945.268] (-1945.430) (-1938.331) (-1941.817) * (-1943.200) (-1940.703) (-1950.680) [-1944.794] -- 0:05:51
257000 -- [-1946.602] (-1945.146) (-1936.965) (-1939.882) * (-1941.238) (-1940.644) (-1947.191) [-1942.258] -- 0:05:49
258000 -- (-1942.875) (-1944.321) [-1946.444] (-1941.776) * [-1942.340] (-1941.091) (-1950.605) (-1943.324) -- 0:05:50
259000 -- (-1949.661) (-1943.344) (-1940.337) [-1946.295] * (-1944.152) (-1941.562) [-1941.481] (-1944.052) -- 0:05:49
260000 -- (-1941.418) (-1944.430) [-1942.117] (-1942.624) * [-1942.013] (-1940.440) (-1942.055) (-1943.812) -- 0:05:50
Average standard deviation of split frequencies: 0.022154
261000 -- [-1938.138] (-1941.637) (-1944.660) (-1946.368) * [-1943.682] (-1943.634) (-1949.147) (-1939.643) -- 0:05:48
262000 -- (-1941.471) (-1940.909) [-1942.720] (-1945.146) * (-1940.563) [-1946.827] (-1947.835) (-1949.582) -- 0:05:49
263000 -- [-1948.104] (-1937.654) (-1946.980) (-1941.705) * [-1944.424] (-1943.901) (-1941.086) (-1945.533) -- 0:05:47
264000 -- (-1937.731) [-1944.030] (-1949.370) (-1946.928) * (-1944.888) (-1944.668) (-1944.891) [-1942.948] -- 0:05:45
265000 -- (-1946.590) [-1944.707] (-1954.066) (-1942.366) * (-1943.330) [-1945.245] (-1951.879) (-1941.806) -- 0:05:46
Average standard deviation of split frequencies: 0.022152
266000 -- [-1945.140] (-1941.551) (-1942.413) (-1944.583) * (-1944.143) [-1942.367] (-1944.152) (-1943.819) -- 0:05:44
267000 -- (-1956.490) [-1944.895] (-1947.818) (-1943.704) * (-1944.618) (-1942.598) (-1950.495) [-1948.300] -- 0:05:45
268000 -- (-1947.444) [-1947.424] (-1942.979) (-1940.269) * [-1946.456] (-1944.128) (-1943.615) (-1942.650) -- 0:05:44
269000 -- (-1944.913) [-1942.942] (-1942.699) (-1946.576) * (-1947.059) [-1941.079] (-1946.450) (-1936.779) -- 0:05:45
270000 -- (-1943.803) (-1945.475) (-1945.123) [-1943.974] * (-1937.249) (-1948.641) [-1947.180] (-1943.018) -- 0:05:43
Average standard deviation of split frequencies: 0.020900
271000 -- (-1939.071) [-1946.272] (-1945.049) (-1941.711) * (-1942.819) [-1942.495] (-1942.922) (-1944.780) -- 0:05:44
272000 -- [-1941.848] (-1949.392) (-1948.823) (-1946.092) * (-1945.153) [-1941.159] (-1947.139) (-1943.936) -- 0:05:42
273000 -- (-1948.662) (-1941.845) [-1947.458] (-1945.705) * [-1943.637] (-1938.063) (-1938.970) (-1938.945) -- 0:05:43
274000 -- [-1943.680] (-1944.232) (-1942.562) (-1947.443) * [-1940.812] (-1942.333) (-1943.516) (-1940.888) -- 0:05:41
275000 -- (-1943.942) (-1941.954) [-1945.775] (-1947.482) * [-1939.760] (-1943.902) (-1948.531) (-1947.555) -- 0:05:42
Average standard deviation of split frequencies: 0.020282
276000 -- [-1950.122] (-1949.553) (-1947.273) (-1939.333) * (-1942.667) (-1945.601) (-1940.254) [-1943.470] -- 0:05:41
277000 -- [-1940.384] (-1948.006) (-1940.995) (-1946.393) * [-1942.030] (-1946.055) (-1943.310) (-1946.392) -- 0:05:41
278000 -- [-1948.179] (-1945.271) (-1940.935) (-1939.725) * (-1943.794) [-1945.383] (-1937.456) (-1941.269) -- 0:05:40
279000 -- (-1939.206) [-1943.856] (-1946.336) (-1944.856) * [-1940.786] (-1942.570) (-1936.309) (-1949.198) -- 0:05:41
280000 -- (-1941.573) (-1950.083) [-1950.794] (-1941.846) * (-1941.307) [-1944.060] (-1953.572) (-1945.886) -- 0:05:39
Average standard deviation of split frequencies: 0.018266
281000 -- [-1941.949] (-1942.846) (-1948.691) (-1947.019) * [-1943.345] (-1940.267) (-1945.702) (-1941.981) -- 0:05:40
282000 -- (-1946.900) (-1941.452) [-1945.797] (-1949.598) * (-1946.457) (-1943.154) (-1947.127) [-1939.191] -- 0:05:38
283000 -- [-1947.947] (-1945.755) (-1947.001) (-1946.546) * (-1951.867) [-1944.782] (-1945.163) (-1941.325) -- 0:05:39
284000 -- (-1946.878) (-1942.847) [-1940.880] (-1952.087) * [-1943.523] (-1943.761) (-1945.137) (-1948.690) -- 0:05:37
285000 -- (-1952.307) (-1946.155) [-1940.866] (-1947.709) * (-1942.792) (-1943.059) (-1943.504) [-1946.328] -- 0:05:36
Average standard deviation of split frequencies: 0.018131
286000 -- (-1943.171) (-1945.582) [-1939.284] (-1944.679) * (-1942.662) (-1949.654) (-1950.671) [-1943.971] -- 0:05:37
287000 -- (-1946.426) (-1940.748) (-1943.587) [-1948.054] * (-1943.365) (-1941.147) [-1942.552] (-1944.272) -- 0:05:35
288000 -- [-1944.758] (-1942.081) (-1945.371) (-1945.201) * (-1942.717) (-1949.276) [-1943.670] (-1943.087) -- 0:05:36
289000 -- [-1952.129] (-1940.204) (-1943.881) (-1950.433) * (-1948.652) (-1939.872) [-1941.275] (-1943.868) -- 0:05:34
290000 -- [-1947.644] (-1940.500) (-1956.922) (-1945.720) * (-1943.851) (-1948.482) (-1950.510) [-1947.785] -- 0:05:35
Average standard deviation of split frequencies: 0.017434
291000 -- (-1957.009) (-1939.860) (-1945.444) [-1944.698] * (-1955.389) [-1937.833] (-1938.598) (-1950.987) -- 0:05:33
292000 -- [-1941.813] (-1943.822) (-1956.137) (-1940.118) * (-1941.595) (-1944.795) [-1944.840] (-1941.888) -- 0:05:34
293000 -- (-1939.009) (-1939.022) [-1957.413] (-1942.573) * (-1949.348) [-1946.392] (-1947.440) (-1941.277) -- 0:05:32
294000 -- (-1941.503) [-1942.300] (-1954.033) (-1940.388) * (-1944.488) (-1947.946) [-1939.383] (-1938.027) -- 0:05:33
295000 -- [-1946.517] (-1957.272) (-1949.374) (-1940.789) * (-1951.065) (-1944.673) (-1948.213) [-1947.552] -- 0:05:32
Average standard deviation of split frequencies: 0.016324
296000 -- (-1943.721) [-1947.790] (-1942.112) (-1942.182) * (-1945.360) [-1946.310] (-1945.764) (-1941.496) -- 0:05:32
297000 -- [-1944.646] (-1948.984) (-1943.107) (-1943.997) * (-1945.007) [-1945.685] (-1939.593) (-1941.816) -- 0:05:31
298000 -- (-1944.312) (-1940.781) (-1943.944) [-1941.597] * (-1952.160) (-1951.158) [-1947.105] (-1939.895) -- 0:05:32
299000 -- (-1945.471) [-1941.281] (-1945.592) (-1947.642) * (-1944.203) (-1949.768) [-1942.676] (-1948.105) -- 0:05:30
300000 -- (-1936.737) (-1939.420) [-1948.682] (-1939.264) * (-1940.796) (-1946.413) [-1943.167] (-1949.323) -- 0:05:31
Average standard deviation of split frequencies: 0.016463
301000 -- [-1942.027] (-1948.318) (-1940.414) (-1944.674) * (-1942.428) (-1945.801) [-1945.937] (-1952.266) -- 0:05:29
302000 -- (-1941.069) (-1939.495) [-1947.123] (-1941.210) * [-1940.536] (-1948.934) (-1945.916) (-1947.662) -- 0:05:30
303000 -- [-1938.909] (-1941.964) (-1944.333) (-1950.709) * [-1940.809] (-1944.099) (-1941.019) (-1939.211) -- 0:05:28
304000 -- (-1948.262) (-1947.073) (-1940.750) [-1942.885] * (-1946.426) (-1950.027) (-1944.065) [-1942.497] -- 0:05:27
305000 -- [-1940.951] (-1946.898) (-1943.616) (-1944.598) * (-1937.368) [-1941.282] (-1947.109) (-1943.173) -- 0:05:28
Average standard deviation of split frequencies: 0.018679
306000 -- (-1944.166) [-1938.290] (-1942.617) (-1942.417) * (-1939.052) (-1938.253) (-1949.054) [-1954.911] -- 0:05:26
307000 -- (-1949.794) [-1942.640] (-1944.511) (-1953.623) * [-1946.534] (-1939.343) (-1943.990) (-1946.200) -- 0:05:27
308000 -- [-1937.393] (-1952.381) (-1940.703) (-1937.814) * (-1942.749) [-1942.163] (-1947.801) (-1942.590) -- 0:05:25
309000 -- (-1942.240) (-1945.916) (-1939.842) [-1941.047] * (-1938.807) [-1941.770] (-1943.894) (-1937.212) -- 0:05:26
310000 -- [-1941.009] (-1952.157) (-1947.314) (-1940.993) * (-1947.662) (-1944.463) (-1939.056) [-1947.054] -- 0:05:24
Average standard deviation of split frequencies: 0.019726
311000 -- [-1937.924] (-1953.021) (-1954.002) (-1945.834) * (-1943.291) (-1938.969) [-1949.731] (-1946.035) -- 0:05:25
312000 -- [-1944.859] (-1941.798) (-1941.381) (-1945.700) * (-1944.346) [-1939.250] (-1948.541) (-1939.363) -- 0:05:24
313000 -- [-1946.396] (-1945.435) (-1938.001) (-1944.575) * [-1943.654] (-1944.539) (-1944.659) (-1943.019) -- 0:05:24
314000 -- (-1945.488) (-1944.460) [-1949.728] (-1939.011) * (-1944.537) [-1942.073] (-1941.067) (-1949.347) -- 0:05:23
315000 -- [-1943.100] (-1945.838) (-1952.619) (-1939.979) * [-1948.599] (-1942.139) (-1946.137) (-1938.498) -- 0:05:24
Average standard deviation of split frequencies: 0.019580
316000 -- (-1938.579) (-1943.463) (-1938.382) [-1940.644] * (-1939.371) (-1950.094) (-1943.049) [-1943.667] -- 0:05:22
317000 -- (-1942.037) (-1941.218) (-1945.193) [-1937.212] * (-1938.510) [-1944.805] (-1943.539) (-1941.660) -- 0:05:23
318000 -- (-1946.269) (-1949.181) (-1944.039) [-1938.878] * [-1948.210] (-1943.850) (-1941.486) (-1939.023) -- 0:05:21
319000 -- (-1943.477) [-1946.670] (-1949.748) (-1946.924) * (-1946.433) [-1946.389] (-1943.996) (-1941.070) -- 0:05:22
320000 -- (-1953.761) [-1946.803] (-1940.364) (-1941.763) * [-1947.576] (-1944.664) (-1947.808) (-1941.959) -- 0:05:20
Average standard deviation of split frequencies: 0.018743
321000 -- (-1945.798) [-1941.059] (-1947.861) (-1939.738) * (-1943.283) (-1941.403) [-1943.165] (-1939.722) -- 0:05:21
322000 -- (-1939.188) (-1941.984) [-1941.754] (-1945.501) * (-1944.253) (-1944.064) [-1943.334] (-1944.224) -- 0:05:20
323000 -- (-1944.115) (-1944.516) (-1946.468) [-1940.905] * (-1943.875) (-1944.303) [-1942.024] (-1945.410) -- 0:05:18
324000 -- [-1953.490] (-1938.685) (-1939.641) (-1949.394) * [-1943.595] (-1941.070) (-1940.256) (-1947.490) -- 0:05:19
325000 -- [-1940.123] (-1943.131) (-1942.073) (-1949.861) * (-1945.853) (-1947.792) [-1938.469] (-1946.933) -- 0:05:17
Average standard deviation of split frequencies: 0.018156
326000 -- (-1944.238) (-1952.325) (-1940.458) [-1946.489] * [-1945.811] (-1948.064) (-1941.990) (-1949.991) -- 0:05:18
327000 -- [-1944.187] (-1944.373) (-1943.993) (-1952.279) * [-1941.326] (-1946.265) (-1940.317) (-1952.535) -- 0:05:16
328000 -- (-1942.035) [-1941.804] (-1944.162) (-1948.617) * (-1943.771) (-1946.570) [-1942.522] (-1945.286) -- 0:05:17
329000 -- (-1939.966) [-1946.104] (-1942.781) (-1947.431) * (-1944.482) (-1957.047) [-1939.292] (-1945.058) -- 0:05:16
330000 -- [-1943.972] (-1948.131) (-1939.401) (-1943.959) * (-1951.993) (-1945.318) (-1940.397) [-1944.819] -- 0:05:16
Average standard deviation of split frequencies: 0.016632
331000 -- [-1945.438] (-1943.787) (-1946.429) (-1946.227) * (-1935.932) [-1940.980] (-1944.609) (-1950.448) -- 0:05:15
332000 -- [-1944.862] (-1947.163) (-1941.083) (-1943.896) * (-1943.529) (-1940.115) [-1945.418] (-1945.907) -- 0:05:15
333000 -- (-1946.115) [-1949.415] (-1943.134) (-1947.780) * (-1949.729) [-1946.434] (-1945.660) (-1941.711) -- 0:05:14
334000 -- [-1942.038] (-1953.362) (-1944.810) (-1943.805) * [-1946.128] (-1940.928) (-1942.651) (-1944.478) -- 0:05:15
335000 -- (-1942.469) (-1957.837) (-1947.548) [-1937.667] * [-1939.942] (-1940.509) (-1946.085) (-1945.679) -- 0:05:13
Average standard deviation of split frequencies: 0.014965
336000 -- (-1940.245) (-1944.230) (-1942.163) [-1944.478] * (-1951.417) (-1943.331) (-1941.041) [-1941.090] -- 0:05:14
337000 -- (-1946.357) (-1956.441) (-1944.741) [-1942.761] * (-1948.150) [-1945.048] (-1947.981) (-1945.948) -- 0:05:12
338000 -- (-1948.067) (-1948.225) (-1944.708) [-1940.572] * (-1946.436) [-1937.933] (-1945.777) (-1943.475) -- 0:05:13
339000 -- (-1940.974) (-1940.629) (-1940.515) [-1940.076] * (-1944.644) [-1943.695] (-1948.024) (-1945.067) -- 0:05:11
340000 -- (-1948.493) [-1948.470] (-1944.333) (-1946.613) * (-1941.981) [-1945.640] (-1945.358) (-1941.621) -- 0:05:12
Average standard deviation of split frequencies: 0.013838
341000 -- [-1939.979] (-1951.442) (-1940.606) (-1950.859) * [-1948.413] (-1943.719) (-1944.631) (-1938.074) -- 0:05:11
342000 -- [-1945.753] (-1946.537) (-1942.202) (-1945.172) * (-1948.070) (-1949.552) [-1946.861] (-1939.254) -- 0:05:09
343000 -- (-1940.089) (-1947.535) (-1947.732) [-1939.287] * (-1949.863) (-1943.306) (-1946.783) [-1943.555] -- 0:05:10
344000 -- (-1943.860) (-1947.389) (-1943.250) [-1942.500] * (-1944.643) (-1945.606) (-1939.754) [-1937.413] -- 0:05:08
345000 -- (-1942.928) (-1943.163) [-1944.254] (-1964.887) * (-1944.887) (-1944.794) (-1951.587) [-1942.300] -- 0:05:09
Average standard deviation of split frequencies: 0.014230
346000 -- [-1942.996] (-1945.781) (-1950.936) (-1943.266) * (-1944.481) (-1944.984) (-1942.855) [-1941.970] -- 0:05:08
347000 -- (-1942.140) [-1948.012] (-1939.224) (-1957.994) * (-1951.281) (-1943.646) (-1941.111) [-1944.862] -- 0:05:08
348000 -- (-1940.752) (-1943.804) [-1941.657] (-1953.808) * (-1959.842) (-1945.174) (-1947.392) [-1942.410] -- 0:05:07
349000 -- (-1944.105) (-1940.473) [-1941.636] (-1946.305) * (-1939.793) (-1942.761) (-1948.878) [-1941.826] -- 0:05:07
350000 -- (-1942.248) (-1947.276) (-1939.344) [-1936.777] * (-1941.731) [-1948.637] (-1947.629) (-1941.751) -- 0:05:06
Average standard deviation of split frequencies: 0.015796
351000 -- (-1949.759) (-1945.681) [-1948.708] (-1950.213) * (-1950.126) (-1947.764) [-1941.907] (-1953.464) -- 0:05:06
352000 -- (-1944.651) (-1945.075) (-1943.278) [-1942.073] * (-1941.568) (-1940.457) [-1944.452] (-1945.331) -- 0:05:05
353000 -- (-1942.001) [-1938.567] (-1942.814) (-1941.103) * (-1943.808) [-1942.173] (-1944.101) (-1945.046) -- 0:05:06
354000 -- (-1947.744) (-1944.222) (-1944.282) [-1938.708] * [-1943.625] (-1944.340) (-1945.786) (-1942.034) -- 0:05:04
355000 -- (-1947.724) (-1945.384) (-1944.692) [-1944.571] * (-1940.465) [-1949.004] (-1946.249) (-1947.009) -- 0:05:05
Average standard deviation of split frequencies: 0.013573
356000 -- [-1948.939] (-1941.344) (-1945.359) (-1940.410) * (-1948.669) [-1948.026] (-1947.183) (-1947.875) -- 0:05:03
357000 -- (-1952.549) (-1954.395) [-1940.104] (-1949.065) * (-1942.842) (-1941.833) [-1943.068] (-1946.591) -- 0:05:04
358000 -- (-1941.943) (-1948.291) [-1941.607] (-1950.290) * (-1937.186) (-1940.957) (-1944.360) [-1940.802] -- 0:05:03
359000 -- (-1935.490) [-1940.314] (-1941.135) (-1947.819) * [-1946.126] (-1942.681) (-1940.665) (-1939.981) -- 0:05:01
360000 -- (-1943.624) (-1944.275) [-1943.986] (-1943.080) * (-1952.222) (-1945.557) (-1947.877) [-1941.420] -- 0:05:02
Average standard deviation of split frequencies: 0.012744
361000 -- (-1942.248) (-1943.542) (-1938.757) [-1935.751] * (-1945.048) (-1942.723) (-1945.695) [-1940.291] -- 0:05:00
362000 -- (-1940.820) (-1940.503) (-1942.607) [-1940.463] * (-1950.634) [-1946.840] (-1943.751) (-1947.649) -- 0:05:01
363000 -- [-1946.030] (-1940.536) (-1949.665) (-1946.678) * (-1941.807) (-1940.151) [-1943.155] (-1947.437) -- 0:05:00
364000 -- [-1943.474] (-1945.434) (-1940.895) (-1960.055) * (-1943.868) [-1942.415] (-1937.610) (-1943.353) -- 0:05:00
365000 -- (-1943.402) [-1941.125] (-1948.706) (-1951.907) * (-1944.803) (-1948.057) (-1948.261) [-1942.315] -- 0:04:59
Average standard deviation of split frequencies: 0.012719
366000 -- (-1941.847) [-1941.720] (-1944.399) (-1946.906) * (-1945.739) (-1944.850) (-1951.841) [-1940.308] -- 0:04:59
367000 -- (-1948.868) (-1942.650) (-1947.782) [-1943.124] * (-1944.701) (-1941.851) [-1941.969] (-1944.092) -- 0:04:58
368000 -- (-1942.953) (-1941.725) (-1946.933) [-1948.291] * (-1941.362) (-1949.450) (-1944.516) [-1941.755] -- 0:04:58
369000 -- (-1947.972) [-1940.782] (-1941.740) (-1946.298) * [-1949.035] (-1945.857) (-1943.257) (-1944.707) -- 0:04:57
370000 -- (-1945.962) (-1943.392) (-1953.155) [-1948.400] * [-1943.444] (-1944.578) (-1945.840) (-1945.310) -- 0:04:57
Average standard deviation of split frequencies: 0.012559
371000 -- (-1947.076) (-1941.420) (-1940.664) [-1939.280] * (-1945.455) (-1951.395) [-1946.910] (-1941.314) -- 0:04:56
372000 -- (-1950.587) [-1947.304] (-1942.949) (-1941.122) * (-1954.470) (-1952.237) (-1939.960) [-1943.370] -- 0:04:57
373000 -- (-1943.078) [-1951.576] (-1942.898) (-1941.972) * [-1945.169] (-1947.580) (-1952.798) (-1955.555) -- 0:04:55
374000 -- (-1941.462) (-1940.386) (-1941.956) [-1944.704] * (-1944.681) [-1941.303] (-1940.564) (-1953.274) -- 0:04:56
375000 -- [-1936.651] (-1941.459) (-1942.219) (-1937.485) * (-1942.285) [-1936.429] (-1942.858) (-1948.548) -- 0:04:55
Average standard deviation of split frequencies: 0.013791
376000 -- (-1942.558) [-1935.984] (-1947.567) (-1947.528) * (-1944.685) (-1942.514) [-1939.422] (-1944.465) -- 0:04:55
377000 -- [-1944.080] (-1941.980) (-1947.463) (-1951.178) * (-1943.693) (-1938.447) (-1943.103) [-1941.945] -- 0:04:54
378000 -- [-1938.062] (-1944.388) (-1946.573) (-1943.555) * (-1940.860) (-1937.464) (-1947.128) [-1942.933] -- 0:04:52
379000 -- [-1940.790] (-1945.463) (-1946.490) (-1945.203) * [-1938.578] (-1943.420) (-1947.445) (-1943.201) -- 0:04:53
380000 -- (-1944.152) (-1946.419) [-1943.288] (-1943.723) * (-1947.499) [-1942.108] (-1950.024) (-1937.833) -- 0:04:52
Average standard deviation of split frequencies: 0.013622
381000 -- (-1944.083) (-1943.124) [-1944.643] (-1944.625) * (-1952.247) (-1942.282) [-1939.005] (-1952.836) -- 0:04:52
382000 -- [-1940.205] (-1948.778) (-1946.780) (-1948.505) * (-1948.657) (-1944.949) [-1945.912] (-1943.435) -- 0:04:51
383000 -- (-1946.641) [-1944.116] (-1940.776) (-1944.156) * (-1945.926) (-1943.364) [-1939.944] (-1944.130) -- 0:04:51
384000 -- (-1942.975) [-1942.158] (-1941.964) (-1943.642) * (-1946.910) (-1941.050) [-1942.985] (-1939.958) -- 0:04:50
385000 -- (-1944.765) [-1941.155] (-1950.257) (-1943.601) * [-1948.665] (-1949.835) (-1942.174) (-1940.520) -- 0:04:50
Average standard deviation of split frequencies: 0.015113
386000 -- (-1943.679) (-1953.179) (-1941.554) [-1945.107] * (-1941.390) (-1946.215) (-1942.579) [-1948.089] -- 0:04:49
387000 -- (-1948.934) (-1946.655) (-1940.536) [-1941.781] * (-1945.643) (-1946.878) [-1946.179] (-1940.434) -- 0:04:49
388000 -- (-1941.464) [-1944.843] (-1946.198) (-1940.511) * (-1940.676) (-1948.169) (-1946.372) [-1939.901] -- 0:04:48
389000 -- (-1947.408) (-1942.300) (-1942.116) [-1941.175] * (-1954.223) (-1946.453) (-1938.958) [-1944.622] -- 0:04:49
390000 -- [-1942.781] (-1944.517) (-1947.633) (-1942.396) * (-1943.819) [-1940.072] (-1944.341) (-1946.337) -- 0:04:47
Average standard deviation of split frequencies: 0.014631
391000 -- (-1939.394) (-1945.429) (-1943.267) [-1939.323] * (-1944.622) (-1944.025) (-1940.877) [-1939.286] -- 0:04:48
392000 -- (-1947.868) [-1948.364] (-1945.796) (-1942.177) * (-1947.864) (-1942.679) (-1947.799) [-1937.668] -- 0:04:46
393000 -- (-1941.221) [-1946.419] (-1942.706) (-1941.325) * (-1941.908) [-1941.334] (-1942.848) (-1938.363) -- 0:04:47
394000 -- (-1945.528) (-1951.555) (-1946.076) [-1945.303] * [-1940.353] (-1945.504) (-1949.118) (-1945.267) -- 0:04:46
395000 -- (-1945.106) (-1946.812) [-1943.223] (-1942.776) * (-1944.683) (-1944.721) (-1946.306) [-1938.083] -- 0:04:46
Average standard deviation of split frequencies: 0.015475
396000 -- [-1939.669] (-1948.171) (-1940.120) (-1946.942) * [-1943.078] (-1939.041) (-1942.973) (-1951.700) -- 0:04:45
397000 -- (-1944.615) (-1944.799) (-1943.510) [-1940.823] * (-1945.533) [-1946.037] (-1951.487) (-1946.128) -- 0:04:44
398000 -- (-1942.849) [-1943.191] (-1946.955) (-1954.276) * [-1946.500] (-1943.105) (-1936.960) (-1945.917) -- 0:04:44
399000 -- (-1945.688) (-1940.287) [-1947.292] (-1945.532) * (-1949.890) (-1943.237) [-1944.818] (-1945.199) -- 0:04:43
400000 -- (-1937.486) (-1940.837) [-1943.908] (-1950.936) * [-1945.543] (-1946.205) (-1945.956) (-1946.381) -- 0:04:43
Average standard deviation of split frequencies: 0.015001
401000 -- (-1942.285) (-1943.882) (-1942.351) [-1938.674] * [-1937.102] (-1947.624) (-1943.279) (-1941.361) -- 0:04:42
402000 -- (-1946.759) (-1942.277) (-1945.363) [-1938.187] * [-1941.504] (-1948.165) (-1944.688) (-1950.433) -- 0:04:42
403000 -- (-1946.892) [-1942.696] (-1943.367) (-1947.085) * (-1942.032) [-1938.643] (-1935.447) (-1946.040) -- 0:04:41
404000 -- (-1945.140) [-1944.826] (-1942.608) (-1939.445) * (-1941.680) (-1948.968) (-1949.101) [-1940.632] -- 0:04:41
405000 -- [-1943.733] (-1956.735) (-1944.512) (-1950.531) * [-1946.427] (-1942.989) (-1943.953) (-1942.616) -- 0:04:40
Average standard deviation of split frequencies: 0.013643
406000 -- [-1943.275] (-1944.764) (-1938.787) (-1941.974) * [-1945.470] (-1943.267) (-1940.591) (-1951.841) -- 0:04:40
407000 -- [-1943.735] (-1942.191) (-1949.882) (-1943.451) * (-1938.220) (-1943.980) [-1942.005] (-1944.634) -- 0:04:39
408000 -- (-1939.124) (-1944.820) [-1942.098] (-1940.399) * (-1945.813) [-1947.342] (-1951.565) (-1943.444) -- 0:04:40
409000 -- (-1944.306) [-1941.194] (-1942.929) (-1955.319) * (-1945.463) (-1943.261) (-1953.142) [-1939.556] -- 0:04:38
410000 -- (-1941.780) (-1945.051) (-1943.001) [-1940.014] * (-1946.806) (-1945.276) (-1951.211) [-1938.643] -- 0:04:39
Average standard deviation of split frequencies: 0.013344
411000 -- (-1950.524) (-1940.844) [-1940.685] (-1942.649) * [-1943.142] (-1947.324) (-1944.529) (-1938.726) -- 0:04:38
412000 -- [-1942.550] (-1947.208) (-1940.000) (-1942.587) * (-1938.905) [-1940.759] (-1948.927) (-1942.161) -- 0:04:38
413000 -- [-1938.694] (-1946.453) (-1939.891) (-1938.428) * [-1940.836] (-1944.411) (-1947.717) (-1949.900) -- 0:04:37
414000 -- (-1942.925) (-1944.128) (-1944.132) [-1941.225] * (-1937.326) (-1948.187) [-1947.245] (-1951.302) -- 0:04:36
415000 -- (-1954.472) (-1948.817) (-1948.018) [-1939.172] * [-1944.757] (-1941.399) (-1946.533) (-1947.097) -- 0:04:36
Average standard deviation of split frequencies: 0.013315
416000 -- (-1943.361) [-1942.154] (-1938.087) (-1938.998) * [-1942.987] (-1939.903) (-1946.091) (-1947.732) -- 0:04:35
417000 -- [-1945.027] (-1943.121) (-1945.343) (-1940.572) * [-1938.341] (-1945.002) (-1947.005) (-1942.981) -- 0:04:35
418000 -- (-1939.962) [-1944.370] (-1945.153) (-1941.502) * (-1942.939) [-1945.074] (-1945.797) (-1942.984) -- 0:04:34
419000 -- (-1947.311) (-1946.042) (-1949.374) [-1942.807] * (-1944.946) (-1948.215) (-1943.342) [-1943.583] -- 0:04:34
420000 -- (-1942.825) (-1940.262) (-1943.056) [-1942.963] * (-1950.600) [-1945.468] (-1948.843) (-1939.970) -- 0:04:33
Average standard deviation of split frequencies: 0.013167
421000 -- (-1955.861) (-1947.484) (-1940.182) [-1942.650] * [-1940.484] (-1950.987) (-1942.677) (-1944.514) -- 0:04:33
422000 -- (-1953.118) [-1942.838] (-1943.106) (-1944.017) * [-1940.529] (-1942.592) (-1953.177) (-1944.180) -- 0:04:32
423000 -- [-1951.794] (-1939.719) (-1947.068) (-1940.922) * (-1941.389) [-1942.942] (-1947.411) (-1944.838) -- 0:04:32
424000 -- [-1942.900] (-1946.910) (-1946.041) (-1949.739) * (-1938.805) [-1945.217] (-1950.634) (-1947.159) -- 0:04:31
425000 -- [-1942.285] (-1950.665) (-1942.532) (-1943.257) * (-1941.663) [-1947.445] (-1946.777) (-1944.187) -- 0:04:31
Average standard deviation of split frequencies: 0.013417
426000 -- [-1943.203] (-1946.192) (-1948.710) (-1948.477) * (-1944.802) [-1944.435] (-1947.530) (-1953.485) -- 0:04:30
427000 -- (-1945.542) [-1943.993] (-1943.145) (-1944.326) * [-1940.612] (-1946.074) (-1942.668) (-1941.474) -- 0:04:31
428000 -- [-1943.140] (-1940.264) (-1943.563) (-1940.384) * (-1940.180) (-1953.990) [-1941.875] (-1942.926) -- 0:04:29
429000 -- (-1940.405) [-1949.783] (-1947.910) (-1939.368) * (-1948.741) (-1944.800) (-1948.184) [-1944.246] -- 0:04:30
430000 -- (-1951.927) (-1940.622) [-1944.193] (-1941.997) * (-1943.748) [-1944.031] (-1946.462) (-1939.082) -- 0:04:29
Average standard deviation of split frequencies: 0.012998
431000 -- (-1953.233) (-1945.387) (-1943.761) [-1943.544] * [-1951.803] (-1942.232) (-1941.089) (-1940.160) -- 0:04:29
432000 -- (-1942.774) (-1944.161) [-1944.724] (-1954.800) * (-1948.559) (-1940.924) (-1948.526) [-1947.143] -- 0:04:28
433000 -- [-1939.421] (-1939.066) (-1949.571) (-1944.059) * (-1946.876) [-1945.309] (-1943.873) (-1954.657) -- 0:04:27
434000 -- (-1945.172) [-1942.530] (-1943.790) (-1952.550) * (-1948.126) (-1949.874) [-1939.104] (-1947.644) -- 0:04:27
435000 -- (-1942.757) [-1947.349] (-1942.518) (-1941.463) * (-1951.827) [-1938.873] (-1944.671) (-1942.417) -- 0:04:26
Average standard deviation of split frequencies: 0.011623
436000 -- (-1943.330) (-1940.824) [-1941.572] (-1942.837) * [-1938.733] (-1942.753) (-1941.872) (-1946.561) -- 0:04:26
437000 -- (-1944.057) (-1941.830) [-1937.652] (-1944.040) * (-1940.626) (-1951.260) [-1941.110] (-1945.618) -- 0:04:25
438000 -- (-1940.847) (-1942.996) [-1943.087] (-1943.649) * (-1947.880) (-1941.255) [-1941.057] (-1941.110) -- 0:04:25
439000 -- (-1938.248) (-1946.438) [-1944.796] (-1941.514) * (-1949.846) [-1944.592] (-1939.346) (-1941.302) -- 0:04:24
440000 -- [-1952.016] (-1944.023) (-1947.382) (-1941.795) * (-1951.822) (-1953.272) (-1943.858) [-1940.654] -- 0:04:24
Average standard deviation of split frequencies: 0.012124
441000 -- [-1948.871] (-1947.186) (-1951.312) (-1947.704) * [-1940.936] (-1936.435) (-1937.571) (-1944.677) -- 0:04:23
442000 -- [-1938.979] (-1944.957) (-1945.190) (-1942.019) * (-1941.532) (-1942.076) (-1950.201) [-1946.681] -- 0:04:23
443000 -- [-1939.544] (-1941.031) (-1945.087) (-1948.445) * (-1940.924) (-1947.747) (-1942.296) [-1937.785] -- 0:04:22
444000 -- [-1943.508] (-1946.896) (-1946.659) (-1942.972) * (-1949.031) (-1944.046) [-1944.382] (-1940.322) -- 0:04:22
445000 -- (-1939.980) (-1943.873) [-1947.300] (-1944.496) * [-1947.439] (-1936.016) (-1942.296) (-1946.055) -- 0:04:21
Average standard deviation of split frequencies: 0.011039
446000 -- (-1945.956) [-1942.801] (-1945.274) (-1952.030) * (-1943.246) (-1941.851) (-1951.152) [-1945.326] -- 0:04:22
447000 -- (-1943.010) (-1940.797) [-1943.661] (-1941.207) * (-1942.541) (-1942.906) [-1943.023] (-1939.768) -- 0:04:21
448000 -- (-1946.872) (-1947.238) (-1949.539) [-1939.974] * (-1954.236) (-1943.733) (-1949.796) [-1948.859] -- 0:04:21
449000 -- [-1937.415] (-1945.950) (-1943.628) (-1946.311) * (-1939.500) (-1939.138) (-1946.395) [-1941.770] -- 0:04:20
450000 -- (-1945.366) (-1944.312) [-1943.181] (-1945.275) * (-1943.752) (-1949.394) (-1950.500) [-1943.416] -- 0:04:20
Average standard deviation of split frequencies: 0.011274
451000 -- [-1941.928] (-1942.320) (-1940.963) (-1941.440) * (-1941.160) [-1939.227] (-1951.696) (-1939.254) -- 0:04:19
452000 -- (-1942.562) (-1943.499) (-1941.521) [-1936.095] * (-1945.734) (-1938.894) (-1954.162) [-1943.181] -- 0:04:18
453000 -- [-1938.577] (-1947.067) (-1942.981) (-1945.105) * [-1941.433] (-1940.495) (-1944.063) (-1945.860) -- 0:04:18
454000 -- (-1939.772) (-1945.398) (-1947.351) [-1941.889] * (-1944.889) (-1940.052) [-1942.186] (-1947.940) -- 0:04:17
455000 -- [-1941.603] (-1942.566) (-1942.992) (-1943.078) * (-1947.350) (-1945.009) [-1944.251] (-1941.079) -- 0:04:17
Average standard deviation of split frequencies: 0.009419
456000 -- (-1939.899) [-1944.927] (-1944.476) (-1948.140) * (-1942.881) [-1940.771] (-1950.667) (-1941.540) -- 0:04:16
457000 -- [-1942.621] (-1949.448) (-1937.603) (-1943.868) * (-1944.831) [-1943.552] (-1944.467) (-1950.370) -- 0:04:16
458000 -- (-1943.647) (-1945.228) [-1946.187] (-1936.413) * (-1945.648) (-1943.588) [-1943.565] (-1948.851) -- 0:04:15
459000 -- (-1941.565) (-1943.306) (-1943.359) [-1939.205] * (-1942.841) (-1944.507) (-1939.634) [-1937.212] -- 0:04:15
460000 -- [-1944.071] (-1942.007) (-1943.888) (-1957.836) * (-1940.274) [-1942.292] (-1944.603) (-1944.288) -- 0:04:14
Average standard deviation of split frequencies: 0.010361
461000 -- (-1940.446) [-1947.434] (-1942.985) (-1943.295) * (-1950.867) (-1940.739) [-1940.665] (-1943.431) -- 0:04:14
462000 -- (-1945.497) (-1947.101) [-1941.113] (-1943.726) * [-1939.880] (-1942.968) (-1943.003) (-1947.043) -- 0:04:13
463000 -- (-1944.171) (-1943.233) (-1940.348) [-1946.413] * [-1943.015] (-1947.526) (-1945.511) (-1942.622) -- 0:04:14
464000 -- (-1947.912) (-1947.881) [-1940.538] (-1945.550) * (-1944.690) (-1942.650) [-1949.608] (-1942.611) -- 0:04:12
465000 -- (-1947.123) (-1947.396) (-1943.586) [-1944.364] * (-1942.426) (-1939.059) (-1942.906) [-1945.965] -- 0:04:13
Average standard deviation of split frequencies: 0.009891
466000 -- (-1953.402) [-1939.687] (-1944.148) (-1948.301) * (-1956.424) (-1942.004) [-1945.872] (-1945.236) -- 0:04:12
467000 -- (-1941.643) (-1948.281) (-1945.972) [-1939.761] * (-1945.621) (-1939.739) [-1939.566] (-1943.355) -- 0:04:12
468000 -- (-1937.015) [-1946.696] (-1946.995) (-1944.324) * (-1943.076) (-1947.274) [-1947.507] (-1938.637) -- 0:04:11
469000 -- (-1945.026) [-1941.661] (-1942.284) (-1939.849) * [-1940.132] (-1943.975) (-1948.805) (-1945.444) -- 0:04:10
470000 -- (-1947.749) [-1942.278] (-1942.903) (-1940.140) * [-1952.968] (-1936.019) (-1947.931) (-1935.860) -- 0:04:10
Average standard deviation of split frequencies: 0.009390
471000 -- (-1945.349) (-1947.796) [-1944.072] (-1940.615) * (-1937.708) [-1940.417] (-1951.358) (-1943.514) -- 0:04:09
472000 -- [-1938.330] (-1946.276) (-1945.278) (-1941.026) * (-1936.256) (-1941.390) (-1944.871) [-1944.902] -- 0:04:09
473000 -- (-1947.341) (-1940.267) [-1946.296] (-1943.361) * [-1939.142] (-1938.804) (-1950.392) (-1942.044) -- 0:04:08
474000 -- (-1945.857) [-1943.494] (-1944.681) (-1939.613) * [-1942.435] (-1945.428) (-1946.910) (-1950.634) -- 0:04:08
475000 -- (-1940.039) (-1942.663) [-1938.872] (-1949.998) * (-1941.554) [-1942.169] (-1945.927) (-1950.950) -- 0:04:07
Average standard deviation of split frequencies: 0.008294
476000 -- [-1947.290] (-1946.288) (-1941.511) (-1945.926) * [-1944.622] (-1954.859) (-1944.063) (-1945.269) -- 0:04:07
477000 -- (-1944.918) (-1948.471) [-1941.784] (-1944.346) * [-1940.921] (-1941.821) (-1947.150) (-1948.656) -- 0:04:06
478000 -- (-1941.212) (-1942.728) (-1943.191) [-1941.609] * (-1940.945) (-1953.070) [-1947.086] (-1944.602) -- 0:04:06
479000 -- (-1941.290) [-1943.819] (-1953.593) (-1945.778) * (-1942.077) [-1939.069] (-1943.358) (-1964.536) -- 0:04:05
480000 -- [-1939.491] (-1951.071) (-1944.939) (-1938.184) * (-1939.289) [-1937.933] (-1943.012) (-1946.451) -- 0:04:05
Average standard deviation of split frequencies: 0.007478
481000 -- (-1944.167) [-1946.097] (-1945.335) (-1948.921) * [-1944.814] (-1942.215) (-1946.744) (-1940.032) -- 0:04:04
482000 -- (-1943.755) (-1943.213) (-1949.129) [-1943.387] * (-1947.599) (-1944.592) [-1941.967] (-1955.399) -- 0:04:05
483000 -- (-1944.480) (-1951.764) (-1944.407) [-1949.344] * (-1938.481) [-1939.858] (-1944.838) (-1960.273) -- 0:04:04
484000 -- [-1942.440] (-1941.955) (-1940.856) (-1951.782) * (-1939.167) [-1944.579] (-1943.146) (-1948.957) -- 0:04:04
485000 -- (-1952.354) (-1940.815) (-1947.729) [-1941.877] * (-1941.628) (-1942.047) [-1943.946] (-1950.144) -- 0:04:03
Average standard deviation of split frequencies: 0.007275
486000 -- [-1946.190] (-1951.920) (-1947.143) (-1942.957) * (-1945.083) (-1942.367) [-1943.134] (-1943.221) -- 0:04:03
487000 -- [-1944.144] (-1945.518) (-1950.710) (-1952.425) * (-1941.015) (-1947.968) [-1944.225] (-1943.226) -- 0:04:02
488000 -- [-1943.493] (-1953.590) (-1948.530) (-1942.165) * (-1954.020) [-1947.956] (-1944.474) (-1939.741) -- 0:04:01
489000 -- (-1944.093) (-1942.625) [-1936.191] (-1951.138) * (-1941.557) (-1939.796) [-1944.470] (-1942.303) -- 0:04:01
490000 -- (-1946.709) (-1944.199) (-1942.137) [-1943.675] * (-1937.971) [-1936.858] (-1943.520) (-1947.183) -- 0:04:00
Average standard deviation of split frequencies: 0.006965
491000 -- (-1943.874) [-1943.720] (-1940.968) (-1945.499) * (-1947.540) (-1946.823) (-1947.283) [-1943.438] -- 0:04:00
492000 -- (-1947.079) (-1944.331) (-1944.038) [-1941.886] * (-1945.183) (-1944.301) (-1949.248) [-1943.729] -- 0:03:59
493000 -- (-1940.761) (-1938.415) [-1948.079] (-1946.618) * (-1943.687) (-1939.401) (-1942.316) [-1946.018] -- 0:03:59
494000 -- (-1945.109) (-1944.465) (-1943.660) [-1942.104] * (-1944.940) (-1941.740) [-1947.224] (-1940.146) -- 0:03:58
495000 -- (-1942.396) (-1942.573) (-1939.354) [-1943.042] * (-1948.683) [-1941.188] (-1952.263) (-1940.499) -- 0:03:58
Average standard deviation of split frequencies: 0.007960
496000 -- [-1941.754] (-1942.555) (-1945.526) (-1947.817) * (-1947.378) (-1946.716) (-1955.006) [-1942.112] -- 0:03:57
497000 -- [-1943.716] (-1944.759) (-1940.219) (-1949.783) * (-1945.135) [-1948.827] (-1947.677) (-1944.431) -- 0:03:57
498000 -- (-1949.472) [-1943.241] (-1943.854) (-1951.895) * [-1942.848] (-1944.868) (-1948.300) (-1942.533) -- 0:03:56
499000 -- (-1944.148) [-1938.148] (-1942.287) (-1945.348) * (-1944.010) (-1955.176) (-1948.136) [-1942.054] -- 0:03:56
500000 -- (-1947.442) (-1939.340) (-1944.058) [-1947.703] * (-1939.960) (-1945.475) [-1940.761] (-1948.017) -- 0:03:56
Average standard deviation of split frequencies: 0.007650
501000 -- (-1940.049) (-1954.881) [-1944.878] (-1939.490) * (-1939.823) (-1946.914) (-1946.347) [-1944.667] -- 0:03:56
502000 -- (-1942.593) [-1947.595] (-1941.291) (-1942.672) * [-1939.853] (-1944.130) (-1942.695) (-1944.465) -- 0:03:55
503000 -- (-1942.231) (-1946.053) [-1945.505] (-1939.714) * [-1943.181] (-1945.190) (-1946.201) (-1945.340) -- 0:03:55
504000 -- (-1945.708) (-1942.530) (-1943.206) [-1943.285] * (-1943.861) (-1946.774) (-1944.790) [-1944.267] -- 0:03:54
505000 -- [-1941.042] (-1940.881) (-1940.931) (-1951.431) * (-1943.295) (-1941.654) [-1944.441] (-1943.667) -- 0:03:54
Average standard deviation of split frequencies: 0.008074
506000 -- (-1952.158) (-1942.183) (-1943.879) [-1943.538] * (-1941.384) (-1946.779) [-1946.909] (-1947.636) -- 0:03:53
507000 -- (-1943.803) (-1942.405) [-1944.319] (-1943.422) * [-1941.675] (-1941.466) (-1937.194) (-1942.273) -- 0:03:52
508000 -- (-1941.807) [-1942.600] (-1946.346) (-1946.433) * (-1939.172) [-1939.640] (-1941.897) (-1949.731) -- 0:03:52
509000 -- [-1942.636] (-1940.534) (-1943.482) (-1941.143) * (-1953.509) (-1938.478) (-1941.900) [-1945.951] -- 0:03:51
510000 -- (-1938.915) (-1941.007) [-1940.113] (-1947.533) * (-1944.569) (-1944.726) [-1937.708] (-1941.780) -- 0:03:51
Average standard deviation of split frequencies: 0.008308
511000 -- (-1945.978) (-1946.241) (-1947.057) [-1944.388] * (-1950.429) [-1943.826] (-1947.658) (-1942.250) -- 0:03:50
512000 -- (-1941.782) [-1943.852] (-1944.317) (-1942.580) * (-1942.189) (-1948.658) [-1946.962] (-1946.575) -- 0:03:50
513000 -- [-1946.626] (-1944.735) (-1946.117) (-1937.988) * [-1942.757] (-1939.563) (-1939.477) (-1948.955) -- 0:03:49
514000 -- (-1943.500) [-1941.259] (-1940.735) (-1944.745) * (-1944.308) (-1946.567) [-1947.053] (-1943.047) -- 0:03:49
515000 -- (-1943.224) (-1943.291) [-1949.546] (-1948.355) * (-1944.119) (-1947.362) (-1940.646) [-1946.987] -- 0:03:48
Average standard deviation of split frequencies: 0.008108
516000 -- (-1946.074) (-1950.184) (-1946.871) [-1943.525] * (-1940.933) (-1945.255) (-1942.469) [-1946.159] -- 0:03:48
517000 -- [-1944.643] (-1939.246) (-1949.248) (-1948.040) * (-1942.692) (-1943.252) (-1946.856) [-1949.381] -- 0:03:47
518000 -- (-1940.753) (-1941.015) (-1946.823) [-1939.951] * (-1942.455) (-1939.743) [-1949.038] (-1940.899) -- 0:03:47
519000 -- (-1946.671) [-1947.534] (-1944.524) (-1940.169) * [-1936.724] (-1943.291) (-1941.107) (-1944.276) -- 0:03:47
520000 -- (-1941.555) [-1945.609] (-1949.485) (-1948.749) * (-1935.811) (-1949.431) [-1938.275] (-1942.442) -- 0:03:47
Average standard deviation of split frequencies: 0.009054
521000 -- (-1938.864) (-1943.777) [-1940.371] (-1948.176) * [-1938.651] (-1939.757) (-1945.791) (-1941.992) -- 0:03:46
522000 -- (-1944.351) (-1949.208) (-1953.924) [-1946.120] * (-1939.774) (-1944.665) (-1939.474) [-1942.289] -- 0:03:46
523000 -- [-1941.338] (-1941.931) (-1943.545) (-1942.152) * (-1943.122) [-1937.845] (-1940.019) (-1936.171) -- 0:03:45
524000 -- [-1944.937] (-1942.586) (-1951.275) (-1943.931) * (-1943.582) [-1938.441] (-1944.945) (-1940.221) -- 0:03:44
525000 -- (-1937.998) (-1948.396) [-1948.497] (-1944.432) * (-1942.572) (-1939.842) [-1945.152] (-1945.357) -- 0:03:44
Average standard deviation of split frequencies: 0.008962
526000 -- (-1943.281) (-1948.200) [-1941.450] (-1942.928) * (-1941.092) (-1943.038) [-1951.807] (-1935.703) -- 0:03:43
527000 -- (-1942.102) (-1937.831) (-1939.142) [-1940.561] * (-1941.074) [-1942.799] (-1947.028) (-1944.139) -- 0:03:43
528000 -- (-1945.142) (-1942.942) [-1937.937] (-1944.055) * (-1943.873) [-1947.350] (-1941.232) (-1946.859) -- 0:03:42
529000 -- (-1947.376) (-1944.280) [-1942.739] (-1948.244) * (-1942.109) (-1943.612) [-1941.393] (-1947.805) -- 0:03:42
530000 -- [-1938.444] (-1949.176) (-1943.301) (-1942.779) * (-1943.261) [-1941.963] (-1949.216) (-1947.634) -- 0:03:41
Average standard deviation of split frequencies: 0.009438
531000 -- (-1942.114) [-1945.926] (-1941.543) (-1943.231) * [-1941.984] (-1941.753) (-1942.226) (-1948.633) -- 0:03:41
532000 -- [-1943.461] (-1950.214) (-1951.107) (-1947.191) * (-1947.812) [-1943.233] (-1941.400) (-1952.479) -- 0:03:40
533000 -- (-1946.439) (-1944.040) (-1939.610) [-1942.971] * (-1941.309) [-1941.646] (-1951.547) (-1952.461) -- 0:03:40
534000 -- (-1946.143) (-1938.595) [-1950.497] (-1949.463) * (-1944.015) [-1942.017] (-1948.164) (-1941.320) -- 0:03:39
535000 -- (-1942.016) [-1941.403] (-1945.083) (-1946.807) * (-1944.971) [-1940.736] (-1940.778) (-1949.577) -- 0:03:39
Average standard deviation of split frequencies: 0.010224
536000 -- (-1945.117) (-1941.493) [-1944.465] (-1946.608) * (-1944.156) (-1938.306) (-1940.224) [-1944.943] -- 0:03:39
537000 -- (-1941.959) (-1941.464) [-1944.731] (-1949.041) * (-1939.690) (-1947.031) (-1944.324) [-1944.335] -- 0:03:38
538000 -- [-1943.539] (-1948.973) (-1949.954) (-1946.931) * [-1938.686] (-1943.820) (-1944.774) (-1937.664) -- 0:03:38
539000 -- (-1943.256) (-1948.333) [-1944.412] (-1945.194) * [-1943.121] (-1950.245) (-1949.322) (-1941.233) -- 0:03:38
540000 -- (-1941.233) (-1947.364) (-1947.628) [-1945.192] * (-1942.864) [-1944.226] (-1952.159) (-1940.774) -- 0:03:37
Average standard deviation of split frequencies: 0.009591
541000 -- (-1944.223) (-1949.611) [-1947.024] (-1943.723) * [-1942.428] (-1943.939) (-1946.225) (-1947.457) -- 0:03:36
542000 -- (-1949.644) (-1944.505) [-1942.138] (-1942.884) * (-1942.554) [-1943.140] (-1941.751) (-1948.491) -- 0:03:36
543000 -- (-1943.842) (-1946.070) [-1940.780] (-1941.675) * (-1942.810) [-1940.196] (-1943.492) (-1951.703) -- 0:03:35
544000 -- (-1947.833) (-1944.385) [-1942.775] (-1940.336) * (-1946.426) (-1942.749) [-1947.273] (-1944.723) -- 0:03:35
545000 -- (-1944.801) [-1947.415] (-1944.657) (-1941.857) * [-1940.852] (-1939.239) (-1940.299) (-1940.012) -- 0:03:34
Average standard deviation of split frequencies: 0.010145
546000 -- (-1952.395) (-1946.594) (-1941.133) [-1939.777] * (-1943.790) (-1947.380) (-1942.332) [-1942.495] -- 0:03:34
547000 -- (-1947.612) (-1946.351) [-1943.716] (-1948.820) * (-1947.374) (-1944.040) (-1943.510) [-1946.042] -- 0:03:33
548000 -- (-1948.714) (-1951.611) (-1946.792) [-1940.388] * (-1942.810) (-1943.037) (-1944.619) [-1947.257] -- 0:03:33
549000 -- (-1945.753) (-1941.839) [-1945.233] (-1936.443) * (-1942.406) (-1955.378) (-1937.333) [-1943.372] -- 0:03:32
550000 -- (-1946.843) (-1940.702) [-1947.102] (-1938.400) * (-1941.663) (-1944.119) [-1945.983] (-1939.124) -- 0:03:32
Average standard deviation of split frequencies: 0.011557
551000 -- (-1951.143) (-1951.103) [-1942.432] (-1946.735) * [-1936.809] (-1938.063) (-1944.718) (-1943.227) -- 0:03:31
552000 -- [-1947.337] (-1944.320) (-1949.428) (-1944.663) * (-1940.261) (-1946.341) (-1947.895) [-1939.423] -- 0:03:31
553000 -- (-1949.207) (-1943.427) [-1945.758] (-1943.582) * (-1939.782) (-1949.384) [-1945.377] (-1942.704) -- 0:03:30
554000 -- (-1942.738) [-1941.984] (-1943.068) (-1941.239) * (-1945.458) [-1949.433] (-1943.826) (-1952.759) -- 0:03:30
555000 -- (-1948.171) [-1943.255] (-1947.213) (-1941.799) * (-1943.498) (-1952.054) [-1941.738] (-1949.606) -- 0:03:30
Average standard deviation of split frequencies: 0.011446
556000 -- (-1946.192) [-1947.203] (-1945.128) (-1949.593) * (-1944.263) (-1968.084) [-1942.582] (-1941.123) -- 0:03:30
557000 -- (-1942.768) [-1936.552] (-1942.778) (-1942.920) * [-1940.769] (-1950.270) (-1942.217) (-1944.520) -- 0:03:29
558000 -- [-1941.275] (-1943.771) (-1944.594) (-1950.097) * (-1946.450) (-1944.807) [-1944.757] (-1949.003) -- 0:03:29
559000 -- (-1952.240) (-1945.127) [-1943.805] (-1943.922) * [-1945.443] (-1946.662) (-1945.750) (-1938.939) -- 0:03:28
560000 -- [-1949.517] (-1944.733) (-1948.627) (-1942.378) * (-1941.160) [-1944.609] (-1943.014) (-1948.328) -- 0:03:28
Average standard deviation of split frequencies: 0.011035
561000 -- (-1942.652) [-1939.446] (-1943.166) (-1942.364) * [-1945.616] (-1946.430) (-1944.872) (-1950.354) -- 0:03:27
562000 -- (-1945.730) (-1950.092) (-1939.161) [-1939.656] * (-1945.406) (-1944.759) (-1943.179) [-1945.753] -- 0:03:26
563000 -- (-1950.494) (-1942.753) [-1940.783] (-1944.436) * (-1949.886) (-1947.879) (-1945.483) [-1939.509] -- 0:03:26
564000 -- (-1945.837) [-1945.487] (-1943.072) (-1943.427) * (-1947.122) (-1948.068) [-1943.457] (-1940.894) -- 0:03:25
565000 -- (-1950.433) [-1942.294] (-1943.027) (-1946.923) * [-1939.718] (-1944.065) (-1946.141) (-1950.403) -- 0:03:25
Average standard deviation of split frequencies: 0.010411
566000 -- (-1941.381) (-1940.851) [-1942.397] (-1944.352) * (-1948.244) (-1949.962) [-1952.309] (-1951.801) -- 0:03:24
567000 -- [-1943.152] (-1944.766) (-1943.230) (-1940.930) * (-1949.399) [-1947.344] (-1944.522) (-1941.455) -- 0:03:24
568000 -- (-1939.769) (-1954.288) [-1944.921] (-1941.010) * [-1944.828] (-1946.376) (-1951.452) (-1939.173) -- 0:03:23
569000 -- (-1943.689) [-1943.602] (-1943.631) (-1945.128) * (-1946.581) [-1945.423] (-1944.960) (-1939.255) -- 0:03:23
570000 -- (-1940.397) [-1944.113] (-1940.810) (-1943.465) * [-1944.270] (-1946.904) (-1941.477) (-1941.958) -- 0:03:22
Average standard deviation of split frequencies: 0.011049
571000 -- (-1950.802) (-1939.108) [-1945.006] (-1940.599) * (-1945.338) (-1945.039) (-1943.098) [-1941.390] -- 0:03:22
572000 -- (-1944.289) (-1938.395) (-1947.494) [-1937.481] * (-1941.469) (-1944.263) [-1947.689] (-1942.884) -- 0:03:22
573000 -- (-1941.555) [-1945.393] (-1941.075) (-1943.830) * [-1944.768] (-1946.610) (-1944.076) (-1944.114) -- 0:03:21
574000 -- (-1942.883) (-1942.832) (-1947.201) [-1943.853] * [-1938.154] (-1946.615) (-1940.050) (-1942.664) -- 0:03:21
575000 -- (-1940.188) (-1951.571) [-1943.436] (-1943.023) * (-1940.838) (-1944.305) (-1951.547) [-1945.698] -- 0:03:21
Average standard deviation of split frequencies: 0.010128
576000 -- (-1943.556) (-1946.718) [-1945.451] (-1945.621) * (-1949.056) (-1942.004) (-1939.583) [-1939.128] -- 0:03:20
577000 -- (-1943.454) [-1945.724] (-1943.156) (-1944.484) * [-1944.551] (-1946.373) (-1944.976) (-1942.523) -- 0:03:20
578000 -- (-1944.071) (-1943.177) [-1939.232] (-1952.706) * (-1940.065) (-1942.246) (-1953.410) [-1952.383] -- 0:03:19
579000 -- (-1946.757) [-1950.024] (-1947.133) (-1939.695) * (-1949.003) (-1943.128) (-1955.187) [-1941.551] -- 0:03:18
580000 -- (-1939.672) (-1943.161) (-1947.153) [-1937.538] * (-1944.119) [-1941.925] (-1943.913) (-1936.642) -- 0:03:18
Average standard deviation of split frequencies: 0.009133
581000 -- (-1951.723) (-1940.142) (-1947.116) [-1941.113] * (-1949.910) (-1948.680) [-1941.785] (-1937.415) -- 0:03:17
582000 -- (-1953.148) [-1940.758] (-1945.590) (-1946.301) * [-1947.707] (-1949.272) (-1950.769) (-1941.109) -- 0:03:17
583000 -- [-1943.682] (-1954.040) (-1946.409) (-1942.409) * (-1944.981) (-1946.705) [-1947.210] (-1940.642) -- 0:03:16
584000 -- [-1937.482] (-1943.235) (-1940.565) (-1943.565) * (-1943.612) (-1944.731) [-1941.839] (-1948.514) -- 0:03:16
585000 -- [-1942.340] (-1942.963) (-1940.335) (-1941.144) * (-1948.516) (-1946.350) (-1937.833) [-1944.463] -- 0:03:15
Average standard deviation of split frequencies: 0.009050
586000 -- (-1942.188) (-1945.066) [-1945.592] (-1944.138) * (-1945.826) (-1941.720) [-1940.968] (-1947.226) -- 0:03:15
587000 -- [-1936.383] (-1940.990) (-1938.334) (-1945.833) * (-1946.923) (-1947.115) [-1940.489] (-1947.006) -- 0:03:14
588000 -- (-1943.400) (-1948.532) (-1944.853) [-1941.463] * (-1945.470) [-1937.131] (-1947.918) (-1948.793) -- 0:03:14
589000 -- (-1941.140) [-1945.039] (-1946.962) (-1938.226) * (-1942.814) (-1941.771) [-1945.449] (-1950.995) -- 0:03:13
590000 -- (-1945.004) [-1939.665] (-1950.006) (-1940.269) * (-1947.126) [-1944.368] (-1936.585) (-1947.219) -- 0:03:13
Average standard deviation of split frequencies: 0.007881
591000 -- [-1943.524] (-1953.193) (-1943.266) (-1943.306) * (-1941.417) (-1949.269) (-1941.358) [-1943.344] -- 0:03:13
592000 -- [-1942.713] (-1944.062) (-1943.375) (-1940.753) * [-1944.566] (-1938.981) (-1940.599) (-1945.249) -- 0:03:12
593000 -- [-1941.428] (-1942.321) (-1938.488) (-1946.138) * (-1943.177) [-1938.796] (-1944.292) (-1946.565) -- 0:03:12
594000 -- [-1946.196] (-1944.271) (-1944.102) (-1946.653) * [-1944.385] (-1940.810) (-1950.576) (-1952.208) -- 0:03:11
595000 -- [-1943.811] (-1938.695) (-1949.349) (-1943.316) * (-1953.699) (-1945.481) [-1938.433] (-1945.614) -- 0:03:11
Average standard deviation of split frequencies: 0.008008
596000 -- (-1949.400) (-1951.641) (-1947.825) [-1944.098] * (-1946.973) (-1943.901) [-1942.821] (-1943.583) -- 0:03:10
597000 -- [-1943.491] (-1949.705) (-1945.876) (-1936.239) * (-1945.741) (-1945.178) [-1943.360] (-1946.414) -- 0:03:10
598000 -- (-1943.557) (-1943.700) (-1951.468) [-1947.038] * [-1946.917] (-1939.843) (-1949.969) (-1945.184) -- 0:03:09
599000 -- (-1939.942) (-1944.983) (-1945.935) [-1941.828] * (-1946.810) (-1942.989) [-1942.867] (-1944.807) -- 0:03:09
600000 -- (-1945.604) (-1936.718) (-1948.886) [-1944.840] * (-1944.580) (-1946.005) [-1942.187] (-1936.456) -- 0:03:08
Average standard deviation of split frequencies: 0.008633
601000 -- (-1940.575) (-1945.086) [-1952.477] (-1941.589) * (-1952.889) [-1939.857] (-1948.074) (-1944.412) -- 0:03:08
602000 -- (-1950.623) [-1943.928] (-1949.015) (-1939.455) * (-1945.078) (-1943.470) (-1942.219) [-1940.012] -- 0:03:07
603000 -- (-1948.971) (-1942.220) (-1955.261) [-1936.925] * (-1941.687) [-1943.557] (-1941.996) (-1942.427) -- 0:03:07
604000 -- (-1950.990) (-1942.156) (-1944.140) [-1942.126] * [-1936.576] (-1941.611) (-1947.604) (-1942.053) -- 0:03:06
605000 -- (-1951.450) [-1950.413] (-1941.914) (-1943.943) * [-1936.657] (-1944.946) (-1941.149) (-1942.703) -- 0:03:06
Average standard deviation of split frequencies: 0.008038
606000 -- (-1942.952) (-1942.579) (-1941.255) [-1944.580] * (-1940.632) (-1942.810) (-1943.342) [-1943.589] -- 0:03:05
607000 -- (-1942.785) (-1941.378) (-1945.811) [-1942.392] * (-1944.984) (-1954.730) [-1944.277] (-1950.382) -- 0:03:05
608000 -- (-1945.385) (-1943.377) (-1943.822) [-1945.925] * (-1948.145) (-1944.032) [-1939.544] (-1942.171) -- 0:03:05
609000 -- (-1942.595) (-1944.316) [-1944.733] (-1946.429) * (-1946.064) [-1946.832] (-1947.274) (-1943.999) -- 0:03:04
610000 -- (-1942.187) (-1952.533) [-1942.119] (-1943.214) * (-1939.590) (-1944.532) (-1949.577) [-1940.280] -- 0:03:04
Average standard deviation of split frequencies: 0.007334
611000 -- (-1945.147) (-1953.951) [-1940.870] (-1945.616) * (-1952.318) [-1945.736] (-1946.935) (-1944.078) -- 0:03:03
612000 -- [-1944.684] (-1949.703) (-1949.970) (-1950.696) * (-1946.596) [-1941.475] (-1941.537) (-1944.886) -- 0:03:03
613000 -- (-1950.577) (-1949.304) (-1941.630) [-1948.430] * (-1943.875) (-1943.898) [-1944.634] (-1945.643) -- 0:03:03
614000 -- (-1950.543) [-1949.369] (-1944.212) (-1946.574) * (-1943.949) [-1947.581] (-1941.493) (-1943.759) -- 0:03:02
615000 -- (-1949.082) (-1940.173) (-1941.999) [-1947.694] * (-1947.638) (-1941.472) [-1948.861] (-1941.411) -- 0:03:01
Average standard deviation of split frequencies: 0.007844
616000 -- (-1945.545) [-1943.042] (-1947.680) (-1944.635) * [-1942.657] (-1944.024) (-1939.975) (-1943.077) -- 0:03:01
617000 -- [-1941.772] (-1939.802) (-1952.667) (-1940.518) * (-1940.472) (-1945.162) (-1941.843) [-1941.273] -- 0:03:00
618000 -- (-1948.496) (-1942.360) (-1946.095) [-1938.477] * (-1948.137) (-1936.973) (-1941.914) [-1942.279] -- 0:03:00
619000 -- (-1953.597) (-1957.705) (-1946.079) [-1953.349] * (-1947.368) (-1941.369) (-1944.777) [-1938.701] -- 0:02:59
620000 -- [-1949.940] (-1944.041) (-1943.477) (-1948.919) * [-1945.788] (-1943.729) (-1951.091) (-1942.641) -- 0:02:59
Average standard deviation of split frequencies: 0.007975
621000 -- (-1955.085) (-1947.034) [-1943.481] (-1947.734) * (-1952.803) (-1943.381) (-1947.177) [-1945.321] -- 0:02:58
622000 -- (-1947.339) [-1941.994] (-1942.924) (-1943.261) * (-1949.450) (-1951.455) (-1942.057) [-1938.416] -- 0:02:58
623000 -- (-1944.669) [-1941.113] (-1944.553) (-1938.506) * (-1944.174) [-1946.421] (-1947.460) (-1941.049) -- 0:02:57
624000 -- (-1943.639) [-1949.054] (-1938.067) (-1944.021) * (-1945.597) [-1940.103] (-1946.370) (-1938.782) -- 0:02:57
625000 -- [-1939.517] (-1952.745) (-1943.423) (-1942.858) * [-1939.878] (-1943.603) (-1942.596) (-1941.497) -- 0:02:57
Average standard deviation of split frequencies: 0.008472
626000 -- [-1936.668] (-1946.947) (-1950.100) (-1947.277) * (-1945.811) [-1941.651] (-1944.758) (-1942.560) -- 0:02:56
627000 -- [-1943.598] (-1942.814) (-1946.910) (-1944.365) * (-1946.889) [-1942.836] (-1948.195) (-1954.047) -- 0:02:56
628000 -- (-1944.394) (-1942.749) (-1944.618) [-1945.525] * (-1946.019) (-1938.142) [-1946.123] (-1959.426) -- 0:02:55
629000 -- (-1939.589) (-1953.182) [-1945.030] (-1941.539) * (-1949.650) (-1949.529) [-1946.665] (-1944.462) -- 0:02:55
630000 -- (-1942.534) [-1941.398] (-1938.718) (-1946.293) * (-1942.655) (-1940.021) (-1949.757) [-1941.249] -- 0:02:55
Average standard deviation of split frequencies: 0.008035
631000 -- (-1949.544) (-1943.861) [-1945.342] (-1939.430) * (-1939.289) (-1941.532) (-1946.566) [-1945.337] -- 0:02:54
632000 -- [-1944.479] (-1940.928) (-1940.112) (-1941.975) * (-1945.484) [-1944.401] (-1949.220) (-1939.667) -- 0:02:54
633000 -- (-1947.746) (-1947.168) (-1953.267) [-1943.154] * [-1946.942] (-1939.723) (-1945.460) (-1944.870) -- 0:02:53
634000 -- [-1943.864] (-1940.252) (-1953.461) (-1945.269) * (-1948.245) (-1941.670) [-1940.468] (-1941.093) -- 0:02:53
635000 -- (-1948.876) [-1941.864] (-1944.856) (-1944.117) * (-1940.951) (-1944.260) [-1939.340] (-1942.490) -- 0:02:52
Average standard deviation of split frequencies: 0.007134
636000 -- [-1939.229] (-1941.919) (-1947.510) (-1948.043) * (-1939.895) (-1946.792) (-1941.524) [-1946.763] -- 0:02:51
637000 -- [-1939.261] (-1948.249) (-1940.107) (-1947.169) * [-1939.683] (-1946.485) (-1939.726) (-1944.444) -- 0:02:51
638000 -- (-1946.573) (-1941.092) [-1940.062] (-1944.725) * (-1946.547) [-1944.351] (-1942.352) (-1937.941) -- 0:02:50
639000 -- (-1938.953) [-1941.538] (-1955.515) (-1945.065) * (-1950.187) (-1944.002) [-1941.398] (-1947.747) -- 0:02:50
640000 -- [-1945.358] (-1947.089) (-1943.696) (-1944.355) * (-1946.603) (-1943.404) (-1948.027) [-1938.106] -- 0:02:49
Average standard deviation of split frequencies: 0.006990
641000 -- (-1949.996) (-1939.915) (-1943.216) [-1945.009] * (-1947.567) (-1948.762) [-1946.137] (-1943.248) -- 0:02:49
642000 -- (-1956.098) (-1953.401) (-1953.955) [-1944.510] * (-1948.091) (-1949.505) (-1943.928) [-1941.425] -- 0:02:48
643000 -- (-1947.154) (-1948.862) [-1945.170] (-1954.195) * [-1944.926] (-1947.660) (-1941.318) (-1941.930) -- 0:02:48
644000 -- (-1944.076) [-1938.985] (-1941.022) (-1944.540) * (-1943.964) (-1944.710) (-1941.046) [-1940.566] -- 0:02:48
645000 -- (-1943.317) [-1937.574] (-1949.749) (-1949.885) * (-1944.252) (-1943.905) [-1939.404] (-1947.755) -- 0:02:47
Average standard deviation of split frequencies: 0.006841
646000 -- [-1945.131] (-1946.610) (-1943.578) (-1938.340) * (-1940.212) (-1950.858) [-1942.912] (-1950.508) -- 0:02:47
647000 -- (-1943.150) (-1939.666) (-1943.367) [-1942.653] * (-1943.758) [-1941.732] (-1950.123) (-1944.047) -- 0:02:46
648000 -- [-1945.779] (-1939.248) (-1944.542) (-1940.081) * (-1942.107) [-1948.231] (-1948.706) (-1940.346) -- 0:02:46
649000 -- (-1949.555) (-1939.525) (-1938.892) [-1946.261] * (-1940.081) (-1944.617) (-1941.901) [-1943.982] -- 0:02:46
650000 -- (-1938.061) [-1942.981] (-1949.399) (-1949.007) * (-1944.560) [-1942.952] (-1940.013) (-1939.779) -- 0:02:45
Average standard deviation of split frequencies: 0.006883
651000 -- (-1939.311) [-1944.828] (-1948.199) (-1950.275) * [-1946.181] (-1943.669) (-1945.500) (-1944.315) -- 0:02:45
652000 -- (-1949.657) (-1940.881) (-1945.974) [-1941.720] * (-1940.913) (-1945.904) (-1943.146) [-1944.743] -- 0:02:44
653000 -- [-1943.259] (-1937.644) (-1943.821) (-1947.930) * (-1946.935) (-1942.161) (-1946.678) [-1946.861] -- 0:02:44
654000 -- [-1943.092] (-1939.194) (-1945.349) (-1948.528) * [-1947.111] (-1940.139) (-1939.316) (-1941.515) -- 0:02:43
655000 -- (-1947.307) [-1947.109] (-1941.787) (-1943.989) * (-1946.080) [-1941.403] (-1944.411) (-1939.127) -- 0:02:43
Average standard deviation of split frequencies: 0.006467
656000 -- (-1941.251) [-1944.885] (-1945.820) (-1945.216) * (-1950.107) (-1949.427) (-1954.828) [-1944.284] -- 0:02:42
657000 -- (-1942.425) (-1947.518) [-1943.358] (-1947.163) * (-1942.218) [-1949.378] (-1952.988) (-1944.771) -- 0:02:41
658000 -- (-1940.510) (-1940.239) (-1945.130) [-1948.045] * (-1943.153) [-1942.625] (-1945.538) (-1946.770) -- 0:02:41
659000 -- (-1946.163) [-1942.893] (-1945.435) (-1949.503) * (-1946.702) [-1943.631] (-1946.792) (-1945.828) -- 0:02:40
660000 -- [-1944.329] (-1944.479) (-1944.694) (-1941.139) * (-1943.405) (-1950.345) [-1939.498] (-1951.366) -- 0:02:40
Average standard deviation of split frequencies: 0.005887
661000 -- [-1947.650] (-1938.380) (-1943.525) (-1946.068) * (-1947.488) (-1938.384) [-1945.090] (-1941.952) -- 0:02:40
662000 -- (-1945.359) (-1939.881) [-1941.932] (-1944.062) * [-1945.201] (-1944.128) (-1947.447) (-1946.504) -- 0:02:39
663000 -- (-1945.761) (-1945.557) [-1943.317] (-1943.712) * [-1938.397] (-1942.102) (-1945.793) (-1944.376) -- 0:02:39
664000 -- (-1941.605) [-1946.048] (-1940.233) (-1947.379) * (-1946.852) (-1942.718) [-1943.368] (-1941.955) -- 0:02:38
665000 -- (-1941.355) (-1945.553) (-1947.259) [-1941.372] * (-1940.447) (-1946.304) (-1944.381) [-1942.255] -- 0:02:38
Average standard deviation of split frequencies: 0.005486
666000 -- (-1939.377) (-1948.197) [-1947.024] (-1956.462) * (-1946.858) (-1943.566) (-1944.403) [-1940.491] -- 0:02:37
667000 -- (-1942.606) (-1946.771) [-1944.259] (-1947.497) * (-1945.466) [-1941.656] (-1944.333) (-1941.577) -- 0:02:37
668000 -- (-1946.537) [-1943.814] (-1949.701) (-1943.839) * (-1946.983) [-1942.331] (-1948.238) (-1946.881) -- 0:02:37
669000 -- [-1947.390] (-1941.503) (-1948.101) (-1946.611) * (-1949.086) (-1938.814) (-1947.466) [-1943.834] -- 0:02:36
670000 -- (-1941.730) (-1941.194) (-1939.322) [-1940.192] * [-1942.224] (-1946.510) (-1945.851) (-1950.587) -- 0:02:36
Average standard deviation of split frequencies: 0.005711
671000 -- (-1945.754) (-1940.553) [-1937.035] (-1943.745) * (-1946.465) (-1942.932) [-1940.742] (-1954.452) -- 0:02:35
672000 -- [-1947.315] (-1940.019) (-1950.462) (-1945.638) * (-1949.598) [-1947.017] (-1947.663) (-1946.534) -- 0:02:35
673000 -- (-1961.164) (-1942.746) [-1942.738] (-1939.579) * [-1941.078] (-1949.361) (-1944.659) (-1943.439) -- 0:02:34
674000 -- (-1943.921) (-1942.482) (-1941.016) [-1947.728] * (-1945.370) (-1952.756) [-1940.379] (-1944.016) -- 0:02:34
675000 -- (-1941.290) [-1938.290] (-1944.165) (-1940.917) * (-1943.650) (-1939.922) (-1941.331) [-1947.233] -- 0:02:33
Average standard deviation of split frequencies: 0.005143
676000 -- (-1948.666) (-1957.302) (-1945.839) [-1946.064] * (-1943.233) [-1946.066] (-1941.299) (-1944.159) -- 0:02:33
677000 -- (-1951.774) (-1942.695) [-1941.293] (-1947.054) * (-1949.997) (-1940.844) (-1946.274) [-1948.119] -- 0:02:32
678000 -- (-1939.055) (-1946.273) (-1942.594) [-1944.222] * (-1945.555) (-1944.685) (-1947.850) [-1940.867] -- 0:02:31
679000 -- [-1949.487] (-1942.136) (-1948.978) (-1940.511) * (-1943.060) (-1946.010) (-1941.472) [-1950.108] -- 0:02:31
680000 -- (-1944.082) [-1940.856] (-1946.914) (-1947.273) * (-1947.595) (-1944.929) (-1947.427) [-1941.735] -- 0:02:31
Average standard deviation of split frequencies: 0.004675
681000 -- (-1944.839) [-1937.395] (-1959.556) (-1950.784) * [-1944.441] (-1941.984) (-1946.345) (-1946.387) -- 0:02:30
682000 -- [-1945.640] (-1947.562) (-1946.996) (-1946.728) * (-1945.231) (-1942.922) [-1938.353] (-1940.110) -- 0:02:30
683000 -- (-1941.176) (-1948.580) [-1945.494] (-1950.779) * [-1945.223] (-1941.171) (-1947.895) (-1946.159) -- 0:02:29
684000 -- [-1941.530] (-1947.250) (-1945.955) (-1946.649) * (-1947.566) [-1947.787] (-1944.426) (-1942.913) -- 0:02:29
685000 -- [-1943.785] (-1943.683) (-1938.828) (-1947.635) * (-1948.027) [-1941.643] (-1949.630) (-1949.529) -- 0:02:28
Average standard deviation of split frequencies: 0.004638
686000 -- (-1943.992) (-1943.365) (-1938.341) [-1941.734] * (-1941.398) [-1947.367] (-1946.862) (-1947.749) -- 0:02:28
687000 -- (-1945.872) (-1950.191) (-1943.650) [-1942.422] * (-1942.574) (-1945.717) [-1940.119] (-1950.692) -- 0:02:28
688000 -- [-1939.900] (-1944.272) (-1938.802) (-1945.739) * (-1946.190) [-1946.334] (-1945.456) (-1943.196) -- 0:02:27
689000 -- (-1945.412) (-1944.597) [-1937.240] (-1943.467) * (-1941.732) (-1950.130) [-1941.006] (-1947.860) -- 0:02:27
690000 -- [-1944.123] (-1944.918) (-1939.803) (-1939.024) * (-1944.690) [-1941.803] (-1942.299) (-1942.503) -- 0:02:26
Average standard deviation of split frequencies: 0.004181
691000 -- (-1943.968) [-1945.621] (-1942.693) (-1940.503) * [-1938.714] (-1940.478) (-1942.443) (-1950.791) -- 0:02:26
692000 -- (-1942.633) (-1939.345) (-1940.702) [-1942.206] * [-1944.114] (-1946.379) (-1946.957) (-1943.930) -- 0:02:25
693000 -- (-1943.349) (-1942.869) (-1943.731) [-1946.190] * (-1939.523) (-1942.460) [-1944.954] (-1945.477) -- 0:02:25
694000 -- (-1940.835) [-1940.699] (-1941.722) (-1945.489) * (-1948.975) (-1942.513) [-1942.582] (-1940.913) -- 0:02:24
695000 -- (-1939.376) [-1947.275] (-1951.153) (-1938.377) * (-1945.001) (-1941.942) [-1945.729] (-1937.408) -- 0:02:24
Average standard deviation of split frequencies: 0.003387
696000 -- (-1945.072) (-1948.293) (-1942.705) [-1939.068] * [-1943.155] (-1944.779) (-1943.275) (-1943.574) -- 0:02:23
697000 -- (-1944.406) (-1944.601) [-1943.786] (-1946.214) * (-1942.215) [-1945.721] (-1947.975) (-1943.897) -- 0:02:23
698000 -- (-1944.646) (-1949.985) (-1944.089) [-1948.595] * (-1943.733) (-1944.417) (-1942.381) [-1945.306] -- 0:02:22
699000 -- (-1948.131) (-1945.908) [-1938.570] (-1953.362) * (-1944.704) (-1941.139) [-1939.083] (-1944.111) -- 0:02:22
700000 -- [-1953.075] (-1948.883) (-1942.779) (-1943.729) * [-1952.368] (-1943.495) (-1943.822) (-1946.993) -- 0:02:21
Average standard deviation of split frequencies: 0.003784
701000 -- (-1947.713) (-1943.726) (-1945.084) [-1947.928] * [-1941.227] (-1940.795) (-1943.592) (-1953.710) -- 0:02:21
702000 -- [-1941.259] (-1943.870) (-1940.796) (-1947.388) * [-1944.152] (-1942.501) (-1950.464) (-1944.132) -- 0:02:20
703000 -- (-1946.470) [-1945.073] (-1947.101) (-1947.190) * (-1945.541) (-1945.098) [-1942.954] (-1941.864) -- 0:02:20
704000 -- (-1943.664) (-1942.885) [-1948.755] (-1941.042) * [-1940.938] (-1942.734) (-1942.534) (-1941.151) -- 0:02:20
705000 -- (-1942.036) [-1940.408] (-1950.019) (-1938.364) * (-1946.335) (-1943.742) [-1941.008] (-1943.726) -- 0:02:19
Average standard deviation of split frequencies: 0.003088
706000 -- (-1942.129) (-1944.462) [-1941.225] (-1943.733) * [-1941.642] (-1951.559) (-1943.272) (-1942.516) -- 0:02:19
707000 -- (-1949.397) (-1955.748) (-1939.286) [-1946.556] * [-1938.295] (-1944.244) (-1948.573) (-1941.399) -- 0:02:18
708000 -- (-1941.106) (-1946.147) (-1943.153) [-1938.958] * [-1949.690] (-1942.032) (-1944.802) (-1943.302) -- 0:02:18
709000 -- (-1943.206) (-1944.643) [-1938.775] (-1938.749) * (-1945.051) (-1941.012) (-1942.838) [-1941.489] -- 0:02:17
710000 -- [-1947.024] (-1950.176) (-1941.344) (-1940.245) * (-1949.717) (-1941.157) [-1947.833] (-1946.994) -- 0:02:17
Average standard deviation of split frequencies: 0.003234
711000 -- (-1947.265) (-1943.758) (-1943.198) [-1948.258] * (-1949.820) (-1944.787) [-1942.632] (-1938.145) -- 0:02:16
712000 -- (-1942.185) (-1941.186) (-1953.953) [-1947.296] * (-1944.691) (-1940.584) [-1940.523] (-1943.286) -- 0:02:16
713000 -- (-1945.533) [-1942.078] (-1941.540) (-1944.042) * (-1942.696) [-1938.094] (-1941.637) (-1943.518) -- 0:02:15
714000 -- [-1945.005] (-1943.274) (-1948.159) (-1945.785) * (-1944.258) [-1943.641] (-1944.801) (-1939.891) -- 0:02:15
715000 -- (-1940.504) (-1942.702) (-1949.589) [-1938.882] * [-1940.024] (-1946.712) (-1942.391) (-1943.459) -- 0:02:14
Average standard deviation of split frequencies: 0.003539
716000 -- (-1943.847) (-1943.503) (-1947.788) [-1950.141] * (-1946.972) (-1948.206) [-1942.096] (-1942.563) -- 0:02:14
717000 -- (-1944.596) [-1940.113] (-1947.599) (-1943.085) * (-1941.975) (-1943.034) (-1951.027) [-1939.078] -- 0:02:13
718000 -- [-1939.009] (-1942.734) (-1947.505) (-1941.194) * (-1938.265) [-1942.082] (-1938.216) (-1941.374) -- 0:02:13
719000 -- (-1944.367) (-1943.950) [-1944.605] (-1938.518) * (-1943.015) [-1946.969] (-1941.557) (-1948.893) -- 0:02:12
720000 -- (-1942.548) [-1942.057] (-1940.380) (-1942.329) * (-1940.755) [-1947.977] (-1937.270) (-1945.785) -- 0:02:12
Average standard deviation of split frequencies: 0.003271
721000 -- (-1936.886) (-1937.374) (-1943.111) [-1949.431] * (-1942.291) [-1938.519] (-1954.762) (-1941.860) -- 0:02:11
722000 -- (-1939.338) (-1941.744) (-1943.097) [-1945.972] * (-1939.086) (-1940.849) [-1944.443] (-1946.637) -- 0:02:11
723000 -- (-1950.908) (-1947.523) [-1950.577] (-1939.268) * (-1938.774) (-1947.516) [-1945.515] (-1950.474) -- 0:02:11
724000 -- (-1938.752) [-1942.209] (-1942.682) (-1945.850) * (-1938.534) (-1947.266) [-1945.992] (-1944.509) -- 0:02:10
725000 -- (-1939.649) (-1940.510) (-1947.638) [-1942.513] * (-1946.330) (-1944.139) [-1941.896] (-1942.362) -- 0:02:10
Average standard deviation of split frequencies: 0.003084
726000 -- (-1952.301) [-1940.246] (-1943.086) (-1946.478) * (-1942.618) [-1950.465] (-1950.998) (-1947.564) -- 0:02:09
727000 -- [-1947.602] (-1942.526) (-1960.015) (-1943.191) * (-1948.682) [-1942.014] (-1951.342) (-1940.911) -- 0:02:09
728000 -- (-1943.507) (-1947.883) (-1954.169) [-1945.860] * [-1941.115] (-1944.758) (-1944.822) (-1944.528) -- 0:02:08
729000 -- (-1941.335) (-1947.022) (-1943.256) [-1943.874] * (-1943.919) (-1942.460) [-1951.113] (-1942.546) -- 0:02:08
730000 -- (-1946.925) (-1948.087) (-1941.148) [-1944.039] * [-1942.186] (-1940.164) (-1950.211) (-1945.655) -- 0:02:07
Average standard deviation of split frequencies: 0.003065
731000 -- (-1943.724) (-1941.994) [-1949.886] (-1946.728) * (-1945.772) (-1940.498) [-1938.309] (-1946.313) -- 0:02:07
732000 -- (-1940.486) [-1944.298] (-1945.987) (-1942.838) * (-1949.306) (-1943.284) [-1946.081] (-1942.276) -- 0:02:06
733000 -- [-1941.774] (-1937.699) (-1943.374) (-1945.940) * (-1939.782) (-1940.229) [-1943.134] (-1940.983) -- 0:02:06
734000 -- (-1951.347) (-1940.063) (-1940.847) [-1938.577] * (-1946.669) (-1942.790) (-1942.407) [-1940.414] -- 0:02:05
735000 -- (-1941.640) (-1940.427) [-1953.888] (-1944.164) * (-1944.387) (-1938.288) (-1939.984) [-1940.211] -- 0:02:05
Average standard deviation of split frequencies: 0.003763
736000 -- (-1944.109) (-1943.340) [-1943.722] (-1951.383) * (-1942.310) (-1938.749) (-1943.411) [-1944.080] -- 0:02:04
737000 -- [-1941.269] (-1948.667) (-1945.509) (-1939.715) * [-1947.779] (-1939.034) (-1941.769) (-1943.227) -- 0:02:04
738000 -- [-1942.041] (-1943.091) (-1941.587) (-1940.353) * [-1944.423] (-1947.394) (-1941.357) (-1939.489) -- 0:02:03
739000 -- (-1945.072) [-1940.530] (-1947.157) (-1943.386) * (-1941.987) (-1939.987) [-1947.601] (-1945.273) -- 0:02:03
740000 -- (-1946.492) [-1944.368] (-1944.809) (-1942.295) * (-1951.022) (-1941.192) [-1943.888] (-1947.631) -- 0:02:02
Average standard deviation of split frequencies: 0.003739
741000 -- (-1952.117) (-1946.135) (-1941.277) [-1937.378] * (-1944.555) (-1954.226) (-1942.108) [-1942.936] -- 0:02:02
742000 -- (-1945.120) [-1946.129] (-1948.370) (-1942.812) * (-1950.879) (-1948.831) (-1943.509) [-1940.473] -- 0:02:02
743000 -- (-1943.427) (-1942.647) [-1944.931] (-1944.350) * (-1948.796) (-1949.861) (-1948.562) [-1944.377] -- 0:02:01
744000 -- (-1964.386) (-1940.921) [-1945.828] (-1939.941) * (-1941.208) [-1941.674] (-1947.231) (-1945.159) -- 0:02:01
745000 -- (-1950.736) (-1943.372) [-1944.592] (-1946.391) * (-1944.153) (-1941.829) [-1944.872] (-1939.293) -- 0:02:00
Average standard deviation of split frequencies: 0.003633
746000 -- (-1941.817) [-1946.275] (-1944.089) (-1946.685) * (-1954.632) [-1946.800] (-1945.587) (-1948.977) -- 0:02:00
747000 -- (-1939.618) (-1944.913) [-1939.777] (-1947.047) * [-1941.999] (-1943.445) (-1946.527) (-1944.364) -- 0:01:59
748000 -- (-1940.341) (-1942.847) [-1937.682] (-1944.623) * (-1943.002) (-1952.385) (-1940.597) [-1946.332] -- 0:01:59
749000 -- [-1939.602] (-1938.650) (-1943.627) (-1942.423) * [-1940.905] (-1944.076) (-1943.491) (-1946.671) -- 0:01:58
750000 -- (-1945.117) [-1945.630] (-1941.179) (-1943.887) * (-1955.715) [-1938.181] (-1948.187) (-1944.207) -- 0:01:58
Average standard deviation of split frequencies: 0.002826
751000 -- [-1940.431] (-1940.383) (-1940.718) (-1942.179) * [-1950.689] (-1939.336) (-1944.849) (-1939.365) -- 0:01:57
752000 -- (-1942.669) (-1941.514) [-1940.882] (-1948.224) * (-1942.444) [-1945.910] (-1940.720) (-1942.810) -- 0:01:57
753000 -- (-1941.225) (-1945.498) (-1940.209) [-1945.811] * (-1942.615) (-1945.000) [-1940.580] (-1943.013) -- 0:01:56
754000 -- (-1950.837) [-1942.214] (-1946.080) (-1956.856) * (-1942.532) (-1947.295) [-1945.234] (-1940.074) -- 0:01:56
755000 -- (-1951.702) [-1938.368] (-1942.642) (-1942.648) * [-1940.382] (-1946.394) (-1938.302) (-1949.489) -- 0:01:55
Average standard deviation of split frequencies: 0.003507
756000 -- (-1946.674) [-1946.165] (-1941.281) (-1949.374) * [-1940.395] (-1941.775) (-1940.237) (-1942.362) -- 0:01:55
757000 -- (-1940.876) (-1942.058) [-1942.393] (-1946.104) * (-1945.301) (-1944.326) (-1944.341) [-1941.735] -- 0:01:54
758000 -- (-1953.031) (-1954.330) [-1944.375] (-1946.080) * (-1947.926) (-1946.291) (-1941.184) [-1946.793] -- 0:01:54
759000 -- [-1943.785] (-1943.627) (-1955.733) (-1939.671) * [-1941.684] (-1942.317) (-1943.262) (-1944.263) -- 0:01:53
760000 -- (-1941.257) [-1945.721] (-1944.302) (-1944.726) * [-1951.360] (-1945.697) (-1942.399) (-1944.353) -- 0:01:53
Average standard deviation of split frequencies: 0.003796
761000 -- (-1954.651) (-1942.769) [-1940.823] (-1943.680) * (-1941.950) (-1948.728) (-1944.489) [-1944.608] -- 0:01:53
762000 -- (-1952.315) [-1946.881] (-1938.806) (-1956.314) * (-1947.273) (-1943.440) (-1945.157) [-1945.703] -- 0:01:52
763000 -- [-1943.127] (-1941.902) (-1940.886) (-1943.190) * [-1949.348] (-1939.073) (-1946.199) (-1945.932) -- 0:01:52
764000 -- (-1946.175) (-1940.684) [-1937.988] (-1944.357) * [-1946.031] (-1948.138) (-1941.155) (-1947.553) -- 0:01:51
765000 -- (-1953.800) (-1943.598) (-1944.468) [-1943.716] * (-1954.477) (-1942.180) [-1936.917] (-1938.027) -- 0:01:51
Average standard deviation of split frequencies: 0.004231
766000 -- (-1947.893) (-1939.202) (-1944.559) [-1936.689] * (-1950.367) (-1940.158) [-1939.992] (-1948.887) -- 0:01:50
767000 -- [-1943.299] (-1941.276) (-1952.320) (-1948.993) * (-1939.936) (-1939.039) [-1943.466] (-1942.694) -- 0:01:50
768000 -- (-1944.358) (-1939.085) (-1949.126) [-1946.050] * [-1943.229] (-1937.873) (-1941.330) (-1949.370) -- 0:01:49
769000 -- (-1947.938) (-1939.678) (-1943.788) [-1941.460] * (-1939.484) (-1950.952) (-1944.300) [-1942.258] -- 0:01:49
770000 -- (-1938.570) (-1947.048) [-1946.503] (-1943.583) * (-1948.090) (-1946.690) [-1938.078] (-1949.260) -- 0:01:48
Average standard deviation of split frequencies: 0.004282
771000 -- [-1940.384] (-1951.222) (-1944.030) (-1941.382) * (-1944.738) (-1948.488) [-1943.769] (-1947.427) -- 0:01:48
772000 -- (-1954.966) (-1949.106) (-1942.288) [-1936.406] * (-1941.204) (-1949.399) [-1944.877] (-1950.043) -- 0:01:47
773000 -- [-1946.609] (-1943.602) (-1941.016) (-1949.210) * (-1945.955) (-1938.720) (-1946.279) [-1952.238] -- 0:01:47
774000 -- [-1939.002] (-1949.780) (-1943.571) (-1946.743) * (-1943.703) (-1940.376) (-1945.235) [-1945.138] -- 0:01:46
775000 -- (-1945.345) [-1947.594] (-1946.408) (-1945.964) * (-1948.817) [-1939.857] (-1939.245) (-1940.648) -- 0:01:46
Average standard deviation of split frequencies: 0.004936
776000 -- (-1941.137) (-1954.299) (-1949.383) [-1942.620] * (-1939.602) [-1943.819] (-1942.360) (-1943.408) -- 0:01:45
777000 -- [-1946.939] (-1943.570) (-1940.821) (-1943.485) * (-1947.155) [-1944.925] (-1944.617) (-1938.620) -- 0:01:45
778000 -- (-1948.394) (-1940.580) [-1946.783] (-1940.731) * (-1944.862) (-1939.602) [-1942.891] (-1938.326) -- 0:01:45
779000 -- (-1939.831) (-1947.144) [-1943.275] (-1946.783) * (-1947.134) [-1944.521] (-1945.589) (-1941.256) -- 0:01:44
780000 -- [-1939.595] (-1945.325) (-1950.598) (-1941.646) * (-1944.192) (-1953.197) [-1944.695] (-1948.137) -- 0:01:44
Average standard deviation of split frequencies: 0.004604
781000 -- (-1944.659) (-1939.756) [-1944.303] (-1943.573) * (-1947.617) [-1941.421] (-1941.835) (-1944.891) -- 0:01:43
782000 -- (-1947.849) (-1942.324) [-1941.043] (-1942.021) * [-1940.285] (-1943.869) (-1938.545) (-1942.956) -- 0:01:43
783000 -- (-1955.431) [-1945.804] (-1937.044) (-1945.611) * (-1944.956) (-1945.800) (-1937.458) [-1941.827] -- 0:01:42
784000 -- [-1945.069] (-1942.531) (-1935.418) (-1952.761) * [-1940.917] (-1948.519) (-1947.266) (-1953.088) -- 0:01:42
785000 -- [-1939.924] (-1949.618) (-1945.092) (-1941.568) * [-1939.747] (-1942.055) (-1947.758) (-1944.404) -- 0:01:41
Average standard deviation of split frequencies: 0.004423
786000 -- (-1945.299) (-1947.067) [-1942.526] (-1945.030) * [-1944.753] (-1943.688) (-1947.049) (-1943.124) -- 0:01:41
787000 -- [-1940.838] (-1939.933) (-1942.722) (-1944.066) * [-1936.866] (-1937.488) (-1950.883) (-1944.899) -- 0:01:40
788000 -- [-1939.077] (-1940.737) (-1945.760) (-1945.326) * (-1939.331) [-1946.352] (-1944.717) (-1949.523) -- 0:01:40
789000 -- (-1946.720) (-1942.267) (-1940.456) [-1947.918] * (-1947.319) (-1945.167) (-1943.901) [-1943.899] -- 0:01:39
790000 -- (-1956.596) [-1945.867] (-1938.048) (-1944.265) * (-1954.590) [-1947.977] (-1943.812) (-1945.116) -- 0:01:39
Average standard deviation of split frequencies: 0.004770
791000 -- (-1946.498) [-1949.328] (-1940.755) (-1941.677) * (-1946.873) (-1947.939) (-1951.567) [-1940.922] -- 0:01:38
792000 -- (-1939.099) [-1941.025] (-1939.537) (-1943.637) * (-1944.307) (-1943.578) [-1942.580] (-1943.334) -- 0:01:38
793000 -- (-1944.771) (-1938.618) (-1943.869) [-1940.099] * (-1938.004) (-1942.026) (-1953.250) [-1949.594] -- 0:01:37
794000 -- [-1946.152] (-1946.472) (-1952.218) (-1939.996) * (-1942.458) (-1950.612) (-1946.875) [-1944.937] -- 0:01:37
795000 -- [-1944.556] (-1946.687) (-1948.394) (-1946.392) * (-1938.963) (-1941.444) [-1943.450] (-1945.314) -- 0:01:36
Average standard deviation of split frequencies: 0.005182
796000 -- [-1947.946] (-1944.373) (-1942.276) (-1941.198) * (-1940.343) [-1945.310] (-1942.179) (-1949.831) -- 0:01:36
797000 -- [-1943.949] (-1939.792) (-1951.849) (-1941.770) * [-1949.621] (-1943.595) (-1948.395) (-1944.884) -- 0:01:36
798000 -- [-1941.150] (-1946.130) (-1945.220) (-1946.467) * [-1939.184] (-1939.733) (-1949.404) (-1949.275) -- 0:01:35
799000 -- (-1937.543) (-1945.313) (-1942.670) [-1944.101] * (-1943.873) [-1944.097] (-1944.678) (-1956.150) -- 0:01:35
800000 -- (-1941.478) (-1940.537) [-1939.332] (-1939.725) * (-1937.709) (-1944.674) [-1947.079] (-1942.457) -- 0:01:34
Average standard deviation of split frequencies: 0.004784
801000 -- (-1942.624) (-1945.678) [-1943.510] (-1946.359) * (-1943.513) [-1938.693] (-1945.330) (-1941.422) -- 0:01:34
802000 -- (-1944.664) (-1941.953) [-1948.981] (-1944.356) * (-1949.848) (-1940.840) (-1943.690) [-1938.394] -- 0:01:33
803000 -- (-1945.125) [-1946.123] (-1945.445) (-1939.322) * (-1942.963) (-1944.900) (-1947.135) [-1938.926] -- 0:01:33
804000 -- (-1950.763) (-1945.187) (-1943.864) [-1937.971] * (-1945.017) (-1941.644) [-1954.000] (-1944.684) -- 0:01:32
805000 -- (-1949.916) (-1937.455) (-1953.668) [-1950.536] * (-1940.549) (-1940.224) [-1939.243] (-1942.369) -- 0:01:32
Average standard deviation of split frequencies: 0.005264
806000 -- (-1939.841) [-1939.065] (-1945.825) (-1940.379) * (-1939.555) (-1942.914) (-1944.538) [-1942.017] -- 0:01:31
807000 -- [-1943.573] (-1939.412) (-1944.495) (-1940.653) * (-1945.467) [-1944.241] (-1942.782) (-1943.908) -- 0:01:31
808000 -- [-1948.661] (-1947.390) (-1943.360) (-1941.679) * (-1944.133) (-1940.284) [-1942.361] (-1941.876) -- 0:01:30
809000 -- (-1943.441) [-1947.566] (-1941.451) (-1960.238) * (-1938.821) (-1940.092) [-1943.068] (-1940.102) -- 0:01:30
810000 -- (-1940.085) (-1954.912) (-1941.242) [-1943.979] * (-1945.287) (-1948.343) [-1940.741] (-1943.007) -- 0:01:29
Average standard deviation of split frequencies: 0.006178
811000 -- [-1943.320] (-1944.893) (-1940.436) (-1948.445) * (-1941.921) (-1940.164) (-1945.911) [-1950.819] -- 0:01:29
812000 -- [-1944.268] (-1946.889) (-1942.831) (-1947.604) * (-1944.161) (-1941.526) [-1943.959] (-1944.314) -- 0:01:28
813000 -- (-1946.659) (-1941.268) [-1944.469] (-1945.613) * [-1950.249] (-1942.681) (-1948.238) (-1950.055) -- 0:01:28
814000 -- (-1940.520) (-1941.023) [-1938.418] (-1943.215) * (-1942.923) (-1939.797) (-1946.279) [-1942.025] -- 0:01:27
815000 -- (-1950.322) (-1939.113) [-1942.046] (-1949.025) * (-1947.718) [-1943.481] (-1949.288) (-1947.933) -- 0:01:27
Average standard deviation of split frequencies: 0.006571
816000 -- [-1941.355] (-1941.019) (-1943.294) (-1946.691) * (-1941.437) (-1951.949) (-1945.809) [-1943.245] -- 0:01:27
817000 -- (-1943.897) [-1947.217] (-1943.756) (-1940.451) * (-1938.898) (-1952.364) [-1943.264] (-1939.438) -- 0:01:26
818000 -- (-1940.293) (-1945.104) (-1948.439) [-1941.778] * [-1936.736] (-1941.955) (-1940.375) (-1939.060) -- 0:01:26
819000 -- (-1941.262) (-1947.452) [-1948.500] (-1942.178) * (-1948.039) [-1940.909] (-1946.465) (-1943.692) -- 0:01:25
820000 -- (-1941.042) (-1948.200) (-1946.110) [-1938.005] * (-1947.222) (-1940.720) [-1940.160] (-1942.516) -- 0:01:25
Average standard deviation of split frequencies: 0.006103
821000 -- (-1942.807) (-1946.494) (-1945.338) [-1946.462] * (-1940.782) (-1941.554) [-1940.298] (-1941.267) -- 0:01:24
822000 -- (-1939.546) [-1939.665] (-1955.926) (-1942.005) * (-1947.715) [-1950.604] (-1947.092) (-1940.339) -- 0:01:24
823000 -- (-1947.319) [-1943.732] (-1947.651) (-1953.219) * (-1941.848) (-1940.808) [-1945.433] (-1947.111) -- 0:01:23
824000 -- (-1943.405) (-1936.655) (-1939.673) [-1945.788] * [-1947.708] (-1945.079) (-1939.994) (-1945.317) -- 0:01:23
825000 -- (-1944.285) (-1943.303) (-1936.587) [-1942.045] * (-1949.127) (-1942.436) (-1951.160) [-1943.268] -- 0:01:22
Average standard deviation of split frequencies: 0.006206
826000 -- [-1944.718] (-1941.213) (-1944.308) (-1941.620) * (-1948.086) (-1946.286) [-1948.016] (-1938.473) -- 0:01:22
827000 -- (-1943.894) [-1944.719] (-1941.210) (-1947.035) * (-1940.948) [-1939.905] (-1940.787) (-1940.120) -- 0:01:21
828000 -- (-1938.546) (-1944.960) [-1937.624] (-1947.567) * [-1945.723] (-1944.728) (-1944.783) (-1944.145) -- 0:01:21
829000 -- (-1944.392) (-1940.592) [-1941.990] (-1939.917) * (-1940.864) [-1955.306] (-1954.466) (-1940.401) -- 0:01:20
830000 -- (-1948.492) (-1941.187) [-1942.666] (-1943.806) * [-1945.367] (-1941.641) (-1942.597) (-1945.269) -- 0:01:20
Average standard deviation of split frequencies: 0.007236
831000 -- (-1944.009) (-1945.793) [-1941.878] (-1939.057) * (-1944.390) (-1941.355) (-1940.543) [-1941.554] -- 0:01:19
832000 -- (-1938.834) (-1948.248) (-1937.453) [-1940.982] * (-1943.196) (-1956.986) (-1944.152) [-1942.080] -- 0:01:19
833000 -- (-1945.358) (-1949.051) [-1940.795] (-1950.569) * [-1948.605] (-1942.870) (-1948.032) (-1944.530) -- 0:01:18
834000 -- (-1937.949) [-1940.040] (-1943.895) (-1945.131) * (-1939.411) (-1941.853) (-1947.958) [-1942.224] -- 0:01:18
835000 -- [-1941.502] (-1943.934) (-1945.543) (-1953.398) * (-1938.384) (-1941.946) (-1944.894) [-1945.406] -- 0:01:18
Average standard deviation of split frequencies: 0.006485
836000 -- (-1941.013) [-1941.543] (-1940.036) (-1948.661) * [-1950.429] (-1943.799) (-1942.524) (-1945.048) -- 0:01:17
837000 -- [-1943.680] (-1943.858) (-1942.383) (-1942.386) * (-1941.541) (-1942.332) (-1944.259) [-1941.883] -- 0:01:17
838000 -- (-1944.379) [-1940.608] (-1946.919) (-1942.283) * (-1951.105) [-1943.815] (-1947.064) (-1949.162) -- 0:01:16
839000 -- (-1940.043) (-1941.188) [-1946.257] (-1950.411) * (-1942.342) (-1944.186) [-1945.094] (-1953.894) -- 0:01:16
840000 -- [-1940.458] (-1944.322) (-1944.192) (-1942.737) * (-1944.948) (-1945.184) (-1947.736) [-1936.444] -- 0:01:15
Average standard deviation of split frequencies: 0.007009
841000 -- (-1938.914) (-1941.225) [-1942.566] (-1943.947) * (-1941.421) [-1938.547] (-1945.047) (-1946.103) -- 0:01:15
842000 -- [-1941.665] (-1937.889) (-1956.307) (-1943.653) * [-1943.092] (-1939.085) (-1938.726) (-1942.736) -- 0:01:14
843000 -- [-1942.032] (-1939.048) (-1945.139) (-1945.167) * [-1944.539] (-1941.886) (-1950.915) (-1952.585) -- 0:01:14
844000 -- (-1946.118) (-1944.411) [-1951.756] (-1936.501) * (-1938.011) [-1944.092] (-1944.871) (-1951.101) -- 0:01:13
845000 -- (-1947.614) (-1943.764) (-1939.787) [-1938.622] * (-1941.503) (-1945.765) [-1940.140] (-1946.459) -- 0:01:13
Average standard deviation of split frequencies: 0.007105
846000 -- [-1942.443] (-1943.617) (-1949.277) (-1941.497) * (-1940.818) (-1939.936) (-1941.599) [-1944.521] -- 0:01:12
847000 -- (-1941.798) [-1951.927] (-1944.619) (-1946.487) * [-1942.377] (-1947.191) (-1946.724) (-1944.012) -- 0:01:12
848000 -- [-1939.442] (-1940.895) (-1940.906) (-1947.803) * (-1950.334) [-1941.925] (-1942.429) (-1949.649) -- 0:01:11
849000 -- (-1950.445) (-1950.690) [-1942.411] (-1949.758) * [-1945.457] (-1950.186) (-1940.450) (-1947.653) -- 0:01:11
850000 -- [-1943.921] (-1943.888) (-1940.881) (-1948.439) * (-1943.537) (-1942.994) [-1944.427] (-1946.838) -- 0:01:10
Average standard deviation of split frequencies: 0.007135
851000 -- (-1942.319) [-1944.414] (-1944.281) (-1940.974) * (-1937.920) (-1948.394) (-1940.382) [-1950.520] -- 0:01:10
852000 -- [-1942.856] (-1938.049) (-1942.410) (-1944.723) * (-1941.795) [-1945.095] (-1936.393) (-1943.298) -- 0:01:10
853000 -- [-1944.618] (-1939.232) (-1941.994) (-1951.921) * (-1946.457) [-1946.426] (-1942.075) (-1943.062) -- 0:01:09
854000 -- (-1943.117) [-1942.438] (-1942.124) (-1938.619) * (-1944.291) [-1944.485] (-1944.186) (-1938.844) -- 0:01:09
855000 -- (-1949.922) (-1941.418) [-1945.873] (-1941.748) * (-1942.179) (-1945.826) (-1937.425) [-1947.013] -- 0:01:08
Average standard deviation of split frequencies: 0.007710
856000 -- [-1944.795] (-1944.327) (-1943.460) (-1940.130) * [-1939.589] (-1938.944) (-1949.431) (-1943.560) -- 0:01:08
857000 -- (-1954.095) (-1944.383) (-1947.201) [-1950.476] * [-1938.856] (-1947.716) (-1937.377) (-1947.819) -- 0:01:07
858000 -- (-1943.377) [-1941.474] (-1944.097) (-1940.712) * (-1948.581) [-1946.382] (-1954.810) (-1950.003) -- 0:01:07
859000 -- (-1942.567) (-1944.248) [-1943.410] (-1946.729) * (-1941.031) (-1947.693) [-1945.784] (-1946.450) -- 0:01:06
860000 -- (-1942.375) [-1956.612] (-1940.751) (-1944.548) * (-1940.910) (-1944.870) [-1942.534] (-1945.015) -- 0:01:06
Average standard deviation of split frequencies: 0.007394
861000 -- [-1945.919] (-1945.339) (-1942.549) (-1939.544) * (-1945.410) [-1942.725] (-1950.349) (-1946.935) -- 0:01:05
862000 -- (-1947.059) (-1944.093) [-1948.720] (-1947.590) * [-1944.513] (-1942.332) (-1941.175) (-1943.163) -- 0:01:05
863000 -- (-1941.319) [-1942.566] (-1943.590) (-1948.455) * (-1948.092) (-1947.785) (-1944.069) [-1952.874] -- 0:01:04
864000 -- [-1944.084] (-1939.231) (-1943.712) (-1945.747) * [-1941.661] (-1942.285) (-1941.537) (-1952.729) -- 0:01:04
865000 -- (-1945.408) (-1953.640) [-1944.301] (-1940.222) * (-1939.986) (-1944.934) [-1942.068] (-1946.036) -- 0:01:03
Average standard deviation of split frequencies: 0.007349
866000 -- [-1945.401] (-1943.930) (-1950.641) (-1942.612) * (-1944.891) (-1941.681) [-1942.069] (-1941.487) -- 0:01:03
867000 -- (-1951.868) [-1945.438] (-1943.879) (-1944.482) * (-1946.699) [-1941.186] (-1940.750) (-1942.291) -- 0:01:02
868000 -- (-1941.677) [-1941.481] (-1943.669) (-1943.969) * (-1949.804) [-1941.346] (-1940.875) (-1944.744) -- 0:01:02
869000 -- (-1945.068) [-1940.166] (-1945.918) (-1942.111) * (-1949.987) (-1944.143) (-1949.893) [-1945.486] -- 0:01:01
870000 -- (-1939.261) (-1940.119) [-1950.507] (-1941.255) * (-1944.404) [-1942.646] (-1940.883) (-1945.547) -- 0:01:01
Average standard deviation of split frequencies: 0.007377
871000 -- (-1940.659) [-1946.419] (-1946.284) (-1946.555) * (-1942.016) (-1946.154) (-1940.548) [-1943.858] -- 0:01:01
872000 -- (-1954.193) (-1945.330) [-1942.219] (-1945.989) * (-1940.395) (-1942.313) (-1956.720) [-1944.053] -- 0:01:00
873000 -- (-1942.734) (-1950.011) [-1949.540] (-1941.457) * (-1942.132) (-1943.566) (-1943.628) [-1940.672] -- 0:01:00
874000 -- (-1942.368) (-1940.150) (-1947.881) [-1939.427] * (-1942.227) [-1943.514] (-1950.207) (-1941.553) -- 0:00:59
875000 -- [-1945.324] (-1946.722) (-1944.781) (-1956.136) * (-1943.759) [-1940.409] (-1957.155) (-1948.027) -- 0:00:59
Average standard deviation of split frequencies: 0.006794
876000 -- (-1945.738) [-1942.080] (-1938.839) (-1952.674) * (-1947.066) (-1939.875) (-1946.053) [-1938.652] -- 0:00:58
877000 -- (-1941.028) [-1944.903] (-1939.849) (-1950.149) * [-1941.364] (-1941.913) (-1942.354) (-1947.390) -- 0:00:58
878000 -- (-1951.747) [-1947.427] (-1941.431) (-1951.504) * (-1942.658) (-1941.833) (-1947.067) [-1940.533] -- 0:00:57
879000 -- (-1951.336) (-1945.244) (-1941.069) [-1944.240] * (-1940.781) [-1945.592] (-1934.557) (-1946.633) -- 0:00:57
880000 -- [-1944.311] (-1946.809) (-1946.870) (-1949.807) * [-1941.685] (-1944.913) (-1949.331) (-1945.152) -- 0:00:56
Average standard deviation of split frequencies: 0.006624
881000 -- (-1943.665) (-1944.181) (-1950.816) [-1942.550] * (-1948.903) [-1944.628] (-1947.274) (-1947.210) -- 0:00:56
882000 -- (-1944.850) (-1944.779) [-1954.342] (-1945.745) * (-1937.775) (-1943.742) [-1946.738] (-1940.683) -- 0:00:55
883000 -- (-1950.529) [-1946.988] (-1949.175) (-1950.502) * [-1938.852] (-1943.015) (-1948.136) (-1941.668) -- 0:00:55
884000 -- (-1942.895) [-1942.670] (-1948.237) (-1945.100) * (-1940.480) (-1946.217) (-1951.357) [-1939.208] -- 0:00:54
885000 -- (-1943.298) [-1947.487] (-1941.450) (-1938.962) * (-1936.982) [-1939.977] (-1949.400) (-1940.421) -- 0:00:54
Average standard deviation of split frequencies: 0.006385
886000 -- (-1944.328) (-1949.846) [-1941.763] (-1940.725) * (-1941.098) [-1948.631] (-1941.600) (-1943.604) -- 0:00:53
887000 -- (-1942.107) (-1944.752) (-1942.152) [-1940.290] * (-1939.328) (-1946.579) (-1939.588) [-1942.414] -- 0:00:53
888000 -- (-1934.794) (-1944.894) [-1939.046] (-1945.799) * [-1937.814] (-1945.786) (-1943.875) (-1942.519) -- 0:00:52
889000 -- (-1942.104) (-1937.192) [-1942.300] (-1944.127) * [-1941.980] (-1940.012) (-1938.281) (-1944.102) -- 0:00:52
890000 -- (-1937.939) (-1941.103) (-1954.845) [-1947.188] * (-1941.859) (-1941.819) [-1940.645] (-1949.968) -- 0:00:52
Average standard deviation of split frequencies: 0.006881
891000 -- (-1946.133) [-1944.146] (-1942.015) (-1947.986) * [-1942.173] (-1940.877) (-1938.647) (-1940.096) -- 0:00:51
892000 -- (-1936.186) [-1945.017] (-1947.303) (-1946.431) * (-1954.022) [-1947.308] (-1947.036) (-1942.744) -- 0:00:51
893000 -- (-1946.195) (-1947.669) (-1947.279) [-1939.894] * (-1945.466) [-1940.282] (-1951.729) (-1939.669) -- 0:00:50
894000 -- (-1943.613) (-1942.790) [-1947.510] (-1947.890) * (-1943.549) (-1941.954) (-1946.487) [-1942.239] -- 0:00:50
895000 -- (-1944.379) (-1945.339) [-1945.510] (-1947.559) * [-1947.027] (-1940.957) (-1944.199) (-1947.780) -- 0:00:49
Average standard deviation of split frequencies: 0.007037
896000 -- [-1943.901] (-1942.291) (-1944.335) (-1946.349) * (-1949.474) (-1943.977) [-1952.227] (-1941.184) -- 0:00:49
897000 -- (-1945.785) (-1948.156) [-1940.485] (-1945.204) * [-1942.107] (-1938.667) (-1949.776) (-1940.495) -- 0:00:48
898000 -- (-1946.972) (-1941.377) (-1947.283) [-1943.739] * [-1945.668] (-1941.462) (-1946.437) (-1943.901) -- 0:00:48
899000 -- (-1939.799) (-1946.659) (-1947.550) [-1948.053] * (-1941.548) (-1943.557) [-1947.816] (-1944.905) -- 0:00:47
900000 -- [-1950.954] (-1958.164) (-1950.333) (-1948.689) * (-1938.385) (-1940.795) [-1944.389] (-1942.883) -- 0:00:47
Average standard deviation of split frequencies: 0.007393
901000 -- (-1942.268) (-1941.861) [-1940.452] (-1944.135) * (-1946.090) (-1939.552) (-1961.894) [-1946.697] -- 0:00:46
902000 -- (-1950.440) (-1943.136) [-1941.022] (-1943.815) * [-1944.754] (-1941.907) (-1946.492) (-1944.456) -- 0:00:46
903000 -- [-1947.086] (-1947.843) (-1943.375) (-1949.757) * [-1939.954] (-1945.354) (-1943.160) (-1943.700) -- 0:00:45
904000 -- (-1943.279) [-1943.600] (-1945.415) (-1948.616) * [-1942.927] (-1945.683) (-1944.963) (-1949.541) -- 0:00:45
905000 -- [-1946.614] (-1940.466) (-1945.769) (-1947.208) * [-1940.284] (-1939.874) (-1938.716) (-1942.915) -- 0:00:44
Average standard deviation of split frequencies: 0.007284
906000 -- [-1945.862] (-1947.958) (-1939.676) (-1946.579) * (-1939.206) [-1949.232] (-1949.852) (-1942.936) -- 0:00:44
907000 -- [-1947.312] (-1952.157) (-1945.792) (-1943.550) * [-1944.647] (-1948.980) (-1948.782) (-1946.251) -- 0:00:43
908000 -- (-1941.833) [-1948.372] (-1944.472) (-1938.730) * [-1946.249] (-1949.818) (-1946.218) (-1945.917) -- 0:00:43
909000 -- (-1948.373) [-1944.355] (-1941.533) (-1947.172) * (-1946.001) (-1951.227) (-1941.397) [-1944.814] -- 0:00:43
910000 -- (-1941.276) (-1939.410) [-1939.717] (-1940.084) * [-1944.828] (-1943.223) (-1941.078) (-1941.501) -- 0:00:42
Average standard deviation of split frequencies: 0.007247
911000 -- (-1940.709) (-1955.571) [-1945.073] (-1939.591) * [-1940.661] (-1939.061) (-1942.740) (-1951.014) -- 0:00:42
912000 -- (-1951.383) [-1942.667] (-1942.522) (-1943.120) * (-1950.248) (-1951.288) [-1946.003] (-1945.849) -- 0:00:41
913000 -- (-1946.194) [-1937.197] (-1939.365) (-1942.632) * (-1944.093) [-1941.546] (-1947.375) (-1946.396) -- 0:00:41
914000 -- (-1948.939) [-1949.370] (-1949.100) (-1947.801) * (-1957.877) (-1943.730) [-1945.046] (-1946.526) -- 0:00:40
915000 -- (-1940.536) [-1939.348] (-1941.301) (-1946.596) * (-1949.951) (-1942.585) (-1957.017) [-1942.273] -- 0:00:40
Average standard deviation of split frequencies: 0.007334
916000 -- (-1943.698) (-1944.544) (-1941.910) [-1942.705] * (-1941.819) (-1940.759) [-1940.813] (-1939.335) -- 0:00:39
917000 -- [-1944.720] (-1948.070) (-1941.167) (-1951.938) * (-1948.529) (-1954.678) (-1951.157) [-1942.926] -- 0:00:39
918000 -- (-1943.887) (-1942.289) (-1942.616) [-1943.645] * (-1954.663) (-1943.709) [-1940.675] (-1947.676) -- 0:00:38
919000 -- (-1945.400) [-1940.324] (-1950.992) (-1942.542) * [-1947.293] (-1947.970) (-1940.680) (-1943.818) -- 0:00:38
920000 -- (-1945.569) [-1944.787] (-1936.623) (-1946.517) * (-1953.979) (-1944.769) [-1940.583] (-1946.193) -- 0:00:37
Average standard deviation of split frequencies: 0.007104
921000 -- (-1947.148) (-1945.974) (-1953.674) [-1940.254] * (-1944.409) [-1944.398] (-1941.963) (-1942.361) -- 0:00:37
922000 -- [-1944.000] (-1947.189) (-1946.178) (-1947.141) * [-1941.684] (-1947.381) (-1938.464) (-1943.085) -- 0:00:36
923000 -- [-1944.144] (-1946.496) (-1944.121) (-1945.454) * (-1949.065) (-1947.045) [-1941.477] (-1946.809) -- 0:00:36
924000 -- [-1939.719] (-1941.172) (-1948.949) (-1941.234) * (-1951.331) (-1951.402) (-1945.879) [-1946.490] -- 0:00:35
925000 -- (-1940.255) [-1939.779] (-1943.136) (-1944.991) * (-1944.020) (-1941.090) [-1949.855] (-1945.130) -- 0:00:35
Average standard deviation of split frequencies: 0.007000
926000 -- (-1947.324) [-1943.244] (-1941.128) (-1945.257) * (-1943.493) (-1944.600) [-1939.585] (-1945.154) -- 0:00:35
927000 -- (-1942.574) (-1945.117) [-1945.352] (-1943.981) * (-1944.302) (-1943.630) [-1937.507] (-1944.901) -- 0:00:34
928000 -- (-1941.700) (-1946.997) (-1950.812) [-1941.359] * (-1948.494) (-1948.454) (-1942.200) [-1943.197] -- 0:00:34
929000 -- (-1945.677) (-1943.994) [-1951.429] (-1941.317) * (-1948.038) [-1943.834] (-1944.481) (-1944.184) -- 0:00:33
930000 -- (-1942.079) [-1946.242] (-1947.897) (-1943.673) * [-1947.099] (-1947.732) (-1944.761) (-1941.028) -- 0:00:33
Average standard deviation of split frequencies: 0.006711
931000 -- [-1944.376] (-1943.619) (-1946.377) (-1952.432) * (-1938.279) (-1944.877) [-1945.267] (-1941.747) -- 0:00:32
932000 -- [-1943.060] (-1948.013) (-1940.289) (-1947.459) * (-1948.065) (-1943.641) (-1947.100) [-1939.342] -- 0:00:32
933000 -- (-1942.548) (-1951.476) [-1952.479] (-1945.151) * (-1947.072) [-1953.482] (-1950.311) (-1948.757) -- 0:00:31
934000 -- [-1939.025] (-1944.915) (-1948.573) (-1954.653) * [-1942.184] (-1945.628) (-1948.348) (-1944.539) -- 0:00:31
935000 -- (-1937.415) [-1939.433] (-1944.111) (-1942.283) * (-1938.068) (-1943.275) (-1946.396) [-1945.330] -- 0:00:30
Average standard deviation of split frequencies: 0.006547
936000 -- (-1942.246) [-1946.547] (-1950.622) (-1942.895) * (-1938.453) [-1947.064] (-1943.950) (-1945.334) -- 0:00:30
937000 -- [-1937.673] (-1943.966) (-1943.915) (-1946.185) * [-1944.829] (-1944.359) (-1941.994) (-1945.967) -- 0:00:29
938000 -- (-1948.287) [-1948.016] (-1938.723) (-1943.931) * (-1945.407) (-1948.877) (-1952.674) [-1940.240] -- 0:00:29
939000 -- (-1946.956) (-1943.552) (-1943.329) [-1948.373] * (-1943.574) (-1941.554) [-1945.771] (-1947.222) -- 0:00:28
940000 -- (-1942.339) (-1940.911) [-1943.795] (-1946.283) * (-1942.547) (-1947.700) (-1949.706) [-1944.827] -- 0:00:28
Average standard deviation of split frequencies: 0.005951
941000 -- (-1952.445) (-1942.167) (-1940.971) [-1942.028] * [-1945.269] (-1943.342) (-1947.254) (-1946.826) -- 0:00:27
942000 -- [-1938.899] (-1943.803) (-1940.097) (-1944.124) * [-1948.162] (-1954.010) (-1942.171) (-1945.455) -- 0:00:27
943000 -- (-1942.532) (-1948.374) [-1941.684] (-1945.219) * (-1940.630) (-1952.230) (-1943.356) [-1940.639] -- 0:00:26
944000 -- (-1938.278) [-1942.388] (-1945.770) (-1944.430) * [-1946.611] (-1940.227) (-1942.231) (-1942.043) -- 0:00:26
945000 -- (-1943.896) [-1937.204] (-1942.479) (-1941.933) * (-1946.784) (-1945.249) (-1940.544) [-1941.883] -- 0:00:26
Average standard deviation of split frequencies: 0.005980
946000 -- (-1938.954) [-1944.861] (-1942.479) (-1944.083) * (-1942.509) (-1953.795) (-1945.187) [-1948.795] -- 0:00:25
947000 -- (-1941.757) (-1951.147) (-1943.403) [-1942.573] * (-1954.826) (-1943.663) (-1949.014) [-1938.746] -- 0:00:25
948000 -- [-1948.001] (-1944.252) (-1949.442) (-1939.045) * (-1944.733) (-1949.709) (-1942.203) [-1938.689] -- 0:00:24
949000 -- (-1951.078) [-1943.567] (-1940.979) (-1938.911) * (-1938.735) (-1941.866) (-1945.138) [-1944.048] -- 0:00:24
950000 -- (-1945.267) (-1944.656) [-1942.270] (-1938.167) * (-1941.290) (-1936.127) (-1948.885) [-1943.477] -- 0:00:23
Average standard deviation of split frequencies: 0.006198
951000 -- [-1941.111] (-1943.633) (-1952.345) (-1943.269) * (-1943.418) [-1941.489] (-1943.062) (-1938.278) -- 0:00:23
952000 -- (-1943.117) (-1944.887) [-1945.164] (-1947.002) * (-1942.341) [-1938.651] (-1950.089) (-1943.292) -- 0:00:22
953000 -- (-1947.065) [-1939.722] (-1939.059) (-1945.342) * [-1938.297] (-1949.775) (-1946.182) (-1944.595) -- 0:00:22
954000 -- (-1950.386) (-1942.028) (-1946.751) [-1939.284] * (-1944.206) [-1944.194] (-1957.264) (-1940.189) -- 0:00:21
955000 -- (-1940.125) [-1945.984] (-1955.653) (-1944.078) * (-1948.218) (-1947.339) (-1952.138) [-1944.786] -- 0:00:21
Average standard deviation of split frequencies: 0.006164
956000 -- (-1942.018) (-1955.350) (-1946.843) [-1943.635] * (-1942.684) (-1944.286) [-1945.064] (-1941.237) -- 0:00:20
957000 -- (-1946.707) (-1940.622) (-1939.607) [-1944.562] * [-1942.349] (-1942.088) (-1947.682) (-1944.470) -- 0:00:20
958000 -- (-1950.601) (-1947.179) [-1943.466] (-1947.232) * [-1939.623] (-1940.708) (-1941.560) (-1944.002) -- 0:00:19
959000 -- (-1944.285) (-1945.879) (-1948.939) [-1941.436] * (-1946.508) (-1941.095) [-1942.754] (-1947.787) -- 0:00:19
960000 -- [-1946.308] (-1938.881) (-1941.767) (-1940.986) * (-1941.981) (-1948.101) [-1942.739] (-1951.698) -- 0:00:18
Average standard deviation of split frequencies: 0.006011
961000 -- (-1950.730) [-1940.193] (-1940.871) (-1946.946) * (-1940.764) (-1943.793) (-1940.370) [-1942.157] -- 0:00:18
962000 -- [-1941.880] (-1942.650) (-1945.292) (-1942.030) * [-1945.871] (-1944.198) (-1942.996) (-1940.170) -- 0:00:17
963000 -- (-1944.905) [-1941.722] (-1942.919) (-1940.516) * (-1937.752) (-1942.185) [-1941.924] (-1940.868) -- 0:00:17
964000 -- (-1938.775) [-1942.002] (-1947.727) (-1939.131) * (-1940.914) (-1949.895) (-1940.585) [-1944.178] -- 0:00:17
965000 -- (-1942.452) [-1945.589] (-1951.963) (-1942.542) * [-1942.927] (-1955.009) (-1942.556) (-1942.852) -- 0:00:16
Average standard deviation of split frequencies: 0.005734
966000 -- (-1943.009) [-1943.318] (-1949.468) (-1944.465) * (-1945.131) (-1940.902) [-1942.686] (-1941.056) -- 0:00:16
967000 -- (-1949.778) (-1954.640) (-1944.082) [-1946.125] * (-1950.704) (-1939.526) (-1944.965) [-1950.586] -- 0:00:15
968000 -- (-1948.425) (-1943.402) [-1949.598] (-1946.989) * (-1944.039) (-1945.860) [-1950.601] (-1941.650) -- 0:00:15
969000 -- (-1946.012) [-1943.011] (-1946.290) (-1943.750) * (-1944.606) [-1945.442] (-1947.780) (-1948.069) -- 0:00:14
970000 -- (-1943.668) [-1949.677] (-1941.583) (-1946.822) * (-1941.602) (-1949.436) [-1942.355] (-1943.864) -- 0:00:14
Average standard deviation of split frequencies: 0.006253
971000 -- [-1945.534] (-1946.728) (-1945.427) (-1945.480) * (-1949.440) [-1937.481] (-1947.831) (-1941.530) -- 0:00:13
972000 -- [-1942.544] (-1942.675) (-1940.059) (-1944.861) * (-1950.280) (-1944.047) (-1943.633) [-1939.000] -- 0:00:13
973000 -- (-1948.154) (-1952.767) (-1944.156) [-1945.677] * [-1944.030] (-1940.218) (-1944.578) (-1947.895) -- 0:00:12
974000 -- (-1944.024) (-1938.255) [-1942.678] (-1939.532) * (-1942.218) (-1948.670) [-1940.357] (-1941.417) -- 0:00:12
975000 -- (-1946.658) (-1941.959) (-1948.456) [-1941.297] * [-1946.823] (-1943.334) (-1948.150) (-1945.378) -- 0:00:11
Average standard deviation of split frequencies: 0.006400
976000 -- (-1949.131) (-1943.241) (-1940.845) [-1945.771] * [-1945.803] (-1949.695) (-1944.056) (-1943.517) -- 0:00:11
977000 -- [-1943.388] (-1941.053) (-1942.970) (-1949.056) * (-1944.067) (-1945.753) [-1942.420] (-1949.450) -- 0:00:10
978000 -- [-1943.642] (-1952.553) (-1945.448) (-1950.526) * (-1945.717) [-1943.938] (-1942.207) (-1948.209) -- 0:00:10
979000 -- (-1945.204) (-1945.579) [-1946.696] (-1947.382) * [-1944.127] (-1942.473) (-1945.978) (-1941.949) -- 0:00:09
980000 -- (-1946.948) (-1946.416) (-1946.495) [-1948.550] * [-1942.948] (-1942.894) (-1943.112) (-1949.039) -- 0:00:09
Average standard deviation of split frequencies: 0.006189
981000 -- (-1948.560) [-1940.588] (-1947.125) (-1940.052) * [-1941.991] (-1943.436) (-1942.487) (-1940.461) -- 0:00:08
982000 -- [-1939.847] (-1940.523) (-1952.939) (-1943.863) * (-1941.269) [-1942.446] (-1944.758) (-1947.414) -- 0:00:08
983000 -- (-1940.978) (-1941.132) [-1941.369] (-1940.931) * (-1944.877) (-1954.160) [-1938.148] (-1946.318) -- 0:00:08
984000 -- (-1949.923) (-1944.805) [-1943.897] (-1945.360) * (-1946.817) [-1943.865] (-1947.844) (-1947.323) -- 0:00:07
985000 -- (-1948.508) (-1946.191) (-1947.527) [-1945.026] * (-1941.534) [-1946.326] (-1943.591) (-1948.727) -- 0:00:07
Average standard deviation of split frequencies: 0.006454
986000 -- (-1938.276) (-1938.855) [-1947.665] (-1943.535) * [-1945.644] (-1943.707) (-1946.462) (-1942.229) -- 0:00:06
987000 -- (-1942.684) [-1947.715] (-1947.696) (-1947.187) * (-1954.810) (-1944.882) (-1942.153) [-1940.212] -- 0:00:06
988000 -- (-1941.215) (-1941.309) (-1942.941) [-1948.707] * [-1943.992] (-1938.344) (-1942.717) (-1943.625) -- 0:00:05
989000 -- [-1948.804] (-1943.918) (-1948.830) (-1942.226) * (-1952.707) [-1940.887] (-1941.147) (-1938.009) -- 0:00:05
990000 -- [-1946.210] (-1947.604) (-1937.607) (-1940.721) * [-1946.191] (-1942.635) (-1943.853) (-1947.681) -- 0:00:04
Average standard deviation of split frequencies: 0.006186
991000 -- (-1943.186) (-1951.077) (-1951.881) [-1939.605] * (-1942.296) (-1941.405) (-1943.383) [-1941.396] -- 0:00:04
992000 -- (-1943.733) (-1939.126) (-1945.512) [-1943.659] * (-1944.128) (-1943.602) (-1942.741) [-1942.317] -- 0:00:03
993000 -- [-1938.580] (-1946.691) (-1944.397) (-1950.857) * (-1942.919) [-1939.617] (-1942.767) (-1946.772) -- 0:00:03
994000 -- (-1942.851) (-1942.788) [-1946.130] (-1947.679) * (-1948.767) [-1940.153] (-1943.309) (-1950.054) -- 0:00:02
995000 -- (-1936.266) (-1939.377) [-1937.453] (-1945.421) * (-1944.051) (-1951.552) [-1944.864] (-1946.019) -- 0:00:02
Average standard deviation of split frequencies: 0.006212
996000 -- (-1942.880) (-1944.133) [-1948.804] (-1944.656) * [-1946.835] (-1937.757) (-1947.520) (-1941.034) -- 0:00:01
997000 -- (-1938.703) (-1943.322) (-1949.636) [-1937.719] * (-1944.623) [-1942.473] (-1945.952) (-1941.626) -- 0:00:01
998000 -- (-1947.090) [-1947.701] (-1947.602) (-1949.852) * (-1941.469) (-1948.463) (-1945.066) [-1944.086] -- 0:00:00
999000 -- (-1936.540) [-1956.388] (-1953.563) (-1954.296) * [-1939.993] (-1952.171) (-1941.672) (-1951.452) -- 0:00:00
1000000 -- (-1945.489) (-1944.945) [-1955.231] (-1950.371) * (-1939.254) [-1948.091] (-1943.926) (-1939.769) -- 0:00:00
Average standard deviation of split frequencies: 0.006536
Analysis completed in 7 mins 53 seconds
Analysis used 473.18 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1933.36
Likelihood of best state for "cold" chain of run 2 was -1933.36
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.1 % ( 50 %) Dirichlet(Revmat{all})
73.3 % ( 58 %) Slider(Revmat{all})
26.3 % ( 14 %) Dirichlet(Pi{all})
28.6 % ( 28 %) Slider(Pi{all})
29.9 % ( 27 %) Multiplier(Alpha{1,2})
52.9 % ( 18 %) Multiplier(Alpha{3})
42.5 % ( 33 %) Slider(Pinvar{all})
16.1 % ( 12 %) ExtSPR(Tau{all},V{all})
18.8 % ( 19 %) ExtTBR(Tau{all},V{all})
19.6 % ( 12 %) NNI(Tau{all},V{all})
12.9 % ( 19 %) ParsSPR(Tau{all},V{all})
26.4 % ( 26 %) Multiplier(V{all})
32.0 % ( 26 %) Nodeslider(V{all})
25.5 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
58.3 % ( 49 %) Dirichlet(Revmat{all})
74.1 % ( 59 %) Slider(Revmat{all})
26.2 % ( 25 %) Dirichlet(Pi{all})
28.1 % ( 31 %) Slider(Pi{all})
30.0 % ( 19 %) Multiplier(Alpha{1,2})
52.9 % ( 20 %) Multiplier(Alpha{3})
41.6 % ( 28 %) Slider(Pinvar{all})
16.7 % ( 22 %) ExtSPR(Tau{all},V{all})
18.9 % ( 21 %) ExtTBR(Tau{all},V{all})
19.6 % ( 31 %) NNI(Tau{all},V{all})
13.2 % ( 19 %) ParsSPR(Tau{all},V{all})
26.4 % ( 22 %) Multiplier(V{all})
32.1 % ( 40 %) Nodeslider(V{all})
25.3 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.47
2 | 167096 0.81 0.64
3 | 166646 166725 0.82
4 | 165639 166873 167021
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166779 0.82 0.66
3 | 167096 166252 0.83
4 | 166453 166445 166975
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1941.75
| 2 1 1 2 2 1 2 |
|2 2 2 |
| 2 1 1 |
| 1 2 1 2 1 1 2 |
| 1 1 1 2 1 2 1 2 2 2 |
|1 1 2 1 21 11 2 11 12 1 1 2 11 2|
| 2 2 2 12 *2 2 2 1 * |
| 2 112 *1 2 1 1 2 1 2 11 2 1 |
| 2 21 1 1 2 1 22 2 12 |
| 1 2 2 2 2 1 2 21 * |
| 2 1 2 * 2 11 |
| 12 2 2 1 |
| 1 1 2 |
| |
| 1 1|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1945.44
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1939.39 -1951.79
2 -1939.65 -1950.64
--------------------------------------
TOTAL -1939.51 -1951.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 9.359770 17.346309 3.801414 17.337440 8.299917 1042.03 1042.74 1.000
r(A<->C){all} 0.095462 0.001593 0.018056 0.172554 0.092652 574.10 606.93 1.007
r(A<->G){all} 0.289586 0.003011 0.184123 0.391569 0.287680 633.07 761.77 1.003
r(A<->T){all} 0.124411 0.001055 0.061570 0.188272 0.122730 750.69 756.81 1.000
r(C<->G){all} 0.215149 0.002679 0.117893 0.319172 0.212132 499.42 575.51 1.001
r(C<->T){all} 0.221506 0.001744 0.144979 0.303931 0.218476 653.69 790.97 1.000
r(G<->T){all} 0.053886 0.000855 0.001834 0.108546 0.050386 675.80 706.99 1.000
pi(A){all} 0.257980 0.000226 0.230808 0.289110 0.257683 1181.37 1245.02 1.000
pi(C){all} 0.224931 0.000208 0.198144 0.253001 0.224249 957.58 1049.73 1.000
pi(G){all} 0.169224 0.000170 0.143341 0.194449 0.168816 885.14 1080.63 1.000
pi(T){all} 0.347865 0.000292 0.313205 0.379268 0.347720 1020.78 1126.36 1.001
alpha{1,2} 0.449771 0.011952 0.262566 0.662106 0.437718 891.02 934.64 1.000
alpha{3} 3.548336 1.840352 1.231004 6.214059 3.342433 1045.30 1208.60 1.000
pinvar{all} 0.027413 0.000468 0.000003 0.069589 0.022549 1225.54 1292.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- ..*.*.
9 -- ..***.
10 -- .*.*..
11 -- .***..
12 -- .*.**.
13 -- .**.*.
14 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 3002 1.000000 0.000000 1.000000 1.000000 2
8 1276 0.425050 0.015075 0.414390 0.435710 2
9 1112 0.370420 0.000942 0.369753 0.371086 2
10 1081 0.360093 0.008009 0.354430 0.365756 2
11 625 0.208195 0.006124 0.203864 0.212525 2
12 595 0.198201 0.000471 0.197868 0.198534 2
13 380 0.126582 0.006595 0.121919 0.131246 2
14 348 0.115923 0.015075 0.105263 0.126582 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.014683 0.000103 0.000007 0.033593 0.013212 1.000 2
length{all}[2] 1.804041 0.470746 0.662106 3.256525 1.684692 1.000 2
length{all}[3] 0.311975 0.016394 0.007803 0.517913 0.318758 1.000 2
length{all}[4] 0.183471 0.014350 0.000336 0.400815 0.170322 1.000 2
length{all}[5] 0.368538 0.017253 0.035993 0.594491 0.372725 1.000 2
length{all}[6] 0.013663 0.000102 0.000004 0.033063 0.011788 1.001 2
length{all}[7] 6.232659 12.428643 1.782367 13.205070 5.270861 1.000 2
length{all}[8] 0.177603 0.010901 0.000274 0.354927 0.171603 1.001 2
length{all}[9] 0.444106 0.200539 0.000171 1.354559 0.306984 1.000 2
length{all}[10] 0.163491 0.011482 0.000337 0.358093 0.154925 1.003 2
length{all}[11] 0.198802 0.017048 0.002103 0.436551 0.181267 0.999 2
length{all}[12] 0.202714 0.014789 0.001619 0.400904 0.192475 0.999 2
length{all}[13] 0.125266 0.008585 0.000986 0.292473 0.105625 1.003 2
length{all}[14] 0.122368 0.010013 0.000179 0.331887 0.099736 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006536
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C6 (6)
|
+ /------------------------------------ C2 (2)
| |
| |------------------------------------ C3 (3)
\----------------100----------------+
|------------------------------------ C4 (4)
|
\------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/ C1 (1)
|
| C6 (6)
|
+ /----------------- C2 (2)
| |
| |--- C3 (3)
\------------------------------------------------------+
|- C4 (4)
|
\--- C5 (5)
|---------| 1.000 expected changes per site
Calculating tree probabilities...
Credible sets of trees (15 trees sampled):
50 % credible set contains 3 trees
90 % credible set contains 10 trees
95 % credible set contains 12 trees
99 % credible set contains 14 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Thu Oct 27 00:04:00 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=6, Len=131
C1 MKIILFSILIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
C2 MRVVALLLLISPVFS--RQVFHYIDCVAGSSTTFGLPC-EGLIQTQSSVQ
C3 MRVILLLAVLYVALATSREVHHYIDCVRGTSRTLQLPC-DGTVESTTPVQ
C4 MRVLILLSLLSVALTAAPEIHHYIDCVRGTSTTILQPC-DGVIESTSPVQ
C5 MRVLLLLSLCAFALS--KEIHYYVDCISGTSTTVNQPC-DGVIESTSPVQ
C6 MKIILFLTLIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
*::: : : . ::.:* :*: *:: . ** .* : :..:
C1 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
C2 FVPDQQYGRVGVLCISNYVQTFRISCPHGN-HTFIIR-----STTYRTNV
C3 FTPDYAYGSIAVPC--NVVFQMRISCPLGN-YTYHVR-----PVSFRTHT
C4 FTPNTQYGSLAVSC--SLVTQIRISCPHGN-HTFHVR-----PVSFRTHT
C5 FTPNYAYGSLAVAC--NSVVQIRILCPRGN-YTFHIR-----PVSFRTHT
C6 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
.: : .: * : : *. *. :*: :* . : :
C1 KVYQELYSPLFLIVIALVFIILCFTIKRKIE
C2 RVTQPQSGDLMMLILCFLIILVLYVCLWR--
C3 RYSQPQGNELQCLIVFLLILIVFYLVFRRR-
C4 RYSQPQGNELQCLIVTLLIVIVLYLFFRRR-
C5 RYSQPQGNEVQCLVVTLLLVILLILLFRRR-
C6 KVYQELYSPLFLIVAALVFIILCFTIKRKIE
: * . : :: :::::: :
-- Starting log on Thu Oct 27 04:00:12 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/original_alignment/codeml,JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 393 sites
reading seq# 2 C2 393 sites
reading seq# 3 C3 393 sites
reading seq# 4 C4 393 sites
reading seq# 5 C5 393 sites
reading seq# 6 C6 393 sitesns = 6 ls = 393
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
27 ambiguity characters in seq. 1
33 ambiguity characters in seq. 2
30 ambiguity characters in seq. 3
30 ambiguity characters in seq. 4
36 ambiguity characters in seq. 5
27 ambiguity characters in seq. 6
18 sites are removed. 16 17 18 39 58 59 60 65 66 67 81 88 89 90 91 92 130 131
Sequences read..
Counting site patterns.. 0:00
Compressing, 112 patterns at 113 / 113 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 112 patterns at 113 / 113 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
109312 bytes for conP
9856 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 6, (2, 3, 4, 5)); MP score: 309
0.070131 0.067126 0.056284 0.025276 0.101413 0.043983 0.105831 0.300000 0.803276 0.310230
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.167756
np = 10
lnL0 = -2862.961356
Iterating by ming2
Initial: fx= 2862.961356
x= 0.07013 0.06713 0.05628 0.02528 0.10141 0.04398 0.10583 0.30000 0.80328 0.31023
1 h-m-p 0.0000 0.0008 5280.8818 +++CCYC 1850.155685 3 0.0006 23 | 0/10
2 h-m-p 0.0001 0.0004 419.9967 +YCCCCC 1836.210020 5 0.0002 46 | 0/10
3 h-m-p 0.0007 0.0036 109.4162 +YYCCC 1826.802864 4 0.0024 66 | 0/10
4 h-m-p 0.0002 0.0009 196.0303 ++ 1817.645703 m 0.0009 79 | 0/10
5 h-m-p 0.0000 0.0002 803.7608 ++ 1808.326903 m 0.0002 92 | 1/10
6 h-m-p 0.0021 0.0104 30.1107 +YCYCCC 1804.625113 5 0.0061 114 | 0/10
7 h-m-p 0.0001 0.0004 523.2976 YCC 1803.836211 2 0.0001 130 | 0/10
8 h-m-p 0.0004 0.0139 170.6926 ++YCYC 1794.803835 3 0.0047 149 | 0/10
9 h-m-p 0.0329 0.1644 16.5847 YCCC 1791.958913 3 0.0262 167 | 0/10
10 h-m-p 0.0463 0.2313 4.3036 YCCC 1791.558969 3 0.0224 185 | 0/10
11 h-m-p 0.0731 0.6356 1.3156 ++ 1784.216197 m 0.6356 198 | 1/10
12 h-m-p 0.0485 0.2423 7.2001 YCC 1783.372899 2 0.0284 214 | 1/10
13 h-m-p 1.3751 7.5947 0.1485 CCC 1780.424225 2 1.9409 231 | 0/10
14 h-m-p 0.0100 0.0500 20.6313 --CYC 1780.409449 2 0.0002 258 | 0/10
15 h-m-p 0.0569 5.9794 0.0785 +++CC 1779.544261 1 3.7337 276 | 0/10
16 h-m-p 0.2165 1.0826 0.0445 ++ 1778.902974 m 1.0826 299 | 1/10
17 h-m-p 0.2347 8.0000 0.2051 ++YCCCC 1775.881167 4 2.7250 331 | 1/10
18 h-m-p 1.6000 8.0000 0.1043 YCCCC 1774.607253 4 2.8810 360 | 0/10
19 h-m-p 0.0366 0.1830 4.4861 --C 1774.606630 0 0.0006 384 | 0/10
20 h-m-p 0.0165 0.1743 0.1553 ++ 1774.451344 m 0.1743 397 | 1/10
21 h-m-p 0.0435 7.3977 0.6214 ++YCC 1772.333991 2 1.1294 425 | 1/10
22 h-m-p 1.6000 8.0000 0.1208 +YCYCC 1769.650928 4 4.9961 454 | 0/10
23 h-m-p 0.0003 0.0015 381.8702 +YCCC 1769.103269 3 0.0008 482 | 0/10
24 h-m-p 0.8403 4.2016 0.3376 +YYCCCC 1762.289517 5 2.6050 504 | 0/10
25 h-m-p 0.3790 1.8950 0.7055 +CCYC 1758.440770 3 1.5066 533 | 0/10
26 h-m-p 0.0449 0.2245 0.6900 ++ 1757.792161 m 0.2245 556 | 1/10
27 h-m-p 0.0788 3.8718 1.9651 +YCCC 1755.566698 3 0.7608 585 | 1/10
28 h-m-p 0.8231 4.1153 0.7884 YCYCCC 1753.247521 5 1.9808 606 | 0/10
29 h-m-p 0.0063 0.0315 54.8815 YC 1753.242990 1 0.0010 629 | 0/10
30 h-m-p 0.0261 2.8657 2.0440 ++YYCC 1752.908554 3 0.3339 648 | 0/10
31 h-m-p 0.1554 0.7769 0.6935 ++ 1752.547801 m 0.7769 661 | 1/10
32 h-m-p 0.2592 6.8350 2.0786 +CCCC 1751.808372 3 1.6019 691 | 1/10
33 h-m-p 1.5119 7.5596 0.3168 YC 1751.723865 1 0.6501 705 | 1/10
34 h-m-p 0.3464 8.0000 0.5947 YCC 1751.707756 2 0.6240 730 | 1/10
35 h-m-p 0.6830 8.0000 0.5432 YC 1751.684291 1 1.2522 753 | 1/10
36 h-m-p 1.6000 8.0000 0.0161 CC 1751.682277 1 1.3942 777 | 1/10
37 h-m-p 0.7090 8.0000 0.0317 +CC 1751.680155 1 3.4101 802 | 1/10
38 h-m-p 1.6000 8.0000 0.0490 C 1751.679240 0 1.7973 824 | 1/10
39 h-m-p 1.6000 8.0000 0.0094 ++ 1751.677754 m 8.0000 846 | 1/10
40 h-m-p 1.2267 8.0000 0.0612 CC 1751.676754 1 1.6021 870 | 1/10
41 h-m-p 1.6000 8.0000 0.0414 C 1751.676424 0 1.6000 892 | 1/10
42 h-m-p 1.6000 8.0000 0.0048 YC 1751.676277 1 2.5644 915 | 1/10
43 h-m-p 1.6000 8.0000 0.0047 C 1751.676217 0 2.2283 937 | 1/10
44 h-m-p 1.6000 8.0000 0.0024 Y 1751.676216 0 1.0413 959 | 1/10
45 h-m-p 1.6000 8.0000 0.0000 +Y 1751.676216 0 4.0200 982 | 1/10
46 h-m-p 1.6000 8.0000 0.0001 Y 1751.676216 0 2.7921 1004 | 1/10
47 h-m-p 1.6000 8.0000 0.0000 -----Y 1751.676216 0 0.0004 1031
Out..
lnL = -1751.676216
1032 lfun, 3096 eigenQcodon, 14448 P(t)
end of tree file.
Time used: 0:06
Model 2: PositiveSelection
TREE # 1
(1, 6, (2, 3, 4, 5)); MP score: 309
0.085182 0.027696 0.071587 0.041450 0.024594 0.019839 0.079846 1.394409 1.433009 0.253692 0.386828 1.371945
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 7.152218
np = 12
lnL0 = -2866.103800
Iterating by ming2
Initial: fx= 2866.103800
x= 0.08518 0.02770 0.07159 0.04145 0.02459 0.01984 0.07985 1.39441 1.43301 0.25369 0.38683 1.37195
1 h-m-p 0.0000 0.0005 4982.4292 +++ 1885.433379 m 0.0005 18 | 0/12
2 h-m-p 0.0011 0.0054 124.7777 CCCC 1881.377008 3 0.0009 39 | 0/12
3 h-m-p 0.0007 0.0033 170.2371 YCYCCC 1866.441816 5 0.0017 62 | 0/12
4 h-m-p 0.0005 0.0026 360.1374 ++ 1820.470219 m 0.0026 77 | 0/12
5 h-m-p 0.0001 0.0004 964.9453 ++ 1809.054037 m 0.0004 92 | 1/12
6 h-m-p 0.0004 0.0019 23.7079 ++ 1808.085623 m 0.0019 107 | 2/12
7 h-m-p 0.0034 0.3721 10.2238 ++CCCC 1806.014780 3 0.0446 130 | 2/12
8 h-m-p 0.0597 0.3592 7.6320 CYCC 1803.828145 3 0.0751 150 | 2/12
9 h-m-p 0.0874 0.5189 6.5587 CYCC 1801.040109 3 0.0827 170 | 2/12
10 h-m-p 0.0616 0.3081 7.9748 YYYC 1798.604709 3 0.0593 188 | 2/12
11 h-m-p 0.3072 3.1686 1.5407 CCC 1797.391120 2 0.2620 207 | 2/12
12 h-m-p 0.0765 0.5093 5.2751 YYCC 1796.210690 3 0.0630 226 | 2/12
13 h-m-p 0.3183 7.4311 1.0443 +YCCC 1794.126042 3 0.9230 247 | 1/12
14 h-m-p 0.0267 0.1976 36.1262 ---YC 1794.119633 1 0.0002 266 | 1/12
15 h-m-p 0.0415 8.0000 0.1751 +++YCCC 1792.124967 3 3.5200 289 | 1/12
16 h-m-p 1.6000 8.0000 0.2780 ++ 1781.393909 m 8.0000 315 | 0/12
17 h-m-p 0.2481 1.2407 1.7338 ++ 1774.959379 m 1.2407 341 | 1/12
18 h-m-p 0.7569 3.7845 2.1877 YCCCCCC 1771.251918 6 1.0953 367 | 1/12
19 h-m-p 0.6686 8.0000 3.5836 YCCCC 1766.159700 4 1.5498 389 | 1/12
20 h-m-p 0.5508 2.7542 3.6550 YYYCCCCCC 1764.745422 8 0.6023 417 | 1/12
21 h-m-p 1.5912 8.0000 1.3834 YCCCC 1763.870054 4 2.9934 439 | 1/12
22 h-m-p 1.2436 6.2178 0.8868 CCC 1763.658853 2 0.4169 458 | 1/12
23 h-m-p 0.4815 8.0000 0.7679 +CCC 1763.534016 2 3.1992 489 | 1/12
24 h-m-p 1.6000 8.0000 0.0495 CC 1763.526665 1 1.3151 517 | 1/12
25 h-m-p 0.5006 8.0000 0.1300 +CC 1763.522854 1 2.2744 546 | 1/12
26 h-m-p 1.6000 8.0000 0.0711 YC 1763.518594 1 3.9193 573 | 1/12
27 h-m-p 1.6000 8.0000 0.0300 CC 1763.517719 1 2.1399 601 | 1/12
28 h-m-p 1.6000 8.0000 0.0138 +YC 1763.516792 1 4.7740 629 | 1/12
29 h-m-p 1.6000 8.0000 0.0137 C 1763.516708 0 2.0319 655 | 1/12
30 h-m-p 1.6000 8.0000 0.0042 YC 1763.516599 1 3.6978 682 | 1/12
31 h-m-p 1.6000 8.0000 0.0059 Y 1763.516597 0 1.1399 708 | 1/12
32 h-m-p 1.6000 8.0000 0.0002 +C 1763.516596 0 5.8277 735 | 1/12
33 h-m-p 1.6000 8.0000 0.0004 Y 1763.516596 0 1.1013 761 | 1/12
34 h-m-p 1.6000 8.0000 0.0000 ++ 1763.516596 m 8.0000 787 | 1/12
35 h-m-p 0.1439 8.0000 0.0014 ++C 1763.516596 0 2.5146 815 | 1/12
36 h-m-p 1.6000 8.0000 0.0019 ++ 1763.516596 m 8.0000 841 | 1/12
37 h-m-p 0.0013 0.6310 202.3253 ++YYYYC 1763.515605 4 0.0202 873 | 1/12
38 h-m-p 0.9455 8.0000 4.3206 ----------------.. | 1/12
39 h-m-p 0.0003 0.1528 0.4649 Y 1763.515600 0 0.0000 917 | 1/12
40 h-m-p 0.0006 0.3022 0.2101 C 1763.515590 0 0.0006 943 | 1/12
41 h-m-p 0.0160 8.0000 0.0667 +YC 1763.515503 1 0.0437 971 | 1/12
42 h-m-p 0.1382 8.0000 0.0211 C 1763.515461 0 0.2091 997 | 1/12
43 h-m-p 0.1358 8.0000 0.0325 Y 1763.515405 0 0.2441 1023 | 1/12
44 h-m-p 0.1524 8.0000 0.0520 YC 1763.515378 1 0.0817 1050 | 1/12
45 h-m-p 0.2429 8.0000 0.0175 C 1763.515356 0 0.2868 1076 | 1/12
46 h-m-p 0.2408 8.0000 0.0208 +YC 1763.515227 1 1.7505 1104 | 1/12
47 h-m-p 1.6000 8.0000 0.0015 ++ 1763.515210 m 8.0000 1130 | 1/12
48 h-m-p 0.0160 8.0000 0.7816 +++++ 1762.936666 m 8.0000 1159 | 1/12
49 h-m-p 0.9972 8.0000 6.2702 ----------------.. | 1/12
50 h-m-p 0.0000 0.0143 51.8849 CCC 1762.889808 2 0.0000 1218 | 1/12
51 h-m-p 0.0005 0.0171 3.6227 CC 1762.885429 1 0.0007 1235 | 1/12
52 h-m-p 0.0018 0.5976 1.3318 ++YC 1762.831223 1 0.0660 1253 | 1/12
53 h-m-p 0.0889 8.0000 0.9883 +YCCC 1762.628941 3 0.6801 1274 | 1/12
54 h-m-p 0.0715 1.3595 9.4047 CYCYCCC 1761.779558 6 0.1443 1310 | 1/12
55 h-m-p 0.6744 5.7258 2.0117 YCCCC 1761.590770 4 0.1811 1332 | 1/12
56 h-m-p 0.2908 6.5379 1.2529 YCCC 1760.649126 3 0.5955 1352 | 1/12
57 h-m-p 0.1218 0.8450 6.1269 CCCC 1759.468135 3 0.1256 1373 | 1/12
58 h-m-p 0.5837 3.9844 1.3180 YCCC 1758.985128 3 0.3620 1393 | 1/12
59 h-m-p 0.2461 7.0480 1.9389 ++YYCCC 1756.063611 4 3.3157 1416 | 1/12
60 h-m-p 0.1507 0.7533 10.1324 CYCCC 1754.441852 4 0.2955 1438 | 1/12
61 h-m-p 1.6000 8.0000 0.9387 YCCC 1753.544740 3 1.2311 1458 | 1/12
62 h-m-p 0.6284 3.1421 1.8174 CCC 1752.872933 2 0.7221 1488 | 1/12
63 h-m-p 0.6738 3.3692 1.5636 YCCCC 1752.525537 4 1.2922 1510 | 1/12
64 h-m-p 0.7971 3.9855 0.5517 YCC 1752.413831 2 0.5869 1528 | 1/12
65 h-m-p 0.8162 4.5045 0.3967 YCCC 1752.292900 3 1.4039 1559 | 1/12
66 h-m-p 1.6000 8.0000 0.3273 CCC 1752.256997 2 1.6863 1589 | 1/12
67 h-m-p 1.6000 8.0000 0.1585 CC 1752.246173 1 1.5124 1617 | 1/12
68 h-m-p 1.6000 8.0000 0.0385 YC 1752.240068 1 3.4108 1644 | 1/12
69 h-m-p 1.4493 8.0000 0.0906 ++ 1752.201317 m 8.0000 1670 | 1/12
70 h-m-p 0.0711 0.3556 7.5969 ++ 1751.966700 m 0.3556 1696 | 2/12
71 h-m-p 1.2199 8.0000 2.0901 ---------------Y 1751.966700 0 0.0000 1726 | 2/12
72 h-m-p 0.0003 0.1537 53.2347 +CC 1751.961592 1 0.0015 1744 | 2/12
73 h-m-p 0.1847 8.0000 0.4282 ++CCY 1751.740543 2 2.9274 1765 | 2/12
74 h-m-p 0.9881 8.0000 1.2686 YYC 1751.696821 2 0.7513 1792 | 2/12
75 h-m-p 1.6000 8.0000 0.0609 YC 1751.687268 1 1.0994 1808 | 2/12
76 h-m-p 0.3250 8.0000 0.2060 +YC 1751.686265 1 0.8308 1835 | 2/12
77 h-m-p 1.6000 8.0000 0.0126 YC 1751.686210 1 0.8571 1861 | 2/12
78 h-m-p 1.6000 8.0000 0.0066 C 1751.686205 0 1.4210 1886 | 2/12
79 h-m-p 1.6000 8.0000 0.0036 +Y 1751.686190 0 4.6208 1912 | 2/12
80 h-m-p 0.9300 8.0000 0.0180 ++ 1751.686075 m 8.0000 1937 | 2/12
81 h-m-p 1.4321 8.0000 0.1004 ++ 1751.685018 m 8.0000 1962 | 2/12
82 h-m-p 0.4189 8.0000 1.9178 +CYYC 1751.680164 3 3.4797 1992 | 2/12
83 h-m-p 1.6000 8.0000 1.9746 YYYYYY 1751.676583 5 1.6000 2012 | 2/12
84 h-m-p 1.6000 8.0000 0.8688 C 1751.676338 0 0.5496 2027 | 2/12
85 h-m-p 0.6527 8.0000 0.7316 C 1751.676251 0 0.6757 2052 | 2/12
86 h-m-p 0.9093 8.0000 0.5436 Y 1751.676227 0 0.9093 2077 | 2/12
87 h-m-p 1.6000 8.0000 0.0485 Y 1751.676217 0 1.1002 2102 | 2/12
88 h-m-p 0.6513 8.0000 0.0820 Y 1751.676216 0 1.2699 2127 | 2/12
89 h-m-p 1.6000 8.0000 0.0020 Y 1751.676216 0 1.1056 2152 | 2/12
90 h-m-p 1.6000 8.0000 0.0001 --Y 1751.676216 0 0.0434 2179 | 2/12
91 h-m-p 0.0160 8.0000 0.0016 -C 1751.676216 0 0.0010 2205 | 2/12
92 h-m-p 0.1199 8.0000 0.0000 -C 1751.676216 0 0.0075 2231 | 2/12
93 h-m-p 0.0160 8.0000 0.0000 ----C 1751.676216 0 0.0000 2260
Out..
lnL = -1751.676216
2261 lfun, 9044 eigenQcodon, 47481 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1758.950451 S = -1689.690420 -90.938197
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 112 patterns 0:24
did 20 / 112 patterns 0:24
did 30 / 112 patterns 0:24
did 40 / 112 patterns 0:24
did 50 / 112 patterns 0:24
did 60 / 112 patterns 0:24
did 70 / 112 patterns 0:24
did 80 / 112 patterns 0:24
did 90 / 112 patterns 0:24
did 100 / 112 patterns 0:24
did 110 / 112 patterns 0:24
did 112 / 112 patterns 0:24end of tree file.
Time used: 0:24
Model 7: beta
TREE # 1
(1, 6, (2, 3, 4, 5)); MP score: 309
0.042139 0.010285 0.063374 0.011464 0.051208 0.038812 0.025130 1.394409 0.435547 1.987177
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.289170
np = 10
lnL0 = -2969.857836
Iterating by ming2
Initial: fx= 2969.857836
x= 0.04214 0.01028 0.06337 0.01146 0.05121 0.03881 0.02513 1.39441 0.43555 1.98718
1 h-m-p 0.0000 0.0006 10610.8151 +++ 1849.737978 m 0.0006 16 | 0/10
2 h-m-p 0.0053 0.0406 1249.5134 --CCYCCC 1844.007808 5 0.0000 40 | 0/10
3 h-m-p 0.0001 0.0006 98.7689 ++ 1839.295026 m 0.0006 53 | 0/10
4 h-m-p 0.0003 0.0113 173.6151 ++YCYCCC 1825.325283 5 0.0034 76 | 0/10
5 h-m-p 0.0115 0.0671 51.2310 +YYCCC 1785.945266 4 0.0424 96 | 0/10
6 h-m-p 0.0457 0.2287 43.3828 CYYCCC 1776.264621 5 0.0252 118 | 0/10
7 h-m-p 0.0993 0.4964 9.0156 CYCCC 1773.943131 4 0.0685 138 | 0/10
8 h-m-p 0.1278 1.6258 4.8341 +YYCCC 1767.522364 4 0.6648 158 | 0/10
9 h-m-p 0.1200 0.6001 7.3186 CYCCCC 1763.520044 5 0.2255 180 | 0/10
10 h-m-p 0.0797 0.3983 9.9343 YYC 1762.249660 2 0.0634 195 | 0/10
11 h-m-p 0.2773 1.8208 2.2702 ++ 1753.639508 m 1.8208 208 | 0/10
12 h-m-p 1.2016 6.0080 0.7485 CCCCC 1751.862703 4 1.3417 229 | 0/10
13 h-m-p 0.3578 1.7888 0.8148 +C 1751.480198 0 1.4310 253 | 0/10
14 h-m-p 1.6000 8.0000 0.3672 CCC 1751.301753 2 1.4271 280 | 0/10
15 h-m-p 1.6000 8.0000 0.1281 YC 1751.165979 1 3.2740 304 | 0/10
16 h-m-p 0.4940 2.4702 0.1934 ++ 1751.042267 m 2.4702 327 | 1/10
17 h-m-p 1.6000 8.0000 0.2609 YC 1751.007691 1 1.1789 351 | 1/10
18 h-m-p 1.6000 8.0000 0.1426 CC 1750.963848 1 1.8157 375 | 1/10
19 h-m-p 1.6000 8.0000 0.0768 CCC 1750.918599 2 2.4772 401 | 1/10
20 h-m-p 1.6000 8.0000 0.0436 CC 1750.914443 1 1.7517 425 | 1/10
21 h-m-p 1.6000 8.0000 0.0099 ++ 1750.907668 m 8.0000 447 | 1/10
22 h-m-p 0.5119 8.0000 0.1552 +YC 1750.887612 1 3.6204 471 | 1/10
23 h-m-p 1.6000 8.0000 0.2466 YC 1750.854828 1 3.4506 494 | 1/10
24 h-m-p 1.6000 8.0000 0.0250 CC 1750.847018 1 2.2474 518 | 1/10
25 h-m-p 1.4749 8.0000 0.0381 ++ 1750.831405 m 8.0000 540 | 1/10
26 h-m-p 1.6000 8.0000 0.1037 ++ 1750.648271 m 8.0000 562 | 1/10
27 h-m-p 0.3738 8.0000 2.2205 +CYCC 1750.092146 3 1.7552 590 | 1/10
28 h-m-p 1.6000 8.0000 0.0489 CC 1750.076594 1 1.4486 605 | 1/10
29 h-m-p 1.4113 8.0000 0.0502 CC 1750.075333 1 1.6907 629 | 1/10
30 h-m-p 1.6000 8.0000 0.0039 Y 1750.075290 0 0.9945 651 | 1/10
31 h-m-p 0.2076 8.0000 0.0189 +C 1750.075275 0 1.2835 674 | 1/10
32 h-m-p 1.6000 8.0000 0.0052 C 1750.075272 0 1.6468 696 | 1/10
33 h-m-p 1.6000 8.0000 0.0003 C 1750.075272 0 1.3120 718 | 1/10
34 h-m-p 1.6000 8.0000 0.0001 Y 1750.075272 0 1.2371 740 | 1/10
35 h-m-p 1.6000 8.0000 0.0000 C 1750.075272 0 1.6000 762 | 1/10
36 h-m-p 1.6000 8.0000 0.0000 ---------C 1750.075272 0 0.0000 793
Out..
lnL = -1750.075272
794 lfun, 8734 eigenQcodon, 55580 P(t)
end of tree file.
Time used: 0:45
Model 8: beta&w>1
TREE # 1
(1, 6, (2, 3, 4, 5)); MP score: 309
0.042248 0.062205 0.056835 0.044702 0.027429 0.024319 0.023357 1.320126 0.900000 0.756803 1.852180 1.300000
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 10.181643
np = 12
lnL0 = -2879.933529
Iterating by ming2
Initial: fx= 2879.933529
x= 0.04225 0.06220 0.05683 0.04470 0.02743 0.02432 0.02336 1.32013 0.90000 0.75680 1.85218 1.30000
1 h-m-p 0.0000 0.0005 5492.7145 +++ 1858.962233 m 0.0005 18 | 0/12
2 h-m-p 0.0001 0.0007 429.3278 CYYCCC 1855.304306 5 0.0001 41 | 0/12
3 h-m-p 0.0001 0.0006 123.3417 ++ 1846.954068 m 0.0006 56 | 1/12
4 h-m-p 0.0002 0.0084 257.3232 ++YCYCCCC 1801.703318 6 0.0053 83 | 1/12
5 h-m-p 0.0009 0.0047 35.4655 ++ 1798.827992 m 0.0047 98 | 2/12
6 h-m-p 0.0079 0.0463 20.4706 CCCC 1796.899795 3 0.0120 119 | 2/12
7 h-m-p 0.0414 0.5559 5.9083 CCC 1796.319920 2 0.0374 138 | 2/12
8 h-m-p 0.0230 0.6803 9.6276 YCCC 1795.452238 3 0.0454 158 | 2/12
9 h-m-p 0.0378 0.6796 11.5813 YCCC 1793.853936 3 0.0820 178 | 2/12
10 h-m-p 0.0497 0.2486 13.5982 YCC 1793.199422 2 0.0307 196 | 2/12
11 h-m-p 0.6940 8.0000 0.6025 CYC 1792.571495 2 0.7445 214 | 2/12
12 h-m-p 0.0555 1.0324 8.0859 YCC 1791.420436 2 0.0988 242 | 2/12
13 h-m-p 0.7813 8.0000 1.0220 ++ 1787.012404 m 8.0000 257 | 1/12
14 h-m-p 0.0003 0.0014 1959.9406 CYCCC 1786.728540 4 0.0002 280 | 1/12
15 h-m-p 0.1634 1.3368 1.8783 ++ 1779.514560 m 1.3368 295 | 2/12
16 h-m-p 0.3423 5.6358 7.3279 +CCCC 1771.125050 3 1.6104 317 | 2/12
17 h-m-p 1.6000 8.0000 6.2179 YYCCC 1766.600992 4 2.2511 338 | 2/12
18 h-m-p 1.6000 8.0000 2.7008 CCCC 1765.396908 3 2.6997 359 | 2/12
19 h-m-p 1.6000 8.0000 1.2079 +YCCC 1764.463710 3 5.0382 380 | 1/12
20 h-m-p 1.6000 8.0000 2.9767 -YCCC 1764.243629 3 0.1570 401 | 1/12
21 h-m-p 0.3141 8.0000 1.4878 ++CCC 1762.011469 2 5.1157 422 | 0/12
22 h-m-p 0.0052 0.0258 426.4127 YCC 1762.000137 2 0.0007 440 | 0/12
23 h-m-p 0.1518 0.7588 0.6613 ++ 1761.302828 m 0.7588 455 | 1/12
24 h-m-p 0.0339 0.2241 14.8030 ++ 1758.652021 m 0.2241 482 | 2/12
25 h-m-p 0.3377 1.6884 4.0111 CCCCC 1757.471008 4 0.4119 505 | 2/12
26 h-m-p 0.2115 5.0133 7.8126 +++ 1752.285495 m 5.0133 521 | 3/12
27 h-m-p 1.3715 6.8574 1.0622 YYCC 1751.300322 3 1.0256 540 | 3/12
28 h-m-p 1.0767 8.0000 1.0117 YYCCC 1749.893270 4 1.5258 561 | 2/12
29 h-m-p 0.1151 0.8075 13.4101 ---CC 1749.892208 1 0.0007 581 | 2/12
30 h-m-p 0.0055 0.0637 1.6543 ++ 1749.787501 m 0.0637 596 | 3/12
31 h-m-p 0.0329 3.2637 3.2021 ++YCCCCC 1748.828034 5 0.6217 622 | 3/12
32 h-m-p 1.6000 8.0000 0.8140 YCCC 1747.959964 3 3.7959 642 | 3/12
33 h-m-p 0.6472 3.2361 0.7851 YCCC 1747.790979 3 0.4513 671 | 3/12
34 h-m-p 0.5122 4.8658 0.6917 +CCC 1747.703298 2 1.8681 700 | 3/12
35 h-m-p 1.5424 7.7122 0.4497 YC 1747.622756 1 3.1298 725 | 3/12
36 h-m-p 1.6000 8.0000 0.2846 CC 1747.545354 1 2.4865 751 | 2/12
37 h-m-p 0.4670 7.9752 1.5153 YC 1747.528803 1 0.2496 776 | 2/12
38 h-m-p 1.6000 8.0000 0.1891 CC 1747.521132 1 2.1692 793 | 2/12
39 h-m-p 1.6000 8.0000 0.0835 YC 1747.513639 1 3.2465 819 | 2/12
40 h-m-p 1.6000 8.0000 0.0701 YC 1747.510862 1 2.6221 845 | 2/12
41 h-m-p 1.6000 8.0000 0.0242 CC 1747.507801 1 2.4937 872 | 1/12
42 h-m-p 1.6000 8.0000 0.0265 ++ 1747.501697 m 8.0000 897 | 1/12
43 h-m-p 1.6000 8.0000 0.1280 YC 1747.497980 1 2.6547 924 | 1/12
44 h-m-p 1.6000 8.0000 0.0957 ++ 1747.484630 m 8.0000 950 | 1/12
45 h-m-p 0.9439 8.0000 0.8111 ++ 1747.370105 m 8.0000 976 | 1/12
46 h-m-p 0.5667 6.6037 11.4504 +
QuantileBeta(0.15, 0.00500, 16.27594) = 1.305912e-161 2000 rounds
YCYC 1747.172909 3 1.5697 1007 | 1/12
47 h-m-p 1.6000 8.0000 5.6714 YCCC 1747.125161 3 0.8765 1027 | 1/12
48 h-m-p 0.8123 8.0000 6.1197 CYCCC 1747.043573 4 1.2532 1049 | 1/12
49 h-m-p 1.0497 5.2484 0.5224 +YCC 1746.876275 2 2.8659 1068 | 1/12
50 h-m-p 0.1604 6.6589 9.3328 ++YCYCC 1746.500192 4 1.8927 1102 | 1/12
51 h-m-p 0.6108 3.0538 1.4270 YCCC 1746.164782 3 1.0896 1122 | 1/12
52 h-m-p 0.1667 1.6945 9.3267 +CCCC 1745.963474 3 0.8810 1144 | 1/12
53 h-m-p 0.1115 0.5575 6.5587 +YC 1745.908393 1 0.3116 1161 | 1/12
54 h-m-p 0.2218 1.1091 2.3468 +CC 1745.852122 1 0.9217 1179 | 1/12
55 h-m-p 1.6000 8.0000 0.4699 CCC 1745.813554 2 2.5715 1198 | 1/12
56 h-m-p 1.6000 8.0000 0.6521 CC 1745.786128 1 2.0687 1226 | 1/12
57 h-m-p 1.6000 8.0000 0.7223 CCC 1745.765502 2 1.9910 1256 | 1/12
58 h-m-p 1.5283 8.0000 0.9409 YYC 1745.754891 2 1.2094 1284 | 1/12
59 h-m-p 1.6000 8.0000 0.6550 CCC 1745.744824 2 2.2055 1314 | 1/12
60 h-m-p 1.6000 8.0000 0.4932 C 1745.732178 0 1.6000 1340 | 1/12
61 h-m-p 1.6000 8.0000 0.4871 YCC 1745.725771 2 1.0894 1369 | 1/12
62 h-m-p 1.6000 8.0000 0.1623 YC 1745.725331 1 1.0215 1396 | 1/12
63 h-m-p 1.6000 8.0000 0.0300 Y 1745.725327 0 0.7798 1422 | 1/12
64 h-m-p 1.6000 8.0000 0.0092 Y 1745.725326 0 0.7490 1448 | 1/12
65 h-m-p 1.6000 8.0000 0.0012 Y 1745.725326 0 0.9024 1474 | 1/12
66 h-m-p 1.6000 8.0000 0.0000 Y 1745.725326 0 0.9174 1500 | 1/12
67 h-m-p 1.6000 8.0000 0.0000 ----C 1745.725326 0 0.0015 1530
Out..
lnL = -1745.725326
1531 lfun, 18372 eigenQcodon, 117887 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1761.031622 S = -1696.266725 -67.701765
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 112 patterns 1:30
did 20 / 112 patterns 1:30
did 30 / 112 patterns 1:30
did 40 / 112 patterns 1:31
did 50 / 112 patterns 1:31
did 60 / 112 patterns 1:31
did 70 / 112 patterns 1:31
did 80 / 112 patterns 1:31
did 90 / 112 patterns 1:32
did 100 / 112 patterns 1:32
did 110 / 112 patterns 1:32
did 112 / 112 patterns 1:32end of tree file.
Time used: 1:32
The loglikelihoods for models M1, M2, M7 and M8 are -1751.676216 -1751.676216 -1750.075272 -1745.725326 respectively
The loglikelihood for model M8 is significantly different from that for M7. Twice the difference is 8.699892
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus MKIILFSILIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFHPLADNKF---
BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus MRVVALLLLISPVFS--RQVFHYIDCVAGSSTTFGLPC-EGLIQTQSSVQFVPDQQYGRV
BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus MRVILLLAVLYVALATSREVHHYIDCVRGTSRTLQLPC-DGTVESTTPVQFTPDYAYGSI
BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus MRVLILLSLLSVALTAAPEIHHYIDCVRGTSTTILQPC-DGVIESTSPVQFTPNTQYGSL
BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus MRVLLLLSLCAFALS--KEIHYYVDCISGTSTTVNQPC-DGVIESTSPVQFTPNYAYGSL
JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus MKIILFLTLIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFHPLADNKF---
*::: : : . ::.:* :*: *:: . ** .* : :..: .: :
16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQEKVYQELYSPLFLIVIALVFI
BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus GVLCISNYVQTFRISCPHGN-HTFIIR-----STTYRTNVRVTQPQSGDLMMLILCFLII
BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus AVPC--NVVFQMRISCPLGN-YTYHVR-----PVSFRTHTRYSQPQGNELQCLIVFLLIL
BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus AVSC--SLVTQIRISCPHGN-HTFHVR-----PVSFRTHTRYSQPQGNELQCLIVTLLIV
BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus AVAC--NSVVQIRILCPRGN-YTFHIR-----PVSFRTHTRYSQPQGNEVQCLVVTLLLV
JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQEKVYQELYSPLFLIVAALVFI
.: * : : *. *. :*: :* . : : : * . : :: ::::
16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus ILCFTIKRKIE
BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus LVLYVCLWR--
BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus IVFYLVFRRR-
BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus IVLYLFFRRR-
BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus ILLILLFRRR-
JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus ILCFTIKRKIE
:: :
>16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus ATGAAAATTATTCTCTTCTCGATATTGATTGTACTTGCAACTTGC---------GAGTTATATCACTATCAAGAGTGTGTTAGAGGTACTACTGTACTATTAGAGGAACCTTGCCCATCAGGAACTTACGAGGGCAATTCACCATTTCATCCTCTTGCTGATAACAAATTT---------GCACTAACTTGC---------ATTAGCACACATTTTGCTTTTGCTTGTGCTGACGGTACTAGACATACCTATCAGCTTCGTGCAAGATCAGTTTCACCTAAACTTTTCACCAGACAAGAGAAAGTTTACCAAGAGCTCTATTCGCCGCTTTTTCTCATTGTTATTGCTTTAGTATTTATAATACTTTGCTTCACCATTAAGAGGAAGATAGAA >BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus ATGCGAGTCGTTGCACTACTCTTGCTAATTTCACCCGTTTTTTCA------AGACAAGTCTTCCACTATATTGATTGTGTAGCTGGCAGTTCAACTACATTTGGTTTACCCTGT---GAAGGGCTTATTCAAACCCAATCTAGTGTACAATTTGTCCCAGACCAACAATATGGTCGTGTAGGTGTTTTATGCATTAGTAATTATGTGCAGACTTTTCGCATTTCTTGTCCACATGGCAAC---CACACTTTTATCATAAGA---------------TCAACCACTTACAGAACTAATGTCAGAGTCACACAACCCCAAAGTGGTGACTTAATGATGTTAATCTTGTGTTTTCTTATTATATTAGTCCTTTATGTTTGCCTCTGGCGT------ >BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus ATGCGTGTCATTTTGCTCCTTGCTGTTCTCTATGTAGCACTTGCTACATCTCGCGAAGTACATCATTACATTGATTGTGTTCGCGGTACATCCAGGACCCTACAACTTCCCTGT---GATGGAACAGTAGAGAGTACTACACCTGTCCAGTTTACACCGGACTATGCTTATGGTAGTATTGCTGTACCATGT------AATGTGGTCTTTCAGATGCGCATTTCTTGTCCACTTGGTAAT---TATACTTATCATGTTAGA---------------CCTGTCAGCTTCAGGACTCACACTCGCTACTCACAACCCCAGGGAAATGAGTTGCAGTGCCTGATAGTCTTTCTTCTAATTCTGATTGTTTTCTACCTTGTTTTCCGCAGACGC--- >BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus ATGCGTGTGCTAATTCTACTTTCACTGTTGTCAGTGGCGCTTACAGCTGCGCCAGAGATACATCATTATATTGATTGTGTCCGTGGGACATCTACCACCATCTTACAACCATGT---GATGGTGTTATAGAAAGTACAAGCCCAGTGCAGTTCACACCTAATACCCAGTATGGTAGTTTGGCAGTGTCTTGC------AGCTTGGTGACACAAATTCGCATTTCTTGTCCTCATGGTAAT---CACACATTTCATGTTAGA---------------CCTGTTAGTTTCAGAACACATACACGCTACTCCCAGCCGCAAGGTAATGAGTTGCAGTGCCTGATTGTCACTCTTCTAATTGTAATTGTTCTTTACCTGTTCTTTCGCAGACGT--- >BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus ATGCGTGTGTTGCTTCTGCTTTCGCTTTGTGCCTTTGCACTATCT------AAGGAGATACACTACTATGTAGATTGTATTTCTGGCACTTCCACCACTGTTAACCAACCTTGT---GATGGAGTAATAGAAAGCACTAGCCCTGTACAATTTACACCAAACTATGCATATGGCAGTTTGGCTGTCGCCTGC------AATAGTGTTGTACAAATTCGCATTCTGTGTCCCCGTGGTAAT---TACACTTTTCACATTAGA---------------CCTGTAAGCTTTAGGACGCACACTCGTTATTCTCAACCCCAGGGAAACGAGGTGCAATGTCTTGTAGTAACTCTTCTACTTGTGATTCTTCTCATCCTGCTGTTTCGCAGGCGC--- >JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus ATGAAAATTATTCTCTTCTTGACATTGATTGTACTTGCAACTTGC---------GAGTTATATCACTATCAAGAGTGTGTTAGAGGTACCACTGTACTATTAGAAGAACCTTGCCCATCAGGAACTTACGAGGGCAATTCACCATTTCATCCTCTTGCTGATAACAAATTT---------GCACTAACTTGC---------ATTAGCACACATTTTGCTTTTGCTTGTGCTGACGGTACTAGACATACCTATCAGCTTCGTGCAAGATCAGTTTCACCTAAACTTTTCACCAGACAAGAGAAAGTTTACCAAGAGCTCTATTCGCCGCTTTTTCTCATTGTTGCTGCTTTAGTATTTATAATACTTTGCTTCACCATTAAGAGGAAGATAGAA
>16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus MKIILFSILIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFHPLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQEKVYQELYSPLFLIVIALVFIILCFTIKRKIE >BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus MRVVALLLLISPVFS--RQVFHYIDCVAGSSTTFGLPC-EGLIQTQSSVQFVPDQQYGRVGVLCISNYVQTFRISCPHGN-HTFIIR-----STTYRTNVRVTQPQSGDLMMLILCFLIILVLYVCLWR-- >BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus MRVILLLAVLYVALATSREVHHYIDCVRGTSRTLQLPC-DGTVESTTPVQFTPDYAYGSIAVPC--NVVFQMRISCPLGN-YTYHVR-----PVSFRTHTRYSQPQGNELQCLIVFLLILIVFYLVFRRR- >BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus MRVLILLSLLSVALTAAPEIHHYIDCVRGTSTTILQPC-DGVIESTSPVQFTPNTQYGSLAVSC--SLVTQIRISCPHGN-HTFHVR-----PVSFRTHTRYSQPQGNELQCLIVTLLIVIVLYLFFRRR- >BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus MRVLLLLSLCAFALS--KEIHYYVDCISGTSTTVNQPC-DGVIESTSPVQFTPNYAYGSLAVAC--NSVVQIRILCPRGN-YTFHIR-----PVSFRTHTRYSQPQGNEVQCLVVTLLLVILLILLFRRR- >JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus MKIILFLTLIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFHPLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQEKVYQELYSPLFLIVAALVFIILCFTIKRKIE
Reading sequence file /data//pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/original_alignment/codeml/fasta/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1
Found 6 sequences of length 393
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 45.2%
Found 191 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0% 77.4%100.0%
Using a window size of 80 with k as 39
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 173 polymorphic sites
**p-Value(s)**
----------
NSS: 3.35e-01 (1000 permutations)
Max Chi^2: 2.50e-02 (1000 permutations)
PHI (Permutation): 2.27e-01 (1000 permutations)
PHI (Normal): 2.27e-01
#NEXUS
[ID: 2300683947]
begin taxa;
dimensions ntax=6;
taxlabels
16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus
BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus
BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus
BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus
BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus
JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus
;
end;
begin trees;
translate
1 16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus,
2 BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus,
3 BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus,
4 BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus,
5 BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus,
6 JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.321219e-02,6:1.178808e-02,(2:1.684692e+00,3:3.187579e-01,4:1.703225e-01,5:3.727250e-01)1.000:5.270861e+00);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.321219e-02,6:1.178808e-02,(2:1.684692e+00,3:3.187579e-01,4:1.703225e-01,5:3.727250e-01):5.270861e+00);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1939.39 -1951.79
2 -1939.65 -1950.64
--------------------------------------
TOTAL -1939.51 -1951.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 9.359770 17.346309 3.801414 17.337440 8.299917 1042.03 1042.74 1.000
r(A<->C){all} 0.095462 0.001593 0.018056 0.172554 0.092652 574.10 606.93 1.007
r(A<->G){all} 0.289586 0.003011 0.184123 0.391569 0.287680 633.07 761.77 1.003
r(A<->T){all} 0.124411 0.001055 0.061570 0.188272 0.122730 750.69 756.81 1.000
r(C<->G){all} 0.215149 0.002679 0.117893 0.319172 0.212132 499.42 575.51 1.001
r(C<->T){all} 0.221506 0.001744 0.144979 0.303931 0.218476 653.69 790.97 1.000
r(G<->T){all} 0.053886 0.000855 0.001834 0.108546 0.050386 675.80 706.99 1.000
pi(A){all} 0.257980 0.000226 0.230808 0.289110 0.257683 1181.37 1245.02 1.000
pi(C){all} 0.224931 0.000208 0.198144 0.253001 0.224249 957.58 1049.73 1.000
pi(G){all} 0.169224 0.000170 0.143341 0.194449 0.168816 885.14 1080.63 1.000
pi(T){all} 0.347865 0.000292 0.313205 0.379268 0.347720 1020.78 1126.36 1.001
alpha{1,2} 0.449771 0.011952 0.262566 0.662106 0.437718 891.02 934.64 1.000
alpha{3} 3.548336 1.840352 1.231004 6.214059 3.342433 1045.30 1208.60 1.000
pinvar{all} 0.027413 0.000468 0.000003 0.069589 0.022549 1225.54 1292.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 113
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 6 6 3 2 5 6 | Ser TCT 0 2 1 3 3 0 | Tyr TAT 4 4 5 2 4 4 | Cys TGT 2 4 4 3 5 2
TTC 3 1 3 3 0 3 | TCC 0 0 1 1 1 0 | TAC 2 1 3 2 2 2 | TGC 4 2 1 2 1 4
Leu TTA 3 5 0 1 0 3 | TCA 2 4 1 2 0 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 2 2 3 1 2 | TCG 2 0 0 0 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 1 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 6 3 6 4 7 6 | Pro CCT 3 0 2 3 3 3 | His CAT 3 1 3 5 0 3 | Arg CGT 1 1 1 2 3 1
CTC 3 2 2 0 1 3 | CCC 0 3 2 0 2 0 | CAC 1 2 1 1 3 1 | CGC 0 1 4 3 2 0
CTA 2 2 2 3 2 2 | CCA 1 2 2 2 1 1 | Gln CAA 3 8 2 3 5 3 | CGA 0 1 0 0 0 0
CTG 0 0 2 3 4 0 | CCG 1 0 1 1 0 1 | CAG 1 1 4 4 1 1 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 7 5 5 7 5 6 | Thr ACT 6 5 4 1 6 5 | Asn AAT 1 1 2 3 1 1 | Ser AGT 0 3 1 2 1 0
ATC 0 2 0 1 1 0 | ACC 3 2 1 3 1 4 | AAC 1 1 0 0 3 1 | AGC 1 0 1 1 3 1
ATA 3 2 1 2 2 2 | ACA 1 2 4 8 1 2 | Lys AAA 4 0 0 0 0 4 | Arg AGA 2 3 2 3 1 2
Met ATG 1 3 2 1 1 1 | ACG 0 0 0 0 1 0 | AAG 2 0 0 0 0 2 | AGG 1 0 2 0 2 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 4 5 4 2 3 | Ala GCT 5 1 4 0 1 6 | Asp GAT 1 1 2 2 2 1 | Gly GGT 2 3 2 3 1 2
GTC 0 6 5 2 1 0 | GCC 0 0 0 0 2 0 | GAC 1 2 1 0 0 1 | GGC 1 2 0 0 1 1
GTA 3 2 4 1 7 3 | GCA 2 1 1 1 2 2 | Glu GAA 1 1 1 1 1 2 | GGA 1 0 2 0 2 1
GTG 0 1 1 5 3 0 | GCG 0 0 0 1 0 0 | GAG 6 0 2 2 2 5 | GGG 0 1 0 1 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.25664 C:0.22124 A:0.29204 G:0.23009
position 2: T:0.36283 C:0.23009 A:0.27434 G:0.13274
position 3: T:0.44248 C:0.17699 A:0.24779 G:0.13274
Average T:0.35398 C:0.20944 A:0.27139 G:0.16519
#2: C2
position 1: T:0.28319 C:0.23894 A:0.25664 G:0.22124
position 2: T:0.40708 C:0.19469 A:0.20354 G:0.19469
position 3: T:0.38938 C:0.23894 A:0.29204 G:0.07965
Average T:0.35988 C:0.22419 A:0.25074 G:0.16519
#3: C3
position 1: T:0.21239 C:0.30088 A:0.22124 G:0.26549
position 2: T:0.38053 C:0.21239 A:0.23009 G:0.17699
position 3: T:0.44248 C:0.22124 A:0.19469 G:0.14159
Average T:0.34513 C:0.24484 A:0.21534 G:0.19469
#4: C4
position 1: T:0.21239 C:0.30088 A:0.28319 G:0.20354
position 2: T:0.37168 C:0.23009 A:0.22124 G:0.17699
position 3: T:0.40708 C:0.16814 A:0.23894 G:0.18584
Average T:0.33038 C:0.23304 A:0.24779 G:0.18879
#5: C5
position 1: T:0.20354 C:0.30088 A:0.25664 G:0.23894
position 2: T:0.37168 C:0.22124 A:0.21239 G:0.19469
position 3: T:0.43363 C:0.21239 A:0.21239 G:0.14159
Average T:0.33628 C:0.24484 A:0.22714 G:0.19174
#6: C6
position 1: T:0.25664 C:0.22124 A:0.28319 G:0.23894
position 2: T:0.35398 C:0.23894 A:0.27434 G:0.13274
position 3: T:0.43363 C:0.18584 A:0.25664 G:0.12389
Average T:0.34808 C:0.21534 A:0.27139 G:0.16519
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 28 | Ser S TCT 9 | Tyr Y TAT 23 | Cys C TGT 20
TTC 13 | TCC 3 | TAC 12 | TGC 14
Leu L TTA 12 | TCA 11 | *** * TAA 0 | *** * TGA 0
TTG 11 | TCG 4 | TAG 0 | Trp W TGG 1
------------------------------------------------------------------------------
Leu L CTT 32 | Pro P CCT 14 | His H CAT 15 | Arg R CGT 9
CTC 11 | CCC 7 | CAC 9 | CGC 10
CTA 13 | CCA 9 | Gln Q CAA 24 | CGA 1
CTG 9 | CCG 4 | CAG 12 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 35 | Thr T ACT 27 | Asn N AAT 9 | Ser S AGT 7
ATC 4 | ACC 14 | AAC 6 | AGC 7
ATA 12 | ACA 18 | Lys K AAA 8 | Arg R AGA 13
Met M ATG 9 | ACG 1 | AAG 4 | AGG 6
------------------------------------------------------------------------------
Val V GTT 21 | Ala A GCT 17 | Asp D GAT 9 | Gly G GGT 13
GTC 14 | GCC 2 | GAC 5 | GGC 5
GTA 20 | GCA 9 | Glu E GAA 7 | GGA 6
GTG 10 | GCG 1 | GAG 17 | GGG 2
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.23746 C:0.26401 A:0.26549 G:0.23304
position 2: T:0.37463 C:0.22124 A:0.23599 G:0.16814
position 3: T:0.42478 C:0.20059 A:0.24041 G:0.13422
Average T:0.34562 C:0.22861 A:0.24730 G:0.17847
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 6, (2, 3, 4, 5)); MP score: 309
lnL(ntime: 7 np: 10): -1751.676216 +0.000000
7..1 7..6 7..8 8..2 8..3 8..4 8..5
0.058784 0.000004 15.518663 7.662878 1.961718 0.229113 2.135740 1.394409 0.902690 0.046896
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 27.566900
(1: 0.058784, 6: 0.000004, (2: 7.662878, 3: 1.961718, 4: 0.229113, 5: 2.135740): 15.518663);
(C1: 0.058784, C6: 0.000004, (C2: 7.662878, C3: 1.961718, C4: 0.229113, C5: 2.135740): 15.518663);
Detailed output identifying parameters
kappa (ts/tv) = 1.39441
MLEs of dN/dS (w) for site classes (K=2)
p: 0.90269 0.09731
w: 0.04690 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.059 259.0 80.0 0.1396 0.0080 0.0572 2.1 4.6
7..6 0.000 259.0 80.0 0.1396 0.0000 0.0000 0.0 0.0
7..8 15.519 259.0 80.0 0.1396 2.1088 15.1011 546.3 1207.3
8..2 7.663 259.0 80.0 0.1396 1.0413 7.4567 269.7 596.2
8..3 1.962 259.0 80.0 0.1396 0.2666 1.9089 69.1 152.6
8..4 0.229 259.0 80.0 0.1396 0.0311 0.2229 8.1 17.8
8..5 2.136 259.0 80.0 0.1396 0.2902 2.0783 75.2 166.2
Time used: 0:06
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 6, (2, 3, 4, 5)); MP score: 309
lnL(ntime: 7 np: 12): -1751.676216 +0.000000
7..1 7..6 7..8 8..2 8..3 8..4 8..5
0.058784 0.000004 15.518660 7.662874 1.961722 0.229111 2.135742 1.394409 0.902691 0.000899 0.046896 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 27.566897
(1: 0.058784, 6: 0.000004, (2: 7.662874, 3: 1.961722, 4: 0.229111, 5: 2.135742): 15.518660);
(C1: 0.058784, C6: 0.000004, (C2: 7.662874, C3: 1.961722, C4: 0.229111, C5: 2.135742): 15.518660);
Detailed output identifying parameters
kappa (ts/tv) = 1.39441
MLEs of dN/dS (w) for site classes (K=3)
p: 0.90269 0.00090 0.09641
w: 0.04690 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.059 259.0 80.0 0.1396 0.0080 0.0572 2.1 4.6
7..6 0.000 259.0 80.0 0.1396 0.0000 0.0000 0.0 0.0
7..8 15.519 259.0 80.0 0.1396 2.1088 15.1011 546.3 1207.3
8..2 7.663 259.0 80.0 0.1396 1.0413 7.4567 269.7 596.2
8..3 1.962 259.0 80.0 0.1396 0.2666 1.9089 69.1 152.6
8..4 0.229 259.0 80.0 0.1396 0.0311 0.2229 8.1 17.8
8..5 2.136 259.0 80.0 0.1396 0.2902 2.0783 75.2 166.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
32 E 0.522 3.124 +- 2.873
99 I 0.566 3.518 +- 3.485
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.158 0.136 0.121 0.110 0.099 0.090 0.082 0.074 0.068 0.063
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.148
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.028 0.265 0.554
sum of density on p0-p1 = 1.000000
Time used: 0:24
Model 7: beta (10 categories)
TREE # 1: (1, 6, (2, 3, 4, 5)); MP score: 309
lnL(ntime: 7 np: 10): -1750.075272 +0.000000
7..1 7..6 7..8 8..2 8..3 8..4 8..5
0.059414 0.000004 12.363112 5.917461 1.447316 0.562535 1.580241 1.320126 1.327324 14.690020
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 21.930082
(1: 0.059414, 6: 0.000004, (2: 5.917461, 3: 1.447316, 4: 0.562535, 5: 1.580241): 12.363112);
(C1: 0.059414, C6: 0.000004, (C2: 5.917461, C3: 1.447316, C4: 0.562535, C5: 1.580241): 12.363112);
Detailed output identifying parameters
kappa (ts/tv) = 1.32013
Parameters in M7 (beta):
p = 1.32732 q = 14.69002
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00842 0.02068 0.03251 0.04491 0.05849 0.07395 0.09236 0.11581 0.14938 0.21548
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.059 259.6 79.4 0.0812 0.0054 0.0668 1.4 5.3
7..6 0.000 259.6 79.4 0.0812 0.0000 0.0000 0.0 0.0
7..8 12.363 259.6 79.4 0.0812 1.1292 13.9069 293.2 1103.9
8..2 5.917 259.6 79.4 0.0812 0.5405 6.6564 140.3 528.3
8..3 1.447 259.6 79.4 0.0812 0.1322 1.6280 34.3 129.2
8..4 0.563 259.6 79.4 0.0812 0.0514 0.6328 13.3 50.2
8..5 1.580 259.6 79.4 0.0812 0.1443 1.7776 37.5 141.1
Time used: 0:45
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 6, (2, 3, 4, 5)); MP score: 309
lnL(ntime: 7 np: 12): -1745.725326 +0.000000
7..1 7..6 7..8 8..2 8..3 8..4 8..5
0.059185 0.000004 19.060129 8.600921 2.283878 0.087317 2.373211 1.446365 0.933987 1.851938 32.524622 1.506004
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 32.464644
(1: 0.059185, 6: 0.000004, (2: 8.600921, 3: 2.283878, 4: 0.087317, 5: 2.373211): 19.060129);
(C1: 0.059185, C6: 0.000004, (C2: 8.600921, C3: 2.283878, C4: 0.087317, C5: 2.373211): 19.060129);
Detailed output identifying parameters
kappa (ts/tv) = 1.44637
Parameters in M8 (beta&w>1):
p0 = 0.93399 p = 1.85194 q = 32.52462
(p1 = 0.06601) w = 1.50600
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09340 0.09340 0.09340 0.09340 0.09340 0.09340 0.09340 0.09340 0.09340 0.09340 0.06601
w: 0.00899 0.01791 0.02557 0.03315 0.04114 0.04998 0.06030 0.07324 0.09159 0.12773 1.50600
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.059 258.7 80.3 0.1489 0.0084 0.0563 2.2 4.5
7..6 0.000 258.7 80.3 0.1489 0.0000 0.0000 0.0 0.0
7..8 19.060 258.7 80.3 0.1489 2.6981 18.1223 697.9 1455.9
8..2 8.601 258.7 80.3 0.1489 1.2175 8.1777 314.9 657.0
8..3 2.284 258.7 80.3 0.1489 0.3233 2.1715 83.6 174.5
8..4 0.087 258.7 80.3 0.1489 0.0124 0.0830 3.2 6.7
8..5 2.373 258.7 80.3 0.1489 0.3359 2.2564 86.9 181.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
32 E 0.981* 1.480
51 N 0.970* 1.465
52 K 0.924 1.399
58 I 0.918 1.391
60 T 0.968* 1.461
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
32 E 0.640 3.499 +- 3.135
51 N 0.536 2.873 +- 2.934
52 K 0.623 3.252 +- 3.025
99 I 0.573 3.529 +- 3.519
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.995
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.004 0.022 0.062 0.122 0.193 0.265 0.332
ws: 0.145 0.139 0.126 0.113 0.102 0.092 0.082 0.074 0.066 0.060
Time used: 1:32
Model 1: NearlyNeutral -1751.676216
Model 2: PositiveSelection -1751.676216
Model 7: beta -1750.075272
Model 8: beta&w>1 -1745.725326
Model 2 vs 1 0
Model 8 vs 7 8.699892
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
32 E 0.981* 1.480
51 N 0.970* 1.465
52 K 0.924 1.399
58 I 0.918 1.391
60 T 0.968* 1.461
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
32 E 0.640 3.499 +- 3.135
51 N 0.536 2.873 +- 2.934
52 K 0.623 3.252 +- 3.025
99 I 0.573 3.529 +- 3.519
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
