--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:01:53 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpmF/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -229.48 -232.31
2 -229.48 -232.38
--------------------------------------
TOTAL -229.48 -232.35
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890708 0.092928 0.345102 1.498527 0.852784 1501.00 1501.00 1.000
r(A<->C){all} 0.161265 0.020819 0.000081 0.460901 0.119808 124.53 220.27 1.015
r(A<->G){all} 0.165899 0.019086 0.000210 0.440352 0.125234 186.26 197.67 1.006
r(A<->T){all} 0.169447 0.020613 0.000079 0.457314 0.129172 242.44 246.95 1.001
r(C<->G){all} 0.165707 0.019357 0.000056 0.453417 0.128977 108.87 136.82 1.000
r(C<->T){all} 0.170025 0.021562 0.000094 0.463068 0.129575 188.42 200.28 1.009
r(G<->T){all} 0.167658 0.020013 0.000016 0.439750 0.129626 157.40 212.51 1.000
pi(A){all} 0.171605 0.000813 0.120855 0.233208 0.170406 1250.37 1308.89 1.000
pi(C){all} 0.302566 0.001215 0.236268 0.370567 0.301735 1239.91 1245.60 1.000
pi(G){all} 0.354708 0.001339 0.283707 0.424079 0.353825 1053.91 1083.99 1.000
pi(T){all} 0.171121 0.000788 0.117881 0.225774 0.169970 1090.29 1164.32 1.000
alpha{1,2} 0.419989 0.227413 0.000430 1.428350 0.251080 1150.20 1199.10 1.000
alpha{3} 0.459637 0.240464 0.000153 1.395052 0.308159 1052.52 1276.76 1.000
pinvar{all} 0.989927 0.000145 0.967280 0.999996 0.993776 1217.32 1284.08 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -215.399246
Model 2: PositiveSelection -215.399242
Model 0: one-ratio -215.399245
Model 7: beta -215.399246
Model 8: beta&w>1 -215.399215
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 8.00000003664536E-6
Model 8 vs 7 6.20000000139953E-5
>C1
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C2
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C3
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C4
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C5
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C6
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=57
C1 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C2 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C3 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C4 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C5 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C6 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
**************************************************
C1 LIDLDRR
C2 LIDLDRR
C3 LIDLDRR
C4 LIDLDRR
C5 LIDLDRR
C6 LIDLDRR
*******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 57 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 57 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1710]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [1710]--->[1710]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.437 Mb, Max= 30.568 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C2 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C3 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C4 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C5 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C6 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
**************************************************
C1 LIDLDRR
C2 LIDLDRR
C3 LIDLDRR
C4 LIDLDRR
C5 LIDLDRR
C6 LIDLDRR
*******
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
C2 ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
C3 ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
C4 ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
C5 ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
C6 ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
**************************************************
C1 CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
C2 CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
C3 CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
C4 CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
C5 CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
C6 CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
**************************************************
C1 GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
C2 GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
C3 GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
C4 GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
C5 GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
C6 GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
**************************************************
C1 CTTATCGACCTTGACCGGCGT
C2 CTTATCGACCTTGACCGGCGT
C3 CTTATCGACCTTGACCGGCGT
C4 CTTATCGACCTTGACCGGCGT
C5 CTTATCGACCTTGACCGGCGT
C6 CTTATCGACCTTGACCGGCGT
*********************
>C1
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C2
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C3
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C4
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C5
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C6
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C1
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C2
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C3
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C4
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C5
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C6
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 171 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791626
Setting output file names to "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1923730328
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0256297858
Seed = 885538468
Swapseed = 1579791626
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -382.706175 -- -24.965149
Chain 2 -- -382.706139 -- -24.965149
Chain 3 -- -382.706197 -- -24.965149
Chain 4 -- -382.706197 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -382.706175 -- -24.965149
Chain 2 -- -382.706197 -- -24.965149
Chain 3 -- -382.706175 -- -24.965149
Chain 4 -- -382.706197 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-382.706] (-382.706) (-382.706) (-382.706) * [-382.706] (-382.706) (-382.706) (-382.706)
500 -- (-241.036) (-244.387) [-236.981] (-247.470) * (-234.109) [-240.678] (-238.949) (-239.012) -- 0:00:00
1000 -- (-237.667) [-244.514] (-235.807) (-240.257) * (-239.284) (-235.507) (-243.147) [-244.354] -- 0:00:00
1500 -- (-240.752) (-239.400) [-238.446] (-239.523) * (-243.433) [-234.432] (-235.032) (-250.431) -- 0:00:00
2000 -- [-239.868] (-248.677) (-238.641) (-240.654) * (-243.917) (-237.392) [-235.576] (-256.615) -- 0:00:00
2500 -- (-232.288) [-232.186] (-245.388) (-232.690) * [-239.107] (-239.130) (-236.981) (-255.128) -- 0:00:00
3000 -- [-235.217] (-248.599) (-232.553) (-239.706) * (-245.641) (-234.975) [-235.701] (-249.450) -- 0:00:00
3500 -- (-237.788) [-235.407] (-251.123) (-248.909) * (-238.931) (-242.349) [-237.728] (-237.620) -- 0:00:00
4000 -- [-241.525] (-241.220) (-236.885) (-248.264) * [-234.398] (-239.556) (-233.924) (-238.799) -- 0:00:00
4500 -- (-233.787) (-243.249) [-241.402] (-247.388) * (-238.807) (-234.743) [-235.556] (-242.241) -- 0:00:00
5000 -- (-238.380) (-237.253) [-244.688] (-241.771) * (-238.048) [-234.407] (-242.009) (-237.660) -- 0:00:00
Average standard deviation of split frequencies: 0.098209
5500 -- [-237.793] (-238.797) (-245.279) (-238.293) * [-233.574] (-241.891) (-234.802) (-239.009) -- 0:00:00
6000 -- (-242.148) (-237.143) (-257.450) [-228.887] * [-240.477] (-248.009) (-237.680) (-234.113) -- 0:00:00
6500 -- (-239.448) (-239.165) (-249.748) [-228.470] * (-239.397) (-245.026) (-246.594) [-237.288] -- 0:00:00
7000 -- (-236.155) [-236.793] (-244.319) (-231.217) * [-239.054] (-239.330) (-240.794) (-241.214) -- 0:00:00
7500 -- [-238.054] (-242.532) (-241.985) (-228.385) * (-242.777) (-230.480) (-235.514) [-240.968] -- 0:00:00
8000 -- (-238.830) (-243.208) (-241.996) [-229.895] * (-241.758) [-230.427] (-240.488) (-246.967) -- 0:00:00
8500 -- (-237.374) (-244.148) [-245.969] (-230.997) * (-240.683) [-230.001] (-239.524) (-243.511) -- 0:00:00
9000 -- (-244.107) [-238.100] (-237.567) (-229.722) * [-238.939] (-228.815) (-236.658) (-245.697) -- 0:00:00
9500 -- (-239.611) [-234.765] (-229.014) (-229.027) * [-234.418] (-229.442) (-241.087) (-259.566) -- 0:00:00
10000 -- (-245.762) (-237.401) (-228.658) [-229.231] * [-247.065] (-229.448) (-243.240) (-246.995) -- 0:01:39
Average standard deviation of split frequencies: 0.090598
10500 -- (-245.863) (-245.162) (-228.213) [-228.790] * (-242.569) [-229.841] (-243.285) (-239.958) -- 0:01:34
11000 -- (-246.596) (-241.314) [-228.602] (-229.258) * (-241.023) [-228.457] (-236.209) (-241.182) -- 0:01:29
11500 -- (-243.666) (-241.568) [-231.186] (-230.982) * (-241.098) (-228.895) [-239.578] (-235.864) -- 0:01:25
12000 -- [-231.085] (-251.671) (-232.951) (-228.307) * (-242.175) [-228.630] (-243.914) (-228.376) -- 0:01:22
12500 -- (-231.539) (-236.207) (-231.591) [-229.298] * [-242.741] (-228.749) (-252.765) (-228.599) -- 0:01:19
13000 -- (-229.112) [-235.088] (-233.583) (-229.951) * (-239.568) [-229.629] (-253.583) (-230.992) -- 0:01:15
13500 -- [-229.106] (-235.841) (-228.984) (-228.681) * [-239.232] (-229.099) (-246.736) (-232.011) -- 0:01:13
14000 -- [-232.619] (-240.451) (-228.435) (-229.484) * [-236.666] (-228.472) (-243.107) (-228.410) -- 0:01:10
14500 -- (-228.624) (-257.159) [-231.738] (-229.854) * (-239.082) (-228.547) (-239.610) [-231.294] -- 0:01:07
15000 -- (-234.087) (-236.648) (-231.293) [-229.214] * (-240.700) [-233.259] (-235.425) (-229.060) -- 0:01:05
Average standard deviation of split frequencies: 0.075294
15500 -- (-230.554) (-231.363) [-228.708] (-231.208) * (-239.558) (-228.261) (-232.919) [-228.774] -- 0:01:03
16000 -- (-228.437) (-232.222) [-228.354] (-231.268) * (-239.169) (-232.275) (-229.594) [-228.323] -- 0:01:01
16500 -- (-234.800) (-228.048) (-229.371) [-229.878] * (-242.652) (-230.105) [-234.231] (-229.400) -- 0:00:59
17000 -- [-229.006] (-228.980) (-236.467) (-230.972) * (-243.097) (-229.991) [-228.561] (-231.804) -- 0:00:57
17500 -- [-229.673] (-228.772) (-235.788) (-228.874) * (-235.818) (-229.418) [-230.635] (-230.004) -- 0:00:56
18000 -- (-229.656) (-232.125) [-230.841] (-229.254) * [-238.259] (-233.853) (-231.195) (-228.809) -- 0:00:54
18500 -- (-228.821) (-228.063) [-232.646] (-228.646) * [-238.956] (-233.936) (-229.375) (-231.692) -- 0:00:53
19000 -- (-230.944) [-228.670] (-228.348) (-230.751) * [-237.855] (-231.277) (-229.362) (-230.681) -- 0:00:51
19500 -- (-230.766) (-230.258) (-228.359) [-230.623] * (-243.055) (-232.389) [-229.389] (-231.449) -- 0:00:50
20000 -- (-229.201) (-232.679) [-230.007] (-228.850) * (-245.023) (-232.198) [-229.470] (-228.997) -- 0:00:49
Average standard deviation of split frequencies: 0.062094
20500 -- (-231.922) (-232.672) [-228.669] (-229.550) * [-243.328] (-228.829) (-229.232) (-229.979) -- 0:00:47
21000 -- (-229.840) (-229.138) (-229.650) [-229.574] * [-238.705] (-230.157) (-229.713) (-228.343) -- 0:00:46
21500 -- (-229.394) [-230.080] (-232.004) (-228.803) * (-235.747) [-230.710] (-232.527) (-229.815) -- 0:00:45
22000 -- [-228.521] (-230.881) (-230.819) (-228.428) * (-250.989) (-230.687) [-230.845] (-228.785) -- 0:00:44
22500 -- (-230.764) (-232.722) [-229.385] (-230.222) * (-249.463) [-230.326] (-229.472) (-229.799) -- 0:00:43
23000 -- (-236.863) [-228.960] (-230.107) (-229.115) * (-250.178) (-229.773) [-229.685] (-233.471) -- 0:00:42
23500 -- (-230.837) (-231.640) [-228.505] (-228.577) * (-251.202) (-229.360) (-228.506) [-232.440] -- 0:00:41
24000 -- (-228.792) (-230.048) (-229.645) [-230.254] * (-246.318) (-230.172) (-230.478) [-230.486] -- 0:00:40
24500 -- (-229.503) [-230.346] (-230.472) (-230.605) * (-232.843) (-232.002) [-229.304] (-230.444) -- 0:00:39
25000 -- (-229.775) [-230.076] (-235.193) (-231.414) * (-232.748) (-232.348) [-233.570] (-228.467) -- 0:00:39
Average standard deviation of split frequencies: 0.058710
25500 -- (-232.651) [-229.955] (-232.186) (-231.501) * (-230.542) [-228.216] (-232.039) (-229.902) -- 0:00:38
26000 -- (-231.516) (-233.657) [-230.888] (-234.134) * (-229.767) [-230.981] (-228.747) (-229.064) -- 0:00:37
26500 -- (-228.465) (-232.286) [-229.321] (-234.541) * [-230.730] (-232.074) (-231.217) (-228.008) -- 0:00:36
27000 -- (-229.100) [-228.450] (-231.276) (-232.403) * (-232.631) (-228.947) (-228.462) [-229.983] -- 0:01:12
27500 -- (-229.983) (-229.187) [-228.748] (-231.153) * (-230.007) (-229.823) [-228.446] (-230.015) -- 0:01:10
28000 -- [-229.314] (-233.008) (-229.035) (-231.713) * (-231.468) (-229.645) (-229.515) [-230.045] -- 0:01:09
28500 -- [-232.065] (-230.700) (-234.475) (-229.636) * [-229.198] (-230.825) (-229.222) (-228.060) -- 0:01:08
29000 -- (-231.615) (-230.048) (-235.666) [-229.507] * (-230.690) (-230.724) (-232.486) [-232.363] -- 0:01:06
29500 -- (-231.180) (-229.027) (-229.080) [-232.292] * (-229.567) (-228.656) [-229.831] (-232.055) -- 0:01:05
30000 -- [-230.491] (-230.756) (-237.899) (-228.090) * (-229.592) [-228.225] (-229.313) (-231.898) -- 0:01:04
Average standard deviation of split frequencies: 0.043188
30500 -- (-230.642) (-231.412) (-236.467) [-230.056] * (-230.385) [-229.137] (-229.558) (-230.101) -- 0:01:03
31000 -- [-230.812] (-232.203) (-229.417) (-233.512) * (-231.537) (-231.920) [-230.197] (-234.057) -- 0:01:02
31500 -- [-229.491] (-229.068) (-228.739) (-230.227) * (-232.295) [-228.119] (-231.302) (-229.113) -- 0:01:01
32000 -- (-230.046) (-228.846) [-228.687] (-230.510) * [-233.355] (-230.018) (-229.489) (-229.854) -- 0:01:00
32500 -- (-229.618) (-230.532) [-228.956] (-228.937) * (-229.580) (-230.097) [-228.926] (-231.412) -- 0:00:59
33000 -- (-230.361) [-231.440] (-229.265) (-228.916) * [-229.664] (-229.168) (-231.010) (-230.055) -- 0:00:58
33500 -- (-229.334) [-230.797] (-234.170) (-229.756) * (-228.646) (-228.776) [-229.164] (-233.969) -- 0:00:57
34000 -- (-230.187) [-229.405] (-230.797) (-228.331) * (-230.169) (-232.664) (-231.618) [-230.375] -- 0:00:56
34500 -- (-230.100) (-229.649) (-228.969) [-230.838] * (-232.941) (-229.985) (-229.488) [-233.867] -- 0:00:55
35000 -- (-228.910) (-229.821) [-228.634] (-229.231) * (-233.279) (-230.091) (-229.984) [-231.220] -- 0:00:55
Average standard deviation of split frequencies: 0.032736
35500 -- (-233.180) [-229.351] (-231.049) (-229.940) * (-229.434) [-229.481] (-228.956) (-229.851) -- 0:00:54
36000 -- (-232.787) [-229.684] (-230.545) (-229.198) * (-231.432) (-229.189) [-228.648] (-229.207) -- 0:00:53
36500 -- (-228.363) (-231.502) [-228.562] (-230.761) * (-234.573) (-229.700) (-228.937) [-229.754] -- 0:00:52
37000 -- (-230.970) [-230.529] (-229.694) (-228.624) * (-230.453) (-229.890) (-228.076) [-230.774] -- 0:00:52
37500 -- (-228.567) (-229.981) [-228.752] (-229.608) * [-230.388] (-229.693) (-231.189) (-232.739) -- 0:00:51
38000 -- (-228.821) (-230.828) (-228.218) [-229.710] * (-228.306) (-229.737) (-228.762) [-229.570] -- 0:00:50
38500 -- (-230.086) (-235.849) (-230.341) [-228.558] * (-229.004) (-229.074) [-229.854] (-230.192) -- 0:00:49
39000 -- [-229.422] (-229.157) (-238.528) (-228.874) * (-231.469) [-229.072] (-230.567) (-230.645) -- 0:00:49
39500 -- (-228.734) [-229.843] (-230.757) (-230.868) * [-230.390] (-233.372) (-229.436) (-232.111) -- 0:00:48
40000 -- [-230.606] (-228.634) (-230.537) (-234.877) * (-229.697) (-232.949) (-228.691) [-228.618] -- 0:00:48
Average standard deviation of split frequencies: 0.027957
40500 -- (-231.851) [-229.660] (-228.880) (-229.265) * (-235.726) (-229.855) (-229.141) [-229.504] -- 0:00:47
41000 -- [-229.836] (-229.996) (-229.592) (-229.887) * (-229.088) (-229.977) [-230.860] (-231.218) -- 0:00:46
41500 -- [-230.150] (-229.027) (-232.712) (-229.310) * [-230.010] (-232.053) (-230.331) (-232.509) -- 0:00:46
42000 -- (-229.583) (-230.848) (-228.072) [-230.623] * [-229.097] (-231.777) (-229.689) (-233.953) -- 0:00:45
42500 -- [-235.676] (-230.772) (-231.705) (-229.351) * (-229.445) (-231.142) [-228.439] (-228.103) -- 0:00:45
43000 -- (-231.460) (-228.780) (-231.978) [-230.583] * (-233.076) [-233.243] (-232.488) (-231.852) -- 0:00:44
43500 -- [-232.621] (-230.713) (-231.519) (-230.072) * (-229.394) (-231.568) (-228.290) [-230.358] -- 0:00:43
44000 -- [-229.452] (-230.183) (-228.972) (-229.444) * (-230.848) (-230.458) (-228.555) [-230.521] -- 0:01:05
44500 -- (-230.147) (-228.281) (-229.932) [-231.873] * (-231.014) (-229.857) [-230.033] (-232.448) -- 0:01:04
45000 -- (-238.855) [-228.353] (-234.931) (-228.231) * (-230.243) [-227.955] (-232.223) (-229.214) -- 0:01:03
Average standard deviation of split frequencies: 0.026840
45500 -- (-240.337) (-228.799) (-232.613) [-229.893] * (-231.599) [-229.413] (-230.350) (-233.138) -- 0:01:02
46000 -- (-231.495) [-230.016] (-231.026) (-229.002) * [-235.326] (-228.640) (-233.316) (-233.450) -- 0:01:02
46500 -- (-230.155) (-231.638) [-228.886] (-231.252) * (-235.913) (-231.017) [-229.234] (-229.466) -- 0:01:01
47000 -- [-230.259] (-231.288) (-229.199) (-231.980) * (-235.545) [-229.196] (-234.291) (-228.587) -- 0:01:00
47500 -- (-236.335) [-230.437] (-230.349) (-229.259) * (-232.918) (-228.755) (-234.643) [-230.763] -- 0:01:00
48000 -- (-231.779) [-229.351] (-230.618) (-233.491) * [-230.577] (-229.435) (-228.808) (-230.777) -- 0:00:59
48500 -- (-232.060) [-231.806] (-231.073) (-230.665) * [-228.430] (-229.050) (-230.133) (-229.846) -- 0:00:58
49000 -- [-229.859] (-228.598) (-230.465) (-230.381) * [-229.424] (-229.938) (-235.926) (-230.237) -- 0:00:58
49500 -- (-229.139) [-229.045] (-228.406) (-228.540) * (-228.467) (-228.548) (-230.101) [-232.196] -- 0:00:57
50000 -- (-229.195) (-229.672) (-228.347) [-231.086] * [-228.829] (-228.460) (-229.590) (-232.648) -- 0:00:57
Average standard deviation of split frequencies: 0.025121
50500 -- (-229.097) (-230.641) (-228.144) [-231.102] * (-230.290) (-231.272) (-230.733) [-232.895] -- 0:00:56
51000 -- (-229.349) (-229.666) (-229.573) [-229.467] * (-229.409) (-232.646) [-228.446] (-231.694) -- 0:00:55
51500 -- (-228.780) [-231.513] (-229.645) (-230.247) * (-228.828) (-230.946) [-229.498] (-228.158) -- 0:00:55
52000 -- (-232.777) (-228.798) [-229.088] (-229.626) * (-229.464) [-235.766] (-234.188) (-229.705) -- 0:00:54
52500 -- (-229.124) (-229.993) (-228.154) [-228.919] * (-229.114) (-232.622) (-231.643) [-228.302] -- 0:00:54
53000 -- (-231.465) (-233.473) (-228.840) [-229.657] * [-231.403] (-228.840) (-229.098) (-229.827) -- 0:00:53
53500 -- (-232.298) (-232.279) (-228.523) [-228.925] * (-231.590) [-228.088] (-228.684) (-231.334) -- 0:00:53
54000 -- (-229.584) (-230.679) (-231.681) [-230.070] * (-233.786) [-231.757] (-231.837) (-230.964) -- 0:00:52
54500 -- [-229.490] (-228.356) (-229.633) (-230.557) * (-232.449) (-229.629) (-228.503) [-234.430] -- 0:00:52
55000 -- (-230.149) [-228.969] (-230.110) (-229.770) * (-234.090) [-229.371] (-229.427) (-236.133) -- 0:00:51
Average standard deviation of split frequencies: 0.027258
55500 -- [-228.891] (-229.890) (-229.340) (-229.696) * [-230.542] (-231.241) (-229.962) (-238.686) -- 0:00:51
56000 -- (-231.210) (-231.337) [-230.183] (-232.002) * (-238.097) [-231.615] (-227.905) (-232.518) -- 0:00:50
56500 -- (-238.237) [-232.293] (-233.813) (-231.814) * (-232.676) (-232.412) [-228.709] (-231.121) -- 0:00:50
57000 -- (-234.451) [-233.254] (-230.413) (-231.460) * (-233.361) [-230.607] (-232.384) (-230.786) -- 0:00:49
57500 -- (-228.712) (-232.753) [-229.312] (-236.058) * [-229.742] (-230.662) (-228.921) (-231.846) -- 0:00:49
58000 -- (-229.197) (-229.773) (-229.358) [-232.043] * (-228.301) (-229.503) [-230.411] (-228.139) -- 0:00:48
58500 -- [-229.895] (-230.024) (-229.930) (-229.561) * (-230.373) (-231.375) [-228.889] (-227.705) -- 0:00:48
59000 -- (-230.614) (-232.708) (-230.933) [-228.271] * (-234.160) [-229.292] (-231.159) (-228.911) -- 0:00:47
59500 -- (-229.485) (-231.357) [-230.618] (-236.228) * (-228.903) (-228.748) [-230.621] (-231.195) -- 0:00:47
60000 -- [-228.521] (-231.517) (-232.505) (-231.365) * [-232.114] (-229.898) (-229.851) (-229.819) -- 0:00:47
Average standard deviation of split frequencies: 0.025642
60500 -- (-228.306) [-231.951] (-234.478) (-230.817) * (-231.782) (-228.384) [-228.459] (-231.436) -- 0:00:46
61000 -- (-232.176) [-230.206] (-231.819) (-230.647) * (-230.199) (-231.523) (-228.550) [-231.792] -- 0:00:46
61500 -- (-232.394) (-229.133) (-229.434) [-231.118] * (-231.486) (-231.281) (-229.610) [-230.837] -- 0:01:01
62000 -- [-231.016] (-229.257) (-229.709) (-228.333) * (-229.047) [-228.557] (-229.467) (-232.863) -- 0:01:00
62500 -- (-228.652) (-230.152) (-229.279) [-233.928] * [-228.308] (-228.673) (-232.246) (-228.776) -- 0:01:00
63000 -- [-231.086] (-229.028) (-228.708) (-231.649) * (-228.913) (-228.292) [-231.343] (-230.968) -- 0:00:59
63500 -- (-229.232) (-231.886) [-229.147] (-229.097) * (-231.620) [-228.837] (-233.777) (-232.753) -- 0:00:58
64000 -- [-229.467] (-231.843) (-230.573) (-232.182) * (-233.066) (-229.034) [-230.051] (-230.919) -- 0:00:58
64500 -- [-229.860] (-232.199) (-228.729) (-230.416) * [-229.209] (-229.715) (-230.073) (-232.099) -- 0:00:58
65000 -- (-234.049) (-231.274) [-231.983] (-228.094) * [-229.767] (-231.765) (-228.726) (-229.885) -- 0:00:57
Average standard deviation of split frequencies: 0.025849
65500 -- (-230.577) (-231.550) [-232.071] (-229.537) * (-228.662) (-228.772) (-231.230) [-228.873] -- 0:00:57
66000 -- (-231.106) (-231.293) (-234.035) [-227.896] * (-230.180) (-229.353) [-229.271] (-228.490) -- 0:00:56
66500 -- (-231.913) (-229.075) (-230.122) [-228.740] * (-229.295) (-229.480) (-232.646) [-229.228] -- 0:00:56
67000 -- (-228.550) (-230.072) (-230.169) [-228.858] * (-229.056) (-230.301) [-229.838] (-228.481) -- 0:00:55
67500 -- (-227.858) [-230.486] (-234.294) (-229.029) * (-230.144) (-229.315) [-230.915] (-227.981) -- 0:00:55
68000 -- (-229.841) (-230.742) [-229.461] (-229.598) * (-229.568) [-229.260] (-231.959) (-229.081) -- 0:00:54
68500 -- (-228.837) (-232.186) [-231.817] (-233.579) * [-228.543] (-228.513) (-229.616) (-233.165) -- 0:00:54
69000 -- (-235.839) [-233.021] (-229.003) (-232.958) * (-236.725) (-229.087) [-228.500] (-231.908) -- 0:00:53
69500 -- (-232.254) [-229.918] (-232.203) (-230.179) * (-240.618) (-230.038) (-229.243) [-228.439] -- 0:00:53
70000 -- [-229.752] (-231.380) (-236.580) (-231.947) * (-233.872) (-232.002) (-229.699) [-228.523] -- 0:00:53
Average standard deviation of split frequencies: 0.028907
70500 -- (-228.766) [-229.927] (-228.773) (-233.870) * (-231.986) (-230.027) [-231.295] (-229.282) -- 0:00:52
71000 -- (-228.105) [-229.293] (-231.539) (-231.403) * [-230.450] (-229.540) (-231.608) (-229.716) -- 0:00:52
71500 -- (-232.018) (-230.740) [-230.568] (-231.483) * (-229.777) (-231.459) (-228.937) [-230.552] -- 0:00:51
72000 -- (-231.306) [-228.591] (-230.049) (-231.584) * (-230.782) [-230.855] (-231.925) (-231.329) -- 0:00:51
72500 -- (-229.224) (-227.892) [-228.269] (-229.882) * [-228.049] (-229.990) (-230.618) (-228.958) -- 0:00:51
73000 -- (-231.606) (-234.560) [-229.884] (-229.607) * (-230.004) [-228.227] (-230.693) (-229.324) -- 0:00:50
73500 -- [-229.005] (-231.644) (-227.993) (-231.398) * [-229.298] (-229.943) (-232.139) (-229.937) -- 0:00:50
74000 -- (-232.376) (-229.479) [-228.543] (-234.699) * (-229.190) [-231.525] (-235.260) (-231.306) -- 0:00:50
74500 -- (-228.034) (-232.550) [-231.452] (-228.699) * (-231.832) (-232.561) (-230.140) [-231.773] -- 0:00:49
75000 -- [-231.771] (-229.852) (-230.943) (-228.202) * (-230.304) (-231.656) (-229.725) [-230.943] -- 0:00:49
Average standard deviation of split frequencies: 0.026051
75500 -- (-230.311) [-229.006] (-230.239) (-232.502) * [-228.439] (-230.225) (-229.648) (-229.413) -- 0:00:48
76000 -- [-229.068] (-230.163) (-228.769) (-231.396) * (-230.210) (-232.394) (-230.106) [-231.527] -- 0:00:48
76500 -- (-229.936) [-228.634] (-230.519) (-232.928) * [-230.615] (-230.615) (-231.623) (-230.804) -- 0:00:48
77000 -- (-232.270) [-231.841] (-227.968) (-231.195) * (-231.592) [-229.849] (-232.529) (-231.225) -- 0:00:47
77500 -- (-231.187) [-229.670] (-228.651) (-232.336) * (-228.769) (-228.387) (-228.790) [-228.712] -- 0:00:47
78000 -- (-232.957) (-231.658) [-229.649] (-231.723) * [-229.809] (-228.260) (-229.292) (-229.351) -- 0:00:47
78500 -- (-233.263) (-230.737) (-232.287) [-229.599] * (-228.069) (-231.099) (-228.463) [-231.904] -- 0:00:58
79000 -- (-233.216) (-229.396) [-229.472] (-231.580) * (-232.693) (-230.175) [-228.425] (-229.157) -- 0:00:58
79500 -- (-231.504) (-229.876) (-230.500) [-229.285] * (-231.104) (-232.404) [-230.047] (-230.602) -- 0:00:57
80000 -- (-230.082) [-230.774] (-229.428) (-230.333) * [-229.799] (-229.904) (-227.993) (-229.441) -- 0:00:57
Average standard deviation of split frequencies: 0.026297
80500 -- [-230.119] (-229.829) (-229.071) (-230.639) * (-229.428) (-228.819) (-229.150) [-231.980] -- 0:00:57
81000 -- (-230.581) (-228.743) (-228.905) [-230.528] * (-231.633) [-231.129] (-230.310) (-229.438) -- 0:00:56
81500 -- (-229.152) (-228.723) [-228.313] (-232.828) * (-230.823) (-229.525) (-230.237) [-232.406] -- 0:00:56
82000 -- (-228.364) (-229.071) (-230.988) [-228.276] * (-231.138) (-233.138) (-229.593) [-233.287] -- 0:00:55
82500 -- (-229.373) (-230.146) [-229.219] (-228.460) * (-232.026) (-230.441) (-229.036) [-232.134] -- 0:00:55
83000 -- (-228.794) [-228.908] (-227.869) (-229.066) * [-230.148] (-230.326) (-228.975) (-229.790) -- 0:00:55
83500 -- [-229.234] (-230.981) (-228.802) (-232.272) * (-228.875) (-230.747) (-229.373) [-228.891] -- 0:00:54
84000 -- (-229.027) [-229.995] (-231.036) (-231.588) * (-229.672) [-228.475] (-231.779) (-231.047) -- 0:00:54
84500 -- (-230.836) (-228.224) (-232.002) [-229.587] * (-229.066) [-229.161] (-229.465) (-228.911) -- 0:00:54
85000 -- [-229.006] (-229.293) (-235.362) (-232.494) * (-229.572) [-228.549] (-234.883) (-228.750) -- 0:00:53
Average standard deviation of split frequencies: 0.025319
85500 -- (-238.950) [-230.150] (-232.464) (-232.605) * (-228.759) (-229.996) (-233.240) [-229.058] -- 0:00:53
86000 -- (-233.337) [-230.537] (-229.303) (-232.134) * (-229.596) (-229.121) [-229.493] (-230.853) -- 0:00:53
86500 -- [-229.642] (-232.278) (-231.049) (-233.067) * [-229.412] (-228.889) (-232.410) (-232.428) -- 0:00:52
87000 -- (-230.254) (-231.322) [-230.916] (-236.192) * (-229.687) (-228.601) (-228.525) [-229.887] -- 0:00:52
87500 -- (-229.720) (-230.130) (-227.937) [-230.513] * [-229.883] (-230.055) (-230.151) (-232.638) -- 0:00:52
88000 -- (-229.045) (-228.759) (-232.244) [-229.232] * (-229.220) (-228.523) [-231.712] (-230.276) -- 0:00:51
88500 -- (-228.389) [-232.087] (-231.561) (-233.422) * (-228.329) (-229.245) [-230.653] (-229.890) -- 0:00:51
89000 -- [-232.084] (-230.950) (-228.519) (-230.002) * (-229.237) (-229.684) (-230.982) [-229.220] -- 0:00:51
89500 -- (-232.518) [-234.146] (-228.690) (-231.181) * (-229.448) (-231.135) (-231.076) [-229.141] -- 0:00:50
90000 -- [-228.627] (-228.929) (-231.631) (-228.418) * (-230.942) [-229.921] (-232.741) (-228.963) -- 0:00:50
Average standard deviation of split frequencies: 0.030723
90500 -- (-228.568) (-231.395) (-228.362) [-228.258] * (-229.077) [-227.811] (-231.521) (-231.969) -- 0:00:50
91000 -- [-228.244] (-233.377) (-230.987) (-229.193) * (-230.262) [-230.517] (-228.542) (-234.062) -- 0:00:49
91500 -- (-228.875) (-231.053) [-230.508] (-232.323) * (-229.898) [-230.081] (-230.136) (-232.947) -- 0:00:49
92000 -- [-236.653] (-229.955) (-228.321) (-229.996) * (-237.514) (-230.616) (-228.625) [-228.811] -- 0:00:49
92500 -- [-229.786] (-228.215) (-231.398) (-229.666) * (-228.234) (-233.699) [-229.868] (-228.604) -- 0:00:49
93000 -- (-228.627) [-231.034] (-229.063) (-231.166) * (-228.430) (-231.552) [-231.810] (-230.739) -- 0:00:48
93500 -- (-229.381) (-228.698) [-229.566] (-229.935) * (-229.755) (-229.029) (-234.178) [-232.265] -- 0:00:48
94000 -- (-230.579) (-227.775) (-231.409) [-233.404] * [-229.804] (-230.210) (-228.733) (-230.982) -- 0:00:48
94500 -- [-228.913] (-229.023) (-230.088) (-229.043) * (-229.697) [-230.751] (-231.882) (-230.089) -- 0:00:47
95000 -- (-228.457) [-231.254] (-229.791) (-235.661) * (-229.804) (-231.273) [-228.874] (-229.793) -- 0:00:47
Average standard deviation of split frequencies: 0.029229
95500 -- (-232.018) [-233.332] (-229.130) (-230.566) * (-228.313) [-228.390] (-229.968) (-230.788) -- 0:00:56
96000 -- [-228.125] (-229.576) (-228.858) (-230.198) * (-229.572) [-235.477] (-234.101) (-231.052) -- 0:00:56
96500 -- (-228.531) (-230.290) [-229.154] (-230.985) * (-229.812) [-230.969] (-231.436) (-230.699) -- 0:00:56
97000 -- (-229.601) [-231.134] (-233.469) (-229.980) * [-231.963] (-231.173) (-229.449) (-230.608) -- 0:00:55
97500 -- (-234.339) [-229.764] (-231.647) (-231.384) * (-231.709) (-229.236) (-228.559) [-230.240] -- 0:00:55
98000 -- (-231.770) [-229.588] (-231.604) (-230.167) * [-229.479] (-231.856) (-230.027) (-230.723) -- 0:00:55
98500 -- (-229.147) (-235.752) (-229.614) [-228.489] * [-230.557] (-230.842) (-229.566) (-229.054) -- 0:00:54
99000 -- (-228.892) (-234.457) [-229.043] (-228.148) * (-229.860) [-230.374] (-230.626) (-228.734) -- 0:00:54
99500 -- [-230.224] (-230.771) (-229.021) (-235.745) * (-230.911) (-229.030) [-229.125] (-229.350) -- 0:00:54
100000 -- [-235.465] (-231.490) (-229.781) (-232.041) * (-232.840) (-228.407) [-230.527] (-229.480) -- 0:00:54
Average standard deviation of split frequencies: 0.028097
100500 -- (-230.054) [-231.077] (-233.752) (-231.038) * (-230.825) [-228.655] (-229.231) (-230.111) -- 0:00:53
101000 -- (-228.933) (-230.995) (-233.543) [-228.753] * (-228.804) (-229.826) (-231.703) [-229.241] -- 0:00:53
101500 -- (-231.018) [-233.700] (-228.697) (-231.688) * (-233.660) [-227.804] (-230.150) (-230.958) -- 0:00:53
102000 -- (-236.548) [-230.624] (-228.456) (-236.094) * (-232.213) (-230.014) (-228.282) [-230.065] -- 0:00:52
102500 -- (-229.295) (-228.560) [-231.612] (-235.001) * (-236.042) [-229.612] (-232.325) (-229.591) -- 0:00:52
103000 -- (-229.460) (-231.113) [-229.992] (-231.665) * [-231.269] (-229.388) (-233.474) (-231.746) -- 0:00:52
103500 -- (-229.228) [-230.009] (-229.944) (-234.662) * (-232.077) [-231.625] (-234.702) (-231.501) -- 0:00:51
104000 -- (-229.898) (-230.021) (-229.271) [-230.516] * (-230.520) (-229.813) [-230.801] (-230.586) -- 0:00:51
104500 -- [-229.317] (-231.700) (-228.842) (-230.295) * (-229.010) (-233.201) [-231.901] (-230.310) -- 0:00:51
105000 -- (-230.793) [-228.755] (-228.190) (-230.265) * (-231.788) (-230.074) (-231.883) [-229.004] -- 0:00:51
Average standard deviation of split frequencies: 0.027290
105500 -- (-228.204) (-230.644) (-229.815) [-231.480] * (-229.476) [-231.326] (-231.221) (-229.015) -- 0:00:50
106000 -- (-229.013) (-232.121) [-228.280] (-229.272) * (-230.388) (-235.476) (-233.050) [-228.994] -- 0:00:50
106500 -- (-231.705) (-230.816) [-229.162] (-229.005) * [-228.899] (-230.332) (-231.320) (-228.596) -- 0:00:50
107000 -- [-228.115] (-228.351) (-230.344) (-228.306) * (-231.800) [-229.222] (-231.184) (-229.243) -- 0:00:50
107500 -- (-233.379) (-228.655) (-230.898) [-228.512] * [-230.340] (-230.900) (-230.699) (-229.555) -- 0:00:49
108000 -- (-238.419) (-230.782) [-230.409] (-228.627) * (-231.014) [-229.427] (-230.929) (-230.267) -- 0:00:49
108500 -- (-231.160) (-232.517) (-230.356) [-228.957] * (-233.096) [-228.913] (-233.208) (-230.434) -- 0:00:49
109000 -- (-232.038) [-230.547] (-230.458) (-228.955) * (-232.449) (-228.318) [-229.505] (-232.880) -- 0:00:49
109500 -- (-229.195) (-231.715) (-229.166) [-233.103] * [-227.958] (-228.909) (-230.727) (-230.647) -- 0:00:48
110000 -- (-229.561) (-230.332) (-228.470) [-232.553] * (-229.310) (-231.342) [-229.646] (-229.140) -- 0:00:48
Average standard deviation of split frequencies: 0.026720
110500 -- [-230.593] (-230.566) (-230.164) (-228.438) * (-231.676) [-230.007] (-229.371) (-235.042) -- 0:00:48
111000 -- (-230.632) (-231.089) (-228.953) [-228.738] * (-229.946) (-229.804) (-231.484) [-233.053] -- 0:00:48
111500 -- (-230.748) (-232.198) [-229.508] (-228.253) * (-230.311) (-229.610) [-229.086] (-229.211) -- 0:00:47
112000 -- (-232.620) (-232.118) [-230.426] (-230.651) * (-233.195) (-232.407) (-230.251) [-228.088] -- 0:00:47
112500 -- (-235.080) (-228.785) [-229.964] (-228.666) * (-232.701) [-229.416] (-229.931) (-230.950) -- 0:00:55
113000 -- [-234.063] (-230.744) (-228.134) (-227.936) * [-229.074] (-229.354) (-228.966) (-231.151) -- 0:00:54
113500 -- [-228.909] (-229.008) (-232.680) (-230.371) * (-229.256) [-229.044] (-232.244) (-234.771) -- 0:00:54
114000 -- (-230.667) (-230.507) (-228.899) [-231.643] * [-228.857] (-230.397) (-229.838) (-232.613) -- 0:00:54
114500 -- (-230.893) (-229.548) (-234.335) [-230.146] * (-229.754) (-231.872) [-230.583] (-232.581) -- 0:00:54
115000 -- (-231.785) (-231.073) (-230.251) [-230.468] * [-228.928] (-232.072) (-230.990) (-230.658) -- 0:00:53
Average standard deviation of split frequencies: 0.028019
115500 -- (-229.464) [-229.932] (-237.060) (-229.230) * (-229.407) (-227.975) (-231.660) [-229.532] -- 0:00:53
116000 -- (-229.919) (-235.734) [-230.721] (-231.097) * (-230.263) [-230.445] (-228.199) (-229.099) -- 0:00:53
116500 -- [-228.612] (-230.163) (-228.650) (-228.859) * (-231.819) (-230.763) (-230.510) [-229.209] -- 0:00:53
117000 -- [-232.283] (-228.633) (-229.355) (-229.846) * (-230.797) (-232.026) [-233.379] (-230.642) -- 0:00:52
117500 -- [-235.115] (-228.841) (-231.799) (-229.008) * (-233.033) (-233.207) [-230.513] (-231.217) -- 0:00:52
118000 -- (-233.661) (-229.346) (-229.064) [-229.266] * (-232.167) (-233.524) (-228.913) [-230.414] -- 0:00:52
118500 -- (-228.687) (-232.457) [-230.536] (-230.294) * (-230.113) (-236.041) [-231.598] (-229.925) -- 0:00:52
119000 -- (-230.559) (-231.783) (-229.709) [-230.697] * (-232.789) (-233.352) [-230.452] (-228.614) -- 0:00:51
119500 -- (-229.367) (-232.248) [-228.256] (-231.622) * (-231.751) (-234.334) (-230.630) [-228.786] -- 0:00:51
120000 -- (-228.830) (-232.850) [-228.243] (-231.248) * (-228.782) (-234.127) [-228.562] (-229.147) -- 0:00:51
Average standard deviation of split frequencies: 0.029300
120500 -- (-228.933) (-234.512) [-229.755] (-229.260) * (-229.935) [-232.217] (-231.123) (-230.295) -- 0:00:51
121000 -- (-230.922) [-230.825] (-229.773) (-230.937) * (-229.060) (-230.345) [-231.601] (-234.204) -- 0:00:50
121500 -- (-229.972) (-229.098) (-228.997) [-229.510] * (-229.456) (-230.032) [-229.890] (-231.520) -- 0:00:50
122000 -- (-229.102) (-229.420) (-229.821) [-230.251] * (-231.151) (-231.234) [-230.657] (-231.420) -- 0:00:50
122500 -- (-229.206) (-231.843) [-228.692] (-230.929) * (-232.284) (-232.157) [-233.237] (-229.188) -- 0:00:50
123000 -- (-229.624) [-231.398] (-229.924) (-231.449) * (-230.968) [-231.124] (-231.365) (-229.044) -- 0:00:49
123500 -- (-231.882) [-232.228] (-229.798) (-233.209) * (-231.682) (-232.019) [-234.384] (-230.450) -- 0:00:49
124000 -- (-230.796) [-232.609] (-232.041) (-230.735) * [-228.470] (-230.292) (-235.494) (-229.911) -- 0:00:49
124500 -- [-230.044] (-229.818) (-230.223) (-229.505) * [-233.611] (-229.183) (-230.186) (-233.795) -- 0:00:49
125000 -- (-232.940) [-228.488] (-232.963) (-232.130) * (-229.710) (-229.873) (-230.786) [-229.133] -- 0:00:49
Average standard deviation of split frequencies: 0.024614
125500 -- (-230.907) (-231.613) (-231.452) [-230.874] * (-229.292) (-231.481) (-229.332) [-229.303] -- 0:00:48
126000 -- [-231.796] (-230.732) (-228.733) (-231.963) * [-230.396] (-230.690) (-233.884) (-231.373) -- 0:00:48
126500 -- (-229.832) (-234.826) [-231.275] (-231.386) * [-231.253] (-236.896) (-231.848) (-231.197) -- 0:00:48
127000 -- [-229.406] (-230.881) (-229.239) (-229.216) * [-230.694] (-232.820) (-229.067) (-230.216) -- 0:00:48
127500 -- (-228.740) (-229.526) (-230.206) [-229.061] * (-230.836) (-231.646) (-228.341) [-228.770] -- 0:00:47
128000 -- (-230.582) [-234.018] (-233.284) (-229.437) * (-227.811) (-232.465) (-228.300) [-229.704] -- 0:00:47
128500 -- (-231.201) (-228.503) (-228.183) [-232.330] * (-230.362) [-229.232] (-231.181) (-231.895) -- 0:00:47
129000 -- (-229.141) (-230.419) (-228.602) [-230.539] * (-230.151) [-228.376] (-235.747) (-230.243) -- 0:00:47
129500 -- (-230.880) [-229.965] (-232.001) (-229.335) * (-231.900) (-231.377) (-229.227) [-230.453] -- 0:00:53
130000 -- [-228.226] (-228.651) (-231.059) (-230.946) * (-229.157) (-233.559) (-228.504) [-230.726] -- 0:00:53
Average standard deviation of split frequencies: 0.022216
130500 -- [-230.817] (-235.504) (-228.367) (-231.515) * (-231.239) (-230.649) [-229.600] (-231.855) -- 0:00:53
131000 -- (-229.130) (-229.703) [-229.515] (-230.841) * (-228.652) (-228.895) [-228.928] (-231.485) -- 0:00:53
131500 -- [-228.619] (-231.776) (-230.039) (-231.643) * [-228.504] (-231.064) (-229.031) (-230.234) -- 0:00:52
132000 -- (-229.917) (-230.202) [-228.580] (-229.440) * (-228.149) (-229.285) [-228.632] (-231.131) -- 0:00:52
132500 -- (-229.210) (-229.668) (-231.597) [-229.846] * [-229.587] (-232.978) (-228.968) (-229.201) -- 0:00:52
133000 -- (-232.448) (-228.235) [-228.434] (-230.010) * (-228.251) (-230.936) [-228.018] (-230.917) -- 0:00:52
133500 -- (-232.904) (-230.821) [-230.119] (-230.003) * (-228.896) (-230.163) [-228.939] (-229.218) -- 0:00:51
134000 -- (-232.217) (-230.050) [-229.872] (-230.045) * (-231.131) (-237.154) [-229.215] (-229.775) -- 0:00:51
134500 -- [-229.051] (-229.899) (-227.925) (-229.870) * [-229.108] (-231.266) (-230.467) (-230.488) -- 0:00:51
135000 -- (-228.661) (-230.705) [-230.036] (-230.953) * (-230.724) [-231.037] (-231.949) (-230.337) -- 0:00:51
Average standard deviation of split frequencies: 0.019885
135500 -- (-229.606) (-228.768) (-236.237) [-230.684] * (-231.203) (-234.157) (-229.705) [-229.090] -- 0:00:51
136000 -- (-229.139) (-229.065) (-231.942) [-230.012] * [-228.924] (-230.632) (-230.314) (-228.921) -- 0:00:50
136500 -- (-228.582) (-229.004) [-231.054] (-229.088) * (-233.151) (-229.609) [-229.734] (-228.172) -- 0:00:50
137000 -- [-231.977] (-228.712) (-230.606) (-231.463) * (-229.041) (-231.621) [-232.563] (-229.307) -- 0:00:50
137500 -- (-230.856) (-229.129) [-229.251] (-234.080) * (-233.635) (-229.021) (-230.383) [-229.946] -- 0:00:50
138000 -- (-233.682) (-230.888) (-230.133) [-229.661] * (-234.864) [-230.145] (-233.639) (-229.769) -- 0:00:49
138500 -- (-230.048) [-230.752] (-228.206) (-229.896) * (-228.718) (-228.738) [-229.328] (-233.105) -- 0:00:49
139000 -- [-229.410] (-232.412) (-232.031) (-230.123) * (-229.864) (-228.567) (-229.631) [-228.860] -- 0:00:49
139500 -- [-230.725] (-231.396) (-231.500) (-233.757) * (-231.067) (-228.592) [-229.192] (-228.066) -- 0:00:49
140000 -- (-232.009) (-229.129) (-230.870) [-229.422] * (-230.413) [-230.396] (-228.279) (-228.793) -- 0:00:49
Average standard deviation of split frequencies: 0.016403
140500 -- [-229.071] (-228.437) (-230.272) (-229.957) * (-228.479) (-228.397) (-230.869) [-230.100] -- 0:00:48
141000 -- (-229.294) [-231.762] (-229.318) (-229.968) * (-228.261) (-231.840) [-229.689] (-228.164) -- 0:00:48
141500 -- [-228.284] (-233.353) (-228.219) (-231.394) * [-231.530] (-230.426) (-233.169) (-229.582) -- 0:00:48
142000 -- [-229.580] (-229.792) (-229.060) (-235.755) * (-233.789) (-229.139) [-230.312] (-229.460) -- 0:00:48
142500 -- (-228.010) (-232.334) [-228.813] (-233.233) * (-233.263) [-230.411] (-232.300) (-228.576) -- 0:00:48
143000 -- [-230.059] (-230.769) (-229.491) (-230.614) * (-229.955) [-228.443] (-230.917) (-229.574) -- 0:00:47
143500 -- [-230.810] (-230.595) (-229.461) (-229.900) * (-230.554) (-228.736) [-231.138] (-230.686) -- 0:00:47
144000 -- (-229.750) (-230.628) (-229.820) [-229.579] * (-228.247) [-229.118] (-229.428) (-232.752) -- 0:00:47
144500 -- (-229.243) [-230.868] (-233.522) (-228.607) * (-229.451) [-228.243] (-231.147) (-231.836) -- 0:00:47
145000 -- [-229.217] (-232.028) (-233.981) (-228.386) * [-229.664] (-228.618) (-233.736) (-231.754) -- 0:00:47
Average standard deviation of split frequencies: 0.016654
145500 -- (-229.145) (-232.778) (-232.014) [-229.465] * (-230.673) [-230.743] (-228.922) (-228.701) -- 0:00:46
146000 -- (-235.240) (-233.560) (-229.494) [-228.631] * (-229.378) [-229.190] (-229.805) (-232.259) -- 0:00:46
146500 -- (-229.369) (-230.000) (-229.332) [-230.478] * (-229.361) (-230.769) (-233.957) [-230.012] -- 0:00:52
147000 -- (-231.985) (-230.228) (-232.465) [-230.198] * [-228.966] (-230.139) (-233.787) (-228.212) -- 0:00:52
147500 -- (-233.079) (-233.011) [-233.779] (-231.764) * (-228.461) (-232.280) [-230.572] (-231.917) -- 0:00:52
148000 -- (-230.891) [-231.389] (-231.887) (-232.379) * (-229.698) (-227.871) [-229.428] (-235.467) -- 0:00:51
148500 -- (-230.438) (-228.782) (-231.066) [-231.093] * (-229.958) (-230.031) [-230.385] (-232.904) -- 0:00:51
149000 -- [-231.658] (-229.534) (-228.893) (-229.051) * [-231.953] (-230.358) (-229.007) (-230.756) -- 0:00:51
149500 -- (-232.805) [-228.949] (-230.554) (-229.054) * (-231.140) [-229.693] (-228.502) (-230.856) -- 0:00:51
150000 -- [-232.238] (-229.869) (-229.263) (-232.279) * (-237.784) (-231.057) [-229.281] (-229.691) -- 0:00:51
Average standard deviation of split frequencies: 0.016513
150500 -- [-229.821] (-229.450) (-229.852) (-231.978) * (-229.580) [-229.339] (-235.166) (-230.291) -- 0:00:50
151000 -- (-229.567) (-230.080) [-228.828] (-234.332) * (-233.774) (-229.126) (-228.217) [-233.728] -- 0:00:50
151500 -- (-229.347) [-230.596] (-238.245) (-229.997) * (-229.651) (-229.673) (-232.871) [-230.665] -- 0:00:50
152000 -- (-228.629) (-229.493) [-230.187] (-230.855) * (-229.336) [-229.710] (-229.755) (-230.864) -- 0:00:50
152500 -- (-231.896) (-235.895) (-229.814) [-230.466] * (-228.696) [-229.869] (-229.955) (-231.556) -- 0:00:50
153000 -- [-229.416] (-232.304) (-229.770) (-228.378) * (-228.558) [-228.915] (-230.051) (-230.685) -- 0:00:49
153500 -- (-232.509) [-232.393] (-229.893) (-228.617) * (-228.973) (-231.426) [-229.174] (-233.653) -- 0:00:49
154000 -- (-232.469) (-229.856) [-231.704] (-230.292) * [-228.552] (-231.468) (-228.826) (-235.303) -- 0:00:49
154500 -- (-229.633) (-229.179) [-228.832] (-233.324) * (-229.914) (-230.721) (-233.231) [-231.578] -- 0:00:49
155000 -- [-231.837] (-231.110) (-231.786) (-230.087) * (-229.730) (-228.823) [-230.067] (-230.026) -- 0:00:49
Average standard deviation of split frequencies: 0.014043
155500 -- (-232.474) (-228.243) [-230.152] (-228.577) * (-231.093) (-230.669) [-230.436] (-230.157) -- 0:00:48
156000 -- (-236.573) [-228.053] (-230.504) (-230.043) * [-229.152] (-229.214) (-230.346) (-232.603) -- 0:00:48
156500 -- (-230.258) (-229.682) [-229.357] (-231.300) * (-231.793) (-230.063) [-234.943] (-231.766) -- 0:00:48
157000 -- [-229.388] (-231.795) (-228.617) (-231.838) * (-234.120) [-230.873] (-235.987) (-229.613) -- 0:00:48
157500 -- (-231.719) (-231.355) [-230.915] (-232.611) * (-230.817) (-228.939) (-235.597) [-228.240] -- 0:00:48
158000 -- (-229.361) (-229.724) (-229.697) [-229.536] * (-229.837) (-234.490) (-230.618) [-228.356] -- 0:00:47
158500 -- (-231.950) (-232.140) [-228.745] (-228.764) * [-232.811] (-231.551) (-228.449) (-233.183) -- 0:00:47
159000 -- (-229.584) [-228.662] (-233.143) (-230.425) * (-229.305) (-231.476) (-228.628) [-230.089] -- 0:00:47
159500 -- (-232.068) (-234.874) [-229.883] (-230.007) * (-229.893) (-232.052) [-228.482] (-230.331) -- 0:00:47
160000 -- (-229.052) [-229.317] (-229.260) (-229.701) * (-228.622) [-228.931] (-228.829) (-229.897) -- 0:00:47
Average standard deviation of split frequencies: 0.011564
160500 -- [-230.396] (-230.398) (-230.153) (-229.257) * (-234.009) [-229.227] (-230.512) (-230.092) -- 0:00:47
161000 -- (-229.185) [-230.685] (-231.237) (-230.879) * [-229.824] (-233.173) (-231.090) (-230.021) -- 0:00:46
161500 -- (-228.810) (-231.920) (-230.666) [-228.958] * [-231.921] (-229.998) (-229.950) (-232.746) -- 0:00:46
162000 -- (-232.032) [-228.200] (-234.610) (-229.141) * (-232.703) [-228.466] (-229.889) (-233.156) -- 0:00:46
162500 -- (-234.772) [-229.248] (-230.480) (-230.358) * (-230.684) [-229.539] (-230.748) (-229.647) -- 0:00:46
163000 -- (-233.147) (-228.528) (-234.395) [-232.428] * (-231.865) (-233.259) [-228.618] (-229.472) -- 0:00:46
163500 -- (-233.386) (-231.149) (-232.259) [-228.508] * [-229.938] (-229.310) (-228.179) (-234.227) -- 0:00:51
164000 -- (-238.727) (-228.570) (-234.686) [-228.089] * (-229.356) (-228.727) (-227.798) [-229.335] -- 0:00:50
164500 -- (-231.100) [-232.759] (-229.018) (-229.257) * [-229.365] (-231.973) (-228.569) (-231.249) -- 0:00:50
165000 -- (-230.366) (-231.928) [-228.306] (-232.499) * [-229.079] (-232.371) (-233.551) (-231.473) -- 0:00:50
Average standard deviation of split frequencies: 0.012027
165500 -- (-229.699) (-233.012) (-231.776) [-234.456] * [-228.923] (-229.254) (-230.510) (-228.470) -- 0:00:50
166000 -- (-231.597) [-232.727] (-231.726) (-231.334) * (-229.912) (-229.411) (-232.133) [-228.716] -- 0:00:50
166500 -- (-230.255) (-227.947) (-229.199) [-229.901] * (-230.992) (-233.426) [-228.648] (-228.866) -- 0:00:50
167000 -- (-228.841) [-228.689] (-231.203) (-231.369) * (-231.075) (-231.157) [-231.639] (-228.363) -- 0:00:49
167500 -- [-233.018] (-229.634) (-232.086) (-232.578) * (-228.940) (-229.259) (-230.623) [-232.584] -- 0:00:49
168000 -- [-233.251] (-231.134) (-231.118) (-233.257) * (-231.093) (-234.703) [-238.079] (-232.586) -- 0:00:49
168500 -- [-228.895] (-230.928) (-228.890) (-229.531) * (-229.116) (-230.992) (-236.638) [-235.883] -- 0:00:49
169000 -- [-230.736] (-231.363) (-230.006) (-229.204) * [-228.112] (-230.361) (-234.339) (-231.690) -- 0:00:49
169500 -- (-235.982) (-230.656) (-237.286) [-229.878] * (-229.351) (-230.010) [-228.770] (-229.151) -- 0:00:48
170000 -- (-237.533) (-228.771) [-228.918] (-229.929) * (-232.471) (-228.633) [-229.900] (-231.008) -- 0:00:48
Average standard deviation of split frequencies: 0.011374
170500 -- (-233.642) (-229.499) [-231.416] (-229.854) * [-230.851] (-230.033) (-233.751) (-232.143) -- 0:00:48
171000 -- (-231.011) [-231.935] (-232.055) (-228.538) * (-229.300) (-231.076) (-230.209) [-231.180] -- 0:00:48
171500 -- (-232.571) (-231.242) [-230.950] (-229.531) * (-229.133) [-230.963] (-229.266) (-231.978) -- 0:00:48
172000 -- [-230.282] (-228.389) (-231.570) (-235.008) * [-229.497] (-235.003) (-232.929) (-230.737) -- 0:00:48
172500 -- [-229.502] (-229.525) (-234.092) (-236.515) * (-229.836) (-232.848) [-229.564] (-228.173) -- 0:00:47
173000 -- (-233.757) [-228.188] (-235.253) (-230.500) * (-231.095) [-231.128] (-232.289) (-230.354) -- 0:00:47
173500 -- (-229.868) (-228.536) (-236.756) [-234.467] * (-228.337) [-228.391] (-230.281) (-230.595) -- 0:00:47
174000 -- (-230.739) [-229.360] (-229.186) (-230.615) * (-233.407) (-230.646) [-232.386] (-229.638) -- 0:00:47
174500 -- (-233.379) (-228.825) [-229.179] (-232.952) * (-231.697) (-229.769) (-230.688) [-228.235] -- 0:00:47
175000 -- (-231.568) (-229.802) (-228.968) [-228.732] * (-228.503) (-228.415) (-230.880) [-229.206] -- 0:00:47
Average standard deviation of split frequencies: 0.012447
175500 -- (-229.013) (-231.071) (-229.120) [-231.026] * (-232.660) (-228.824) [-230.422] (-230.622) -- 0:00:46
176000 -- (-229.430) (-230.976) (-231.339) [-230.567] * (-231.163) (-231.742) [-231.400] (-231.619) -- 0:00:46
176500 -- (-231.489) (-232.243) (-229.714) [-230.324] * (-236.818) (-228.515) (-229.534) [-231.640] -- 0:00:46
177000 -- (-230.659) [-228.829] (-228.727) (-232.928) * [-230.848] (-230.196) (-228.327) (-229.350) -- 0:00:46
177500 -- (-232.933) (-229.293) (-229.355) [-229.012] * (-231.583) (-230.546) [-230.506] (-229.849) -- 0:00:46
178000 -- (-231.601) [-228.839] (-229.051) (-230.179) * (-234.655) (-232.109) (-232.903) [-229.230] -- 0:00:46
178500 -- (-228.526) [-230.618] (-229.860) (-229.412) * [-228.618] (-228.136) (-230.821) (-231.165) -- 0:00:46
179000 -- (-231.105) [-229.909] (-234.665) (-232.660) * (-231.655) (-229.129) [-231.208] (-229.589) -- 0:00:45
179500 -- (-230.975) [-228.589] (-228.555) (-237.792) * (-230.212) (-231.042) [-232.507] (-228.679) -- 0:00:45
180000 -- [-230.033] (-229.538) (-229.467) (-231.995) * (-237.196) (-229.231) [-229.746] (-228.984) -- 0:00:45
Average standard deviation of split frequencies: 0.014735
180500 -- (-228.225) (-228.799) [-230.744] (-233.241) * [-228.794] (-230.230) (-229.983) (-229.421) -- 0:00:49
181000 -- (-227.782) [-228.526] (-231.584) (-232.525) * (-229.384) (-231.299) [-228.735] (-235.629) -- 0:00:49
181500 -- (-229.302) (-233.154) [-233.828] (-233.164) * (-228.916) (-229.973) [-230.602] (-232.023) -- 0:00:49
182000 -- (-230.827) (-229.217) (-228.457) [-229.282] * (-230.454) (-228.530) (-229.946) [-229.778] -- 0:00:49
182500 -- (-228.841) (-233.771) [-231.465] (-229.761) * (-230.815) (-228.949) (-230.842) [-232.245] -- 0:00:49
183000 -- [-228.669] (-229.783) (-229.499) (-231.855) * (-229.393) (-229.208) [-231.990] (-230.022) -- 0:00:49
183500 -- (-229.823) (-229.523) [-227.982] (-230.450) * (-233.845) [-232.672] (-233.637) (-229.406) -- 0:00:48
184000 -- (-229.434) [-228.515] (-230.641) (-229.467) * (-228.522) (-230.687) (-236.512) [-228.653] -- 0:00:48
184500 -- [-231.599] (-233.402) (-229.975) (-232.146) * [-230.275] (-232.585) (-229.919) (-229.369) -- 0:00:48
185000 -- [-230.013] (-230.610) (-228.452) (-228.479) * (-230.670) (-231.403) [-230.272] (-230.325) -- 0:00:48
Average standard deviation of split frequencies: 0.016007
185500 -- (-231.073) (-228.443) (-230.285) [-229.695] * [-228.689] (-230.035) (-228.444) (-228.623) -- 0:00:48
186000 -- (-228.495) (-231.905) (-231.691) [-230.594] * (-231.480) [-232.349] (-229.623) (-232.614) -- 0:00:48
186500 -- [-228.855] (-229.218) (-232.010) (-229.548) * [-228.154] (-229.906) (-230.719) (-229.329) -- 0:00:47
187000 -- (-228.418) (-228.175) (-230.055) [-228.962] * (-229.109) [-231.343] (-230.463) (-236.425) -- 0:00:47
187500 -- [-230.121] (-228.431) (-230.938) (-231.172) * [-229.941] (-230.058) (-230.977) (-232.310) -- 0:00:47
188000 -- (-230.925) [-232.624] (-233.759) (-231.703) * (-230.945) (-231.286) [-228.109] (-228.725) -- 0:00:47
188500 -- (-232.385) (-229.136) [-231.857] (-229.810) * (-230.563) (-230.464) (-229.049) [-228.629] -- 0:00:47
189000 -- (-228.394) (-231.095) (-230.228) [-230.543] * [-228.688] (-229.762) (-230.235) (-231.082) -- 0:00:47
189500 -- (-229.000) (-228.433) (-233.123) [-230.144] * (-228.598) [-228.775] (-229.482) (-228.615) -- 0:00:47
190000 -- [-228.555] (-229.455) (-232.028) (-230.219) * [-229.142] (-233.759) (-236.224) (-228.262) -- 0:00:46
Average standard deviation of split frequencies: 0.016526
190500 -- (-228.275) (-230.502) [-228.597] (-234.278) * (-231.788) (-235.990) [-231.496] (-229.115) -- 0:00:46
191000 -- (-232.765) (-231.969) [-230.611] (-229.267) * (-228.888) [-230.686] (-231.028) (-235.262) -- 0:00:46
191500 -- (-232.470) (-230.135) [-234.865] (-228.903) * (-230.258) (-232.686) (-229.209) [-230.647] -- 0:00:46
192000 -- [-232.964] (-231.329) (-232.754) (-229.153) * (-228.625) (-231.304) [-230.823] (-232.973) -- 0:00:46
192500 -- (-231.425) (-230.913) [-233.086] (-235.480) * (-232.496) [-230.077] (-230.898) (-238.788) -- 0:00:46
193000 -- (-233.366) (-228.588) (-229.735) [-230.145] * (-232.103) (-227.899) (-230.571) [-235.005] -- 0:00:45
193500 -- [-230.256] (-230.585) (-231.916) (-232.696) * (-230.866) (-230.620) [-229.790] (-230.136) -- 0:00:45
194000 -- (-233.024) (-228.979) (-230.201) [-231.745] * (-230.067) (-229.494) (-231.304) [-229.112] -- 0:00:45
194500 -- [-230.293] (-231.154) (-233.196) (-234.516) * (-232.342) (-229.187) (-228.194) [-231.000] -- 0:00:45
195000 -- (-230.748) [-228.967] (-232.485) (-231.800) * (-228.991) (-229.640) (-231.263) [-229.693] -- 0:00:45
Average standard deviation of split frequencies: 0.015513
195500 -- (-231.031) [-228.431] (-230.975) (-230.268) * (-230.884) (-230.002) [-229.623] (-230.508) -- 0:00:45
196000 -- [-232.166] (-229.281) (-230.905) (-229.288) * (-234.815) (-230.980) (-228.686) [-234.413] -- 0:00:45
196500 -- [-230.360] (-229.222) (-228.781) (-229.686) * [-232.745] (-230.932) (-236.133) (-231.063) -- 0:00:44
197000 -- (-232.114) (-232.104) (-229.935) [-229.279] * [-233.109] (-228.305) (-234.154) (-232.167) -- 0:00:44
197500 -- [-229.340] (-231.247) (-229.399) (-232.612) * (-231.053) (-229.212) (-234.628) [-229.094] -- 0:00:48
198000 -- (-232.354) [-230.039] (-229.488) (-231.648) * (-232.653) (-233.803) (-230.820) [-231.999] -- 0:00:48
198500 -- (-231.190) (-229.445) [-231.775] (-228.596) * (-231.639) (-229.787) (-230.446) [-230.516] -- 0:00:48
199000 -- (-231.153) [-230.401] (-229.164) (-231.656) * (-230.629) (-229.691) (-230.585) [-229.935] -- 0:00:48
199500 -- [-230.060] (-232.030) (-230.623) (-229.806) * (-229.480) (-235.684) [-229.639] (-229.599) -- 0:00:48
200000 -- (-228.945) (-228.245) (-228.923) [-228.302] * (-229.113) (-229.490) (-230.617) [-229.049] -- 0:00:48
Average standard deviation of split frequencies: 0.012921
200500 -- [-230.833] (-230.226) (-228.097) (-229.486) * (-229.580) (-230.570) (-229.030) [-229.421] -- 0:00:47
201000 -- [-231.816] (-229.610) (-228.596) (-230.425) * [-229.233] (-229.068) (-229.441) (-229.065) -- 0:00:47
201500 -- (-230.826) (-232.425) (-228.848) [-231.590] * [-230.595] (-232.312) (-232.257) (-230.823) -- 0:00:47
202000 -- [-228.735] (-229.295) (-228.627) (-231.472) * (-228.699) (-232.290) [-232.619] (-232.545) -- 0:00:47
202500 -- (-230.200) (-229.067) (-230.413) [-231.000] * (-229.318) (-231.012) [-230.352] (-230.584) -- 0:00:47
203000 -- [-233.573] (-229.673) (-232.826) (-231.748) * [-228.613] (-229.350) (-229.416) (-229.409) -- 0:00:47
203500 -- (-230.659) (-230.218) [-229.911] (-228.735) * (-230.174) (-228.559) [-229.760] (-228.090) -- 0:00:46
204000 -- (-231.726) [-231.881] (-232.776) (-229.099) * (-229.901) [-229.231] (-232.789) (-230.583) -- 0:00:46
204500 -- (-228.919) (-228.091) [-235.150] (-230.780) * [-228.632] (-228.952) (-228.802) (-228.527) -- 0:00:46
205000 -- (-229.270) (-228.922) [-231.062] (-228.509) * (-230.580) [-229.004] (-230.739) (-230.480) -- 0:00:46
Average standard deviation of split frequencies: 0.013476
205500 -- (-229.772) (-228.580) [-230.427] (-229.063) * (-234.368) [-229.264] (-229.009) (-232.251) -- 0:00:46
206000 -- (-232.915) (-229.458) (-230.592) [-229.741] * [-232.591] (-229.108) (-228.574) (-235.972) -- 0:00:46
206500 -- (-232.363) (-230.152) (-229.542) [-228.087] * [-230.176] (-230.597) (-232.282) (-230.380) -- 0:00:46
207000 -- (-228.832) [-231.473] (-232.906) (-228.179) * [-228.309] (-229.387) (-231.486) (-232.139) -- 0:00:45
207500 -- (-232.330) (-236.131) [-229.036] (-228.908) * [-228.800] (-231.111) (-231.424) (-230.289) -- 0:00:45
208000 -- (-229.322) [-230.148] (-231.340) (-229.817) * [-230.535] (-229.547) (-229.865) (-228.901) -- 0:00:45
208500 -- (-228.952) (-231.228) [-232.551] (-229.514) * [-229.421] (-229.678) (-228.889) (-228.530) -- 0:00:45
209000 -- [-229.967] (-229.502) (-232.820) (-230.675) * (-230.930) (-230.120) (-230.778) [-230.442] -- 0:00:45
209500 -- (-230.211) (-228.531) (-233.072) [-229.028] * (-228.129) [-230.175] (-228.149) (-231.496) -- 0:00:45
210000 -- (-230.142) (-230.465) (-229.853) [-230.616] * (-232.497) (-233.092) [-229.432] (-229.462) -- 0:00:45
Average standard deviation of split frequencies: 0.014742
210500 -- (-229.144) (-230.384) [-231.750] (-229.236) * (-230.464) (-232.754) (-232.371) [-228.890] -- 0:00:45
211000 -- (-229.506) (-230.020) [-231.718] (-230.535) * (-230.301) [-228.111] (-233.652) (-228.572) -- 0:00:44
211500 -- (-229.878) (-229.394) [-228.880] (-229.941) * (-232.002) [-228.973] (-229.204) (-231.070) -- 0:00:44
212000 -- (-233.352) (-231.679) [-231.878] (-231.678) * [-232.920] (-232.582) (-230.235) (-233.115) -- 0:00:44
212500 -- (-230.428) (-232.989) (-228.632) [-228.827] * (-229.172) (-231.180) (-230.288) [-231.645] -- 0:00:44
213000 -- (-229.121) (-229.618) [-228.331] (-229.115) * [-230.501] (-228.979) (-228.464) (-230.311) -- 0:00:44
213500 -- (-232.774) (-230.013) (-228.775) [-228.185] * (-232.256) (-228.127) [-228.366] (-228.689) -- 0:00:44
214000 -- [-230.140] (-231.365) (-229.397) (-228.365) * (-228.656) [-231.415] (-234.891) (-232.465) -- 0:00:44
214500 -- [-229.071] (-230.537) (-229.576) (-228.200) * (-230.100) (-230.522) (-231.169) [-232.217] -- 0:00:47
215000 -- (-229.393) (-229.111) (-228.073) [-229.250] * [-229.702] (-230.282) (-232.341) (-231.885) -- 0:00:47
Average standard deviation of split frequencies: 0.015405
215500 -- (-232.259) [-232.797] (-233.292) (-229.859) * [-228.593] (-235.569) (-229.460) (-228.188) -- 0:00:47
216000 -- (-234.025) (-235.196) (-231.076) [-231.440] * [-229.764] (-234.607) (-231.093) (-231.176) -- 0:00:47
216500 -- [-233.246] (-234.201) (-230.961) (-229.926) * (-229.384) (-234.260) [-228.598] (-228.198) -- 0:00:47
217000 -- (-229.015) [-230.883] (-233.637) (-231.637) * (-229.643) (-234.133) (-230.506) [-229.882] -- 0:00:46
217500 -- (-231.001) [-229.458] (-232.290) (-229.102) * (-230.824) [-232.904] (-230.008) (-228.806) -- 0:00:46
218000 -- (-229.145) (-229.523) (-228.416) [-229.364] * (-230.072) (-231.991) [-230.053] (-231.409) -- 0:00:46
218500 -- (-228.005) (-229.403) (-228.331) [-230.564] * (-231.406) [-230.502] (-229.374) (-234.065) -- 0:00:46
219000 -- (-228.970) (-230.897) [-230.689] (-230.259) * (-232.633) (-235.414) (-230.360) [-230.563] -- 0:00:46
219500 -- [-229.866] (-234.013) (-230.996) (-230.424) * [-232.739] (-227.893) (-230.498) (-229.065) -- 0:00:46
220000 -- (-230.839) (-231.399) (-231.937) [-230.480] * (-230.585) (-229.142) [-229.877] (-228.941) -- 0:00:46
Average standard deviation of split frequencies: 0.014717
220500 -- [-228.742] (-231.683) (-229.079) (-230.211) * (-230.380) (-227.976) [-229.566] (-231.318) -- 0:00:45
221000 -- (-232.765) (-230.461) (-232.722) [-229.645] * (-229.974) (-229.051) (-228.296) [-232.098] -- 0:00:45
221500 -- (-231.520) (-229.421) (-233.167) [-231.368] * [-235.604] (-229.803) (-229.114) (-230.537) -- 0:00:45
222000 -- (-230.844) (-231.403) [-229.886] (-230.925) * [-231.879] (-234.117) (-228.667) (-228.499) -- 0:00:45
222500 -- (-229.596) [-230.733] (-229.504) (-229.457) * (-236.941) (-233.728) [-233.381] (-233.052) -- 0:00:45
223000 -- [-231.835] (-229.905) (-229.557) (-233.022) * (-231.914) [-230.009] (-229.422) (-230.447) -- 0:00:45
223500 -- (-229.646) (-230.841) (-229.563) [-231.528] * (-231.039) (-229.872) (-230.844) [-230.822] -- 0:00:45
224000 -- (-229.574) (-229.904) [-231.543] (-229.385) * [-229.446] (-229.414) (-230.414) (-230.144) -- 0:00:45
224500 -- (-228.436) [-229.224] (-229.569) (-230.117) * [-233.182] (-229.055) (-233.817) (-233.618) -- 0:00:44
225000 -- (-229.118) (-231.013) [-231.583] (-228.218) * (-228.694) (-229.327) (-234.530) [-230.505] -- 0:00:44
Average standard deviation of split frequencies: 0.014485
225500 -- (-229.247) (-229.075) (-232.236) [-230.316] * (-229.139) [-228.624] (-229.872) (-229.733) -- 0:00:44
226000 -- (-230.396) (-228.447) (-232.797) [-228.431] * (-230.102) [-231.414] (-231.004) (-230.342) -- 0:00:44
226500 -- [-232.115] (-229.393) (-230.645) (-231.248) * (-229.314) [-231.245] (-229.577) (-228.538) -- 0:00:44
227000 -- (-229.182) (-234.862) (-228.192) [-234.267] * (-233.621) (-231.590) (-231.367) [-229.504] -- 0:00:44
227500 -- (-229.082) (-236.674) [-229.707] (-235.524) * (-228.422) (-231.159) [-233.413] (-230.518) -- 0:00:44
228000 -- (-233.268) [-229.626] (-230.024) (-230.488) * (-231.904) (-234.158) [-232.481] (-229.440) -- 0:00:44
228500 -- (-230.565) (-234.442) [-229.689] (-228.893) * (-233.300) (-229.776) (-230.057) [-230.513] -- 0:00:43
229000 -- [-229.004] (-230.450) (-230.825) (-230.133) * (-232.292) (-229.882) (-228.675) [-229.013] -- 0:00:43
229500 -- (-232.242) (-230.772) (-229.193) [-228.702] * (-230.451) (-228.998) (-228.135) [-228.333] -- 0:00:43
230000 -- (-229.481) (-228.414) [-230.601] (-231.513) * (-230.396) (-230.401) (-228.919) [-229.091] -- 0:00:43
Average standard deviation of split frequencies: 0.014646
230500 -- (-232.590) (-228.526) (-229.036) [-232.214] * (-229.997) (-229.141) (-230.519) [-229.505] -- 0:00:43
231000 -- (-229.271) [-230.766] (-230.097) (-233.672) * (-228.879) (-230.185) [-229.949] (-228.808) -- 0:00:43
231500 -- (-230.582) (-229.620) (-231.929) [-228.785] * (-230.458) (-230.168) (-230.021) [-228.406] -- 0:00:46
232000 -- (-228.428) (-231.237) [-230.025] (-231.858) * (-228.779) (-229.648) [-232.351] (-231.363) -- 0:00:46
232500 -- (-229.532) (-232.746) [-229.031] (-230.169) * (-232.967) (-229.482) [-232.012] (-233.397) -- 0:00:46
233000 -- (-232.583) (-230.799) (-230.106) [-229.253] * (-230.050) (-232.409) [-228.151] (-231.221) -- 0:00:46
233500 -- (-233.344) [-232.176] (-231.663) (-231.099) * [-229.507] (-229.414) (-229.760) (-231.821) -- 0:00:45
234000 -- [-228.593] (-228.630) (-232.358) (-233.635) * (-230.624) [-230.516] (-229.732) (-229.349) -- 0:00:45
234500 -- (-229.802) (-230.310) [-230.068] (-231.405) * (-230.701) [-228.104] (-231.590) (-230.286) -- 0:00:45
235000 -- (-229.095) (-229.656) (-232.777) [-229.017] * (-232.056) (-232.061) [-232.800] (-238.680) -- 0:00:45
Average standard deviation of split frequencies: 0.014204
235500 -- [-231.156] (-230.596) (-233.498) (-234.532) * (-230.142) (-232.848) [-227.870] (-231.584) -- 0:00:45
236000 -- (-230.916) (-230.122) [-230.097] (-231.915) * (-234.940) (-228.918) (-228.778) [-228.019] -- 0:00:45
236500 -- (-231.587) (-231.357) [-229.528] (-230.615) * (-235.271) [-230.324] (-232.072) (-231.924) -- 0:00:45
237000 -- [-231.644] (-232.406) (-231.009) (-228.281) * (-232.377) [-229.208] (-228.670) (-231.028) -- 0:00:45
237500 -- (-232.758) (-230.414) (-231.287) [-228.490] * (-228.408) [-229.447] (-232.164) (-228.755) -- 0:00:44
238000 -- (-229.955) (-229.666) (-228.486) [-229.381] * [-231.265] (-231.566) (-228.323) (-232.144) -- 0:00:44
238500 -- (-231.695) (-230.215) [-229.855] (-229.764) * (-230.930) (-232.522) (-229.992) [-230.862] -- 0:00:44
239000 -- (-228.821) (-235.998) (-228.864) [-228.572] * (-236.261) [-229.221] (-229.268) (-230.508) -- 0:00:44
239500 -- (-228.916) (-231.178) [-229.922] (-229.483) * (-234.301) [-229.759] (-232.501) (-231.311) -- 0:00:44
240000 -- (-229.985) [-230.834] (-235.619) (-228.787) * (-231.025) (-228.803) (-230.566) [-228.137] -- 0:00:44
Average standard deviation of split frequencies: 0.013402
240500 -- (-229.895) (-230.480) (-233.438) [-228.479] * (-228.612) (-228.773) [-230.718] (-230.376) -- 0:00:44
241000 -- (-230.949) (-230.629) [-230.398] (-228.363) * [-229.056] (-228.267) (-230.669) (-230.642) -- 0:00:44
241500 -- (-230.631) (-228.816) (-230.275) [-228.961] * [-230.066] (-230.137) (-230.552) (-229.224) -- 0:00:43
242000 -- [-229.057] (-229.211) (-229.760) (-230.538) * (-232.751) (-231.086) (-232.770) [-229.477] -- 0:00:43
242500 -- [-229.688] (-228.450) (-230.407) (-227.906) * (-231.962) [-229.598] (-228.685) (-228.884) -- 0:00:43
243000 -- (-229.897) (-232.689) (-232.608) [-229.780] * [-229.230] (-232.072) (-231.337) (-229.657) -- 0:00:43
243500 -- [-229.748] (-230.559) (-231.005) (-229.815) * (-230.367) [-229.407] (-229.835) (-229.990) -- 0:00:43
244000 -- [-229.082] (-228.208) (-229.328) (-229.533) * (-230.863) [-229.190] (-228.899) (-231.721) -- 0:00:43
244500 -- [-229.297] (-230.874) (-228.561) (-231.004) * (-229.890) (-231.236) [-230.334] (-239.680) -- 0:00:43
245000 -- (-233.410) [-229.744] (-231.014) (-229.471) * (-228.412) (-232.517) (-229.238) [-230.490] -- 0:00:43
Average standard deviation of split frequencies: 0.013111
245500 -- (-232.644) (-228.477) (-229.500) [-229.525] * [-228.993] (-231.912) (-229.965) (-232.956) -- 0:00:43
246000 -- (-232.308) (-230.850) (-232.196) [-229.604] * (-228.258) [-231.297] (-229.799) (-229.327) -- 0:00:42
246500 -- (-236.056) [-231.962] (-235.750) (-233.624) * [-230.180] (-228.860) (-235.381) (-229.762) -- 0:00:42
247000 -- [-229.660] (-231.135) (-234.207) (-231.938) * (-229.724) (-230.560) [-229.309] (-231.757) -- 0:00:42
247500 -- (-232.531) (-233.324) (-230.775) [-232.051] * (-230.144) [-230.426] (-230.564) (-229.400) -- 0:00:42
248000 -- (-229.210) (-230.652) (-229.332) [-229.562] * (-231.275) (-233.240) [-229.870] (-230.335) -- 0:00:42
248500 -- (-230.042) (-227.930) [-232.250] (-228.689) * (-230.826) [-229.397] (-230.217) (-231.614) -- 0:00:45
249000 -- (-228.487) [-229.408] (-231.483) (-231.270) * (-229.459) (-231.711) (-231.960) [-230.034] -- 0:00:45
249500 -- (-228.335) [-229.443] (-230.645) (-231.170) * (-231.630) (-230.742) (-232.583) [-229.341] -- 0:00:45
250000 -- (-230.235) (-229.934) [-229.523] (-231.129) * (-229.736) [-229.900] (-232.459) (-229.437) -- 0:00:45
Average standard deviation of split frequencies: 0.013857
250500 -- (-230.480) [-230.113] (-231.758) (-230.797) * (-231.523) [-229.146] (-231.356) (-229.914) -- 0:00:44
251000 -- [-229.077] (-229.260) (-230.183) (-231.320) * (-229.324) [-229.909] (-229.762) (-233.426) -- 0:00:44
251500 -- [-229.119] (-231.022) (-230.481) (-229.462) * (-232.079) (-229.829) (-229.069) [-231.655] -- 0:00:44
252000 -- [-228.812] (-229.415) (-233.012) (-231.600) * [-231.437] (-230.988) (-235.374) (-228.481) -- 0:00:44
252500 -- (-230.991) [-230.100] (-228.423) (-228.544) * (-231.334) [-229.836] (-228.770) (-229.332) -- 0:00:44
253000 -- (-228.476) [-230.778] (-230.319) (-228.154) * [-232.894] (-229.168) (-229.417) (-232.475) -- 0:00:44
253500 -- (-230.414) (-230.944) (-231.032) [-228.761] * (-230.322) [-229.031] (-229.881) (-232.489) -- 0:00:44
254000 -- (-231.215) (-229.694) (-229.327) [-228.986] * (-236.522) [-228.265] (-231.760) (-233.520) -- 0:00:44
254500 -- (-231.611) (-229.793) (-229.706) [-228.331] * (-229.871) (-229.089) [-232.365] (-231.370) -- 0:00:43
255000 -- (-232.093) (-229.440) (-230.354) [-229.137] * (-230.733) (-228.214) (-231.068) [-228.775] -- 0:00:43
Average standard deviation of split frequencies: 0.011727
255500 -- (-235.768) (-228.757) (-229.226) [-233.509] * (-228.990) (-231.176) [-228.238] (-231.601) -- 0:00:43
256000 -- [-231.768] (-229.005) (-229.941) (-229.504) * [-229.722] (-230.309) (-231.732) (-235.017) -- 0:00:43
256500 -- (-230.259) (-228.501) (-229.352) [-231.179] * [-230.498] (-228.613) (-229.107) (-228.312) -- 0:00:43
257000 -- (-229.976) [-228.830] (-229.021) (-230.369) * (-230.995) [-229.302] (-230.370) (-228.498) -- 0:00:43
257500 -- [-230.392] (-233.520) (-227.902) (-231.512) * (-230.371) (-231.542) (-231.546) [-229.121] -- 0:00:43
258000 -- (-232.452) (-232.296) (-232.000) [-236.510] * (-231.319) [-230.883] (-229.163) (-231.567) -- 0:00:43
258500 -- (-231.254) (-229.806) [-231.157] (-237.612) * (-230.362) [-229.937] (-234.355) (-230.084) -- 0:00:43
259000 -- (-233.316) (-229.628) (-230.591) [-236.735] * (-229.214) (-228.447) (-234.730) [-229.353] -- 0:00:42
259500 -- [-229.447] (-229.596) (-232.664) (-234.781) * [-230.835] (-229.454) (-235.043) (-228.474) -- 0:00:42
260000 -- [-228.290] (-233.697) (-230.972) (-233.656) * [-230.164] (-229.125) (-232.177) (-228.916) -- 0:00:42
Average standard deviation of split frequencies: 0.012659
260500 -- [-228.255] (-232.654) (-236.286) (-229.943) * [-229.240] (-231.464) (-230.950) (-229.211) -- 0:00:42
261000 -- (-228.388) (-229.319) (-230.208) [-230.122] * (-229.187) (-231.943) [-229.762] (-230.285) -- 0:00:42
261500 -- (-229.467) (-229.879) [-229.453] (-233.162) * [-229.466] (-231.338) (-229.756) (-230.046) -- 0:00:42
262000 -- (-228.469) [-229.321] (-229.041) (-233.510) * (-231.144) (-231.549) [-228.951] (-229.600) -- 0:00:42
262500 -- (-229.477) [-230.188] (-232.034) (-230.737) * (-228.857) (-229.024) [-229.344] (-230.722) -- 0:00:42
263000 -- (-234.023) [-234.884] (-229.974) (-229.868) * (-228.296) [-229.620] (-235.194) (-229.782) -- 0:00:42
263500 -- (-230.271) (-231.388) [-230.166] (-230.032) * (-229.585) (-231.729) (-231.599) [-230.251] -- 0:00:41
264000 -- (-230.162) (-232.926) (-230.266) [-228.941] * (-229.306) (-230.067) [-230.907] (-231.379) -- 0:00:41
264500 -- [-228.978] (-230.897) (-230.346) (-228.907) * [-228.601] (-230.849) (-228.265) (-231.378) -- 0:00:41
265000 -- (-227.930) (-229.910) [-229.958] (-230.085) * (-232.026) (-233.714) [-229.790] (-233.599) -- 0:00:41
Average standard deviation of split frequencies: 0.013152
265500 -- (-228.809) (-231.188) (-229.772) [-230.331] * [-234.315] (-231.736) (-230.438) (-232.138) -- 0:00:44
266000 -- (-230.058) (-228.896) (-230.566) [-228.255] * (-231.726) [-230.003] (-232.554) (-229.585) -- 0:00:44
266500 -- [-230.283] (-231.144) (-228.501) (-229.291) * (-230.170) (-231.118) (-233.219) [-231.190] -- 0:00:44
267000 -- (-229.410) [-231.237] (-232.792) (-230.290) * [-228.213] (-229.754) (-228.788) (-228.320) -- 0:00:43
267500 -- [-232.003] (-230.529) (-228.726) (-228.754) * (-229.764) (-232.642) (-232.169) [-228.537] -- 0:00:43
268000 -- (-229.455) (-232.708) [-228.654] (-232.143) * [-229.068] (-230.294) (-230.071) (-229.498) -- 0:00:43
268500 -- (-231.115) (-228.472) [-229.037] (-229.650) * (-234.886) [-229.959] (-229.276) (-229.790) -- 0:00:43
269000 -- (-230.010) (-229.992) (-228.402) [-230.822] * (-228.394) (-231.804) (-228.512) [-229.437] -- 0:00:43
269500 -- (-228.923) (-234.043) [-228.680] (-232.560) * (-228.163) [-231.897] (-230.208) (-229.469) -- 0:00:43
270000 -- (-232.405) [-232.112] (-228.915) (-228.669) * (-230.011) (-229.551) (-232.044) [-230.133] -- 0:00:43
Average standard deviation of split frequencies: 0.012558
270500 -- (-229.927) (-232.840) [-230.321] (-229.093) * [-230.607] (-230.322) (-227.844) (-231.598) -- 0:00:43
271000 -- (-235.215) (-231.895) [-229.643] (-229.231) * (-236.044) [-230.775] (-229.886) (-234.241) -- 0:00:43
271500 -- (-229.349) (-230.380) [-230.483] (-230.382) * (-234.840) [-231.374] (-228.283) (-231.295) -- 0:00:42
272000 -- (-229.461) [-233.538] (-229.911) (-229.100) * (-228.418) [-230.701] (-232.324) (-229.099) -- 0:00:42
272500 -- (-228.809) (-229.305) [-234.618] (-230.100) * (-231.335) (-233.332) [-230.047] (-235.903) -- 0:00:42
273000 -- (-228.722) (-232.525) (-232.998) [-228.676] * (-228.686) [-231.661] (-235.474) (-229.848) -- 0:00:42
273500 -- [-230.247] (-229.561) (-232.292) (-229.788) * (-231.545) (-231.803) (-227.984) [-229.277] -- 0:00:42
274000 -- (-233.330) [-228.106] (-228.038) (-229.498) * [-230.030] (-230.091) (-229.731) (-229.910) -- 0:00:42
274500 -- [-228.631] (-230.248) (-231.326) (-231.559) * (-229.595) (-232.050) (-230.696) [-230.048] -- 0:00:42
275000 -- (-231.942) (-232.551) [-229.042] (-230.256) * (-228.894) [-231.437] (-233.196) (-230.966) -- 0:00:42
Average standard deviation of split frequencies: 0.013125
275500 -- [-229.473] (-231.428) (-233.614) (-229.449) * (-229.966) (-232.015) [-232.107] (-229.974) -- 0:00:42
276000 -- [-232.533] (-228.936) (-229.682) (-231.687) * [-230.844] (-230.778) (-231.636) (-229.212) -- 0:00:41
276500 -- (-229.743) (-229.301) [-229.914] (-229.226) * [-230.585] (-229.562) (-233.517) (-228.830) -- 0:00:41
277000 -- (-229.459) (-231.607) (-228.024) [-229.690] * (-232.083) (-229.779) (-232.786) [-229.832] -- 0:00:41
277500 -- (-230.129) [-233.058] (-229.080) (-230.093) * (-230.274) (-231.224) [-230.129] (-229.144) -- 0:00:41
278000 -- (-230.475) [-229.366] (-229.287) (-229.856) * (-229.616) [-228.920] (-229.003) (-228.872) -- 0:00:41
278500 -- (-230.020) (-232.609) [-230.174] (-230.006) * (-234.876) [-229.260] (-230.503) (-235.149) -- 0:00:41
279000 -- (-229.572) (-235.493) [-231.767] (-232.617) * (-228.502) [-228.581] (-228.505) (-228.231) -- 0:00:41
279500 -- [-232.705] (-234.832) (-233.075) (-232.062) * (-231.029) (-229.051) [-228.655] (-231.814) -- 0:00:41
280000 -- (-234.661) (-231.635) (-229.385) [-230.271] * (-231.309) (-228.874) (-231.806) [-232.763] -- 0:00:41
Average standard deviation of split frequencies: 0.012818
280500 -- [-229.216] (-234.203) (-229.897) (-229.924) * (-230.710) (-231.429) (-232.612) [-230.470] -- 0:00:41
281000 -- [-233.056] (-228.970) (-228.877) (-230.263) * [-229.949] (-232.234) (-228.988) (-232.295) -- 0:00:40
281500 -- (-231.329) (-230.446) (-229.909) [-229.584] * (-230.511) (-229.930) [-231.038] (-231.133) -- 0:00:40
282000 -- [-228.943] (-227.947) (-232.501) (-232.064) * (-231.237) [-230.767] (-236.833) (-228.418) -- 0:00:40
282500 -- (-228.570) (-230.272) [-230.210] (-229.181) * (-231.349) (-229.412) (-230.218) [-230.087] -- 0:00:43
283000 -- (-228.160) (-232.379) (-233.317) [-229.211] * (-229.722) [-229.173] (-229.453) (-232.580) -- 0:00:43
283500 -- [-228.597] (-228.061) (-230.358) (-230.653) * (-231.733) (-228.984) [-229.793] (-228.852) -- 0:00:42
284000 -- (-234.556) (-230.477) (-231.485) [-230.523] * (-228.628) (-230.643) (-228.635) [-229.922] -- 0:00:42
284500 -- [-229.508] (-232.022) (-231.702) (-231.797) * (-231.170) [-230.324] (-228.183) (-229.747) -- 0:00:42
285000 -- (-232.269) (-232.180) (-232.212) [-229.351] * (-236.412) [-231.600] (-231.158) (-229.125) -- 0:00:42
Average standard deviation of split frequencies: 0.012666
285500 -- [-227.928] (-233.364) (-229.429) (-233.102) * (-236.181) (-228.594) (-229.683) [-228.583] -- 0:00:42
286000 -- (-228.965) (-231.583) [-229.345] (-229.963) * [-236.102] (-229.803) (-230.838) (-229.426) -- 0:00:42
286500 -- [-229.719] (-228.828) (-233.784) (-233.692) * [-228.345] (-229.472) (-230.645) (-229.828) -- 0:00:42
287000 -- (-231.045) [-229.768] (-228.677) (-234.550) * (-228.698) (-230.948) (-230.100) [-229.909] -- 0:00:42
287500 -- (-229.730) (-231.375) (-230.711) [-228.576] * [-231.218] (-228.493) (-230.439) (-230.413) -- 0:00:42
288000 -- (-231.633) (-232.661) (-231.387) [-228.896] * (-231.349) [-229.995] (-232.998) (-228.135) -- 0:00:42
288500 -- [-229.556] (-232.547) (-229.528) (-229.352) * [-229.368] (-229.818) (-236.221) (-232.108) -- 0:00:41
289000 -- (-228.255) [-230.360] (-231.195) (-229.004) * (-232.758) (-229.777) [-229.512] (-233.282) -- 0:00:41
289500 -- [-231.807] (-229.196) (-233.304) (-227.928) * (-230.179) [-228.386] (-228.176) (-229.000) -- 0:00:41
290000 -- [-229.848] (-228.431) (-229.513) (-229.324) * (-232.552) [-232.288] (-228.252) (-230.324) -- 0:00:41
Average standard deviation of split frequencies: 0.013605
290500 -- (-228.281) (-232.433) (-231.130) [-228.944] * (-230.471) (-228.813) [-228.492] (-229.841) -- 0:00:41
291000 -- (-229.595) (-231.928) (-232.393) [-229.690] * (-233.491) [-230.342] (-228.909) (-229.076) -- 0:00:41
291500 -- (-230.584) (-229.070) (-232.572) [-230.269] * (-230.082) (-235.885) [-230.358] (-230.230) -- 0:00:41
292000 -- (-232.712) [-230.110] (-230.335) (-229.211) * (-231.108) [-233.062] (-231.904) (-233.654) -- 0:00:41
292500 -- (-229.209) [-228.614] (-229.009) (-230.457) * (-230.982) (-229.184) [-228.986] (-229.608) -- 0:00:41
293000 -- (-229.784) [-230.230] (-230.360) (-230.089) * (-231.886) [-228.343] (-228.174) (-229.646) -- 0:00:41
293500 -- (-229.013) (-230.145) [-231.139] (-232.205) * [-228.168] (-230.615) (-228.250) (-232.665) -- 0:00:40
294000 -- (-228.213) (-230.285) (-229.925) [-229.481] * [-228.647] (-228.296) (-230.695) (-229.247) -- 0:00:40
294500 -- (-233.381) (-232.329) [-229.968] (-230.033) * (-229.028) [-228.833] (-229.961) (-229.816) -- 0:00:40
295000 -- [-230.683] (-228.228) (-227.864) (-231.951) * (-228.675) [-229.190] (-232.485) (-230.696) -- 0:00:40
Average standard deviation of split frequencies: 0.013006
295500 -- (-230.714) [-228.676] (-228.338) (-232.331) * (-228.569) (-229.981) (-228.324) [-233.790] -- 0:00:40
296000 -- (-231.209) [-229.763] (-231.348) (-234.064) * (-231.210) [-234.778] (-229.313) (-229.621) -- 0:00:40
296500 -- (-232.332) [-228.967] (-230.010) (-237.438) * (-231.711) [-229.461] (-228.845) (-233.111) -- 0:00:40
297000 -- [-229.374] (-230.754) (-232.625) (-230.238) * (-231.471) [-229.333] (-228.680) (-229.900) -- 0:00:40
297500 -- (-229.256) (-233.702) [-228.359] (-231.877) * [-230.228] (-227.932) (-229.048) (-228.898) -- 0:00:40
298000 -- (-228.788) [-234.610] (-230.148) (-231.081) * (-230.095) (-239.915) (-228.588) [-230.600] -- 0:00:40
298500 -- [-229.071] (-230.010) (-233.918) (-231.502) * [-229.098] (-231.731) (-228.299) (-228.590) -- 0:00:39
299000 -- (-230.787) (-230.901) (-234.200) [-228.939] * (-230.497) [-231.321] (-233.714) (-231.850) -- 0:00:39
299500 -- (-230.404) (-229.217) [-236.965] (-231.698) * (-231.785) [-234.229] (-231.964) (-229.849) -- 0:00:42
300000 -- [-228.533] (-228.326) (-229.448) (-231.334) * [-227.980] (-230.556) (-232.461) (-231.040) -- 0:00:42
Average standard deviation of split frequencies: 0.012020
300500 -- (-228.339) (-229.052) (-230.513) [-228.904] * (-229.580) [-230.286] (-230.322) (-229.881) -- 0:00:41
301000 -- (-230.140) [-228.658] (-231.220) (-229.635) * (-228.316) (-229.706) (-234.414) [-229.392] -- 0:00:41
301500 -- (-229.051) (-233.701) (-231.000) [-229.975] * (-228.379) (-229.146) (-230.663) [-231.467] -- 0:00:41
302000 -- (-229.182) [-234.211] (-229.309) (-232.856) * (-230.478) (-229.185) (-231.942) [-228.357] -- 0:00:41
302500 -- (-228.770) (-234.120) (-229.348) [-229.117] * (-232.546) [-233.093] (-231.385) (-229.653) -- 0:00:41
303000 -- (-228.642) (-232.608) [-233.082] (-228.522) * [-228.206] (-233.542) (-228.552) (-230.215) -- 0:00:41
303500 -- (-228.648) (-230.840) (-229.081) [-230.449] * (-229.340) (-230.482) (-228.844) [-230.495] -- 0:00:41
304000 -- [-229.101] (-233.394) (-228.519) (-230.321) * [-229.310] (-230.753) (-233.170) (-230.273) -- 0:00:41
304500 -- (-231.322) (-233.794) [-230.446] (-229.174) * (-229.496) (-229.799) (-229.886) [-229.137] -- 0:00:41
305000 -- (-229.201) (-231.042) [-229.792] (-230.275) * [-230.208] (-231.283) (-229.796) (-232.855) -- 0:00:41
Average standard deviation of split frequencies: 0.012410
305500 -- [-231.822] (-230.507) (-229.908) (-229.436) * (-229.461) [-230.361] (-230.097) (-229.093) -- 0:00:40
306000 -- (-229.635) [-229.138] (-228.052) (-231.126) * (-231.172) (-232.002) (-230.349) [-231.365] -- 0:00:40
306500 -- (-229.330) [-228.818] (-231.953) (-228.902) * [-229.659] (-231.800) (-230.455) (-229.916) -- 0:00:40
307000 -- [-229.935] (-229.317) (-228.240) (-231.075) * (-228.920) [-231.080] (-233.915) (-231.939) -- 0:00:40
307500 -- (-231.453) (-232.131) [-231.503] (-228.562) * [-228.652] (-232.534) (-233.649) (-229.678) -- 0:00:40
308000 -- [-232.135] (-233.933) (-230.942) (-229.287) * [-231.550] (-234.300) (-230.964) (-230.807) -- 0:00:40
308500 -- (-233.275) [-229.161] (-228.710) (-228.775) * (-232.531) [-229.633] (-228.550) (-228.026) -- 0:00:40
309000 -- (-234.571) (-233.152) [-230.488] (-228.059) * (-228.134) (-229.223) [-229.443] (-228.997) -- 0:00:40
309500 -- (-228.897) (-233.893) (-232.015) [-233.870] * [-232.616] (-229.919) (-231.252) (-229.332) -- 0:00:40
310000 -- (-229.514) (-234.045) (-228.674) [-231.540] * (-231.070) (-230.873) (-229.720) [-228.971] -- 0:00:40
Average standard deviation of split frequencies: 0.012561
310500 -- (-232.069) (-234.999) (-233.314) [-231.548] * [-234.208] (-229.533) (-232.343) (-230.759) -- 0:00:39
311000 -- (-229.063) [-230.091] (-232.798) (-231.888) * [-235.374] (-231.232) (-237.302) (-230.420) -- 0:00:39
311500 -- (-230.072) (-229.389) (-230.306) [-228.973] * [-231.401] (-228.715) (-229.864) (-233.711) -- 0:00:39
312000 -- [-234.615] (-229.525) (-232.949) (-231.458) * (-231.171) (-229.103) [-229.724] (-228.982) -- 0:00:39
312500 -- [-230.056] (-230.245) (-229.470) (-232.660) * (-231.099) (-228.790) [-232.273] (-229.363) -- 0:00:39
313000 -- [-231.267] (-230.099) (-230.453) (-231.820) * [-229.413] (-229.411) (-230.122) (-228.771) -- 0:00:39
313500 -- (-231.862) [-229.101] (-231.937) (-228.488) * (-231.265) (-229.941) [-230.324] (-233.765) -- 0:00:39
314000 -- (-230.308) (-229.590) [-232.969] (-232.855) * (-229.674) (-232.252) [-230.239] (-229.185) -- 0:00:39
314500 -- (-230.205) (-229.223) (-231.511) [-229.836] * (-230.493) (-232.569) [-229.745] (-229.484) -- 0:00:39
315000 -- (-232.834) (-232.188) [-229.764] (-229.637) * (-234.763) (-230.785) (-233.102) [-230.170] -- 0:00:39
Average standard deviation of split frequencies: 0.011603
315500 -- (-230.391) (-231.242) [-228.556] (-230.655) * [-231.060] (-230.856) (-229.016) (-230.443) -- 0:00:39
316000 -- (-229.737) (-230.990) [-228.474] (-232.433) * (-229.299) (-230.207) (-229.056) [-230.982] -- 0:00:38
316500 -- (-229.468) [-230.981] (-229.401) (-230.048) * [-234.961] (-227.922) (-236.718) (-229.521) -- 0:00:41
317000 -- [-230.006] (-229.611) (-231.274) (-233.961) * (-229.196) (-229.020) (-231.863) [-229.427] -- 0:00:40
317500 -- [-228.272] (-230.432) (-231.205) (-237.586) * (-230.468) [-231.760] (-230.543) (-229.473) -- 0:00:40
318000 -- (-229.996) (-229.787) (-229.901) [-229.431] * (-229.849) (-233.272) (-229.129) [-229.577] -- 0:00:40
318500 -- (-230.066) (-231.176) [-229.315] (-232.394) * (-228.425) (-233.249) (-230.539) [-229.328] -- 0:00:40
319000 -- (-230.343) [-230.449] (-230.153) (-232.720) * (-229.954) (-232.455) (-233.181) [-229.654] -- 0:00:40
319500 -- (-229.171) [-229.071] (-230.052) (-230.128) * (-231.602) (-231.107) (-228.660) [-232.941] -- 0:00:40
320000 -- (-230.854) (-233.345) [-230.280] (-228.461) * (-232.970) (-234.185) [-228.882] (-230.895) -- 0:00:40
Average standard deviation of split frequencies: 0.011842
320500 -- [-231.394] (-231.379) (-232.838) (-228.615) * (-230.513) [-235.059] (-230.321) (-230.873) -- 0:00:40
321000 -- [-229.010] (-229.995) (-234.386) (-232.150) * (-230.500) (-231.345) (-229.547) [-230.826] -- 0:00:40
321500 -- (-230.257) (-229.659) (-229.808) [-231.545] * (-232.701) [-229.362] (-232.586) (-229.417) -- 0:00:40
322000 -- (-231.992) [-230.571] (-228.413) (-231.541) * [-228.578] (-229.602) (-229.151) (-230.519) -- 0:00:40
322500 -- (-229.288) [-229.536] (-229.379) (-231.758) * (-229.469) (-233.232) (-230.561) [-233.499] -- 0:00:39
323000 -- (-229.198) (-229.332) [-231.248] (-229.540) * (-230.256) [-229.488] (-228.619) (-232.800) -- 0:00:39
323500 -- (-229.517) (-229.022) (-232.002) [-228.560] * [-230.836] (-229.144) (-229.833) (-230.526) -- 0:00:39
324000 -- [-231.920] (-230.384) (-231.917) (-228.344) * (-228.708) (-229.618) (-229.622) [-230.103] -- 0:00:39
324500 -- [-230.203] (-231.944) (-230.426) (-228.999) * (-231.853) (-232.156) (-228.172) [-229.692] -- 0:00:39
325000 -- (-230.184) [-230.209] (-229.670) (-228.613) * [-232.286] (-229.840) (-228.564) (-231.323) -- 0:00:39
Average standard deviation of split frequencies: 0.011086
325500 -- [-231.604] (-231.913) (-230.406) (-228.806) * [-230.858] (-232.551) (-229.346) (-230.378) -- 0:00:39
326000 -- [-232.168] (-228.389) (-229.074) (-230.920) * (-229.008) [-229.156] (-231.218) (-228.887) -- 0:00:39
326500 -- (-232.140) (-229.286) [-231.104] (-230.050) * (-230.555) [-229.647] (-229.233) (-228.108) -- 0:00:39
327000 -- (-233.881) (-229.364) (-229.449) [-228.812] * [-228.883] (-229.541) (-228.226) (-229.311) -- 0:00:39
327500 -- (-230.017) (-229.500) [-230.859] (-228.299) * (-231.192) [-231.868] (-228.198) (-231.350) -- 0:00:39
328000 -- (-232.313) [-230.491] (-230.006) (-229.851) * [-229.229] (-230.166) (-228.836) (-237.231) -- 0:00:38
328500 -- (-231.628) (-229.126) [-229.906] (-231.056) * [-228.650] (-230.383) (-229.986) (-229.896) -- 0:00:38
329000 -- (-228.793) (-231.096) [-230.061] (-231.223) * (-230.205) [-229.687] (-229.652) (-230.960) -- 0:00:38
329500 -- (-229.770) (-229.201) [-232.448] (-230.756) * (-229.476) (-232.977) (-230.378) [-228.715] -- 0:00:40
330000 -- [-228.725] (-229.740) (-229.070) (-234.245) * (-230.426) (-232.064) (-232.034) [-228.645] -- 0:00:40
Average standard deviation of split frequencies: 0.010851
330500 -- (-234.884) (-230.447) [-232.440] (-234.563) * (-230.534) [-230.720] (-228.761) (-231.518) -- 0:00:40
331000 -- (-229.242) (-232.254) (-231.976) [-228.545] * (-234.515) (-230.720) [-230.653] (-228.543) -- 0:00:40
331500 -- (-229.369) [-229.655] (-231.877) (-230.732) * (-230.680) [-228.896] (-230.519) (-232.799) -- 0:00:40
332000 -- (-229.247) (-232.253) (-229.145) [-229.595] * (-234.149) (-230.636) (-230.623) [-233.722] -- 0:00:40
332500 -- (-230.843) (-229.165) (-229.937) [-228.197] * (-228.064) [-231.362] (-228.130) (-230.877) -- 0:00:40
333000 -- [-231.987] (-230.155) (-228.971) (-234.254) * [-229.071] (-227.831) (-229.571) (-232.620) -- 0:00:40
333500 -- [-231.016] (-228.554) (-230.433) (-231.845) * (-229.848) [-230.138] (-230.681) (-228.923) -- 0:00:39
334000 -- [-230.683] (-229.742) (-228.061) (-230.287) * (-229.451) (-228.416) (-228.738) [-229.297] -- 0:00:39
334500 -- (-231.817) [-230.556] (-229.366) (-229.534) * (-231.278) (-229.776) [-230.600] (-229.671) -- 0:00:39
335000 -- [-230.416] (-230.627) (-230.238) (-229.955) * (-235.538) (-229.679) [-229.990] (-230.884) -- 0:00:39
Average standard deviation of split frequencies: 0.010316
335500 -- (-228.321) (-233.341) (-230.383) [-230.817] * (-232.556) [-228.043] (-230.791) (-233.541) -- 0:00:39
336000 -- (-228.928) (-231.998) [-228.842] (-229.174) * [-229.881] (-230.539) (-229.243) (-232.292) -- 0:00:39
336500 -- (-232.018) (-231.530) (-228.605) [-228.549] * (-231.796) [-228.620] (-229.201) (-229.389) -- 0:00:39
337000 -- (-231.744) [-228.423] (-229.037) (-229.958) * (-232.489) [-228.814] (-231.847) (-234.567) -- 0:00:39
337500 -- (-228.074) (-229.641) [-232.200] (-230.038) * (-232.991) (-232.439) [-232.953] (-230.454) -- 0:00:39
338000 -- (-230.933) (-231.220) (-231.988) [-229.906] * (-230.490) [-229.009] (-231.762) (-230.905) -- 0:00:39
338500 -- [-229.088] (-233.998) (-228.643) (-232.100) * [-228.860] (-230.908) (-231.682) (-230.269) -- 0:00:39
339000 -- (-230.354) (-236.170) [-230.594] (-229.477) * [-230.433] (-230.477) (-229.316) (-229.598) -- 0:00:38
339500 -- [-230.638] (-229.229) (-235.864) (-232.611) * (-238.585) (-231.270) (-232.389) [-232.693] -- 0:00:38
340000 -- [-230.810] (-237.173) (-230.690) (-233.442) * (-229.975) (-230.209) (-228.700) [-229.802] -- 0:00:38
Average standard deviation of split frequencies: 0.009768
340500 -- (-227.992) [-231.073] (-228.942) (-230.290) * (-230.607) [-228.319] (-232.003) (-230.499) -- 0:00:38
341000 -- [-228.499] (-229.799) (-229.209) (-232.205) * [-230.565] (-230.050) (-229.973) (-231.736) -- 0:00:38
341500 -- (-228.566) (-228.754) (-229.680) [-230.305] * [-228.573] (-230.745) (-230.605) (-230.453) -- 0:00:38
342000 -- (-230.365) (-228.480) [-230.209] (-228.552) * (-234.142) (-228.628) (-233.937) [-230.049] -- 0:00:38
342500 -- [-235.923] (-231.796) (-228.192) (-228.377) * (-230.333) (-231.837) [-230.027] (-230.916) -- 0:00:40
343000 -- [-228.339] (-231.269) (-231.516) (-228.977) * [-230.633] (-230.504) (-228.648) (-228.748) -- 0:00:40
343500 -- (-232.069) (-228.753) (-228.435) [-230.113] * (-233.380) (-230.377) (-228.736) [-229.428] -- 0:00:40
344000 -- (-235.343) (-228.065) (-228.472) [-229.682] * (-232.949) [-230.221] (-230.315) (-228.883) -- 0:00:40
344500 -- (-236.256) (-228.892) [-229.078] (-232.706) * [-232.684] (-232.667) (-229.271) (-230.674) -- 0:00:39
345000 -- (-230.091) (-231.669) [-228.734] (-228.416) * (-237.219) (-229.554) (-230.309) [-230.022] -- 0:00:39
Average standard deviation of split frequencies: 0.008976
345500 -- (-229.560) (-230.492) (-229.672) [-230.068] * (-236.721) [-230.383] (-232.776) (-234.479) -- 0:00:39
346000 -- [-229.685] (-230.948) (-231.489) (-229.387) * [-233.368] (-230.380) (-228.932) (-228.232) -- 0:00:39
346500 -- (-236.755) [-230.040] (-228.891) (-233.334) * (-234.241) (-229.966) (-232.192) [-228.398] -- 0:00:39
347000 -- (-228.290) [-229.222] (-230.235) (-235.332) * (-230.241) (-229.532) (-231.610) [-230.366] -- 0:00:39
347500 -- (-230.372) [-229.230] (-230.038) (-234.546) * (-229.722) (-230.365) [-229.845] (-228.880) -- 0:00:39
348000 -- [-229.561] (-229.428) (-229.579) (-233.466) * (-230.004) [-230.636] (-232.172) (-229.104) -- 0:00:39
348500 -- (-229.648) (-228.866) (-230.453) [-231.124] * (-231.105) (-228.910) [-229.223] (-232.806) -- 0:00:39
349000 -- (-230.443) (-229.380) [-230.450] (-228.069) * [-230.791] (-229.073) (-230.492) (-236.509) -- 0:00:39
349500 -- (-229.201) [-232.654] (-230.291) (-231.155) * (-231.992) [-228.665] (-234.899) (-237.665) -- 0:00:39
350000 -- [-228.172] (-232.341) (-228.251) (-233.024) * (-228.848) (-228.851) (-230.074) [-228.887] -- 0:00:39
Average standard deviation of split frequencies: 0.009331
350500 -- [-229.746] (-237.066) (-228.514) (-229.403) * (-229.546) (-229.023) (-229.838) [-229.431] -- 0:00:38
351000 -- (-229.309) (-229.780) [-230.240] (-229.686) * [-228.130] (-231.948) (-229.106) (-229.780) -- 0:00:38
351500 -- (-229.996) (-231.693) [-229.095] (-231.792) * (-230.643) [-229.480] (-229.796) (-228.257) -- 0:00:38
352000 -- (-232.322) (-235.165) [-231.061] (-230.116) * [-229.043] (-233.583) (-228.025) (-230.899) -- 0:00:38
352500 -- (-229.369) [-229.038] (-229.989) (-232.675) * (-230.108) [-229.823] (-230.586) (-230.034) -- 0:00:38
353000 -- (-234.064) (-230.093) (-229.185) [-228.786] * (-229.698) [-232.200] (-230.745) (-228.672) -- 0:00:38
353500 -- (-232.020) [-228.601] (-228.859) (-235.388) * (-230.935) [-230.789] (-230.113) (-234.843) -- 0:00:38
354000 -- (-234.890) (-230.380) [-228.732] (-231.741) * [-232.811] (-229.879) (-231.924) (-235.025) -- 0:00:38
354500 -- [-230.524] (-229.138) (-228.315) (-229.097) * (-231.354) (-232.335) (-228.677) [-230.303] -- 0:00:38
355000 -- (-229.955) (-229.064) (-228.846) [-229.960] * [-228.905] (-231.881) (-229.348) (-229.654) -- 0:00:38
Average standard deviation of split frequencies: 0.008568
355500 -- (-229.206) [-228.449] (-228.026) (-231.508) * (-228.635) [-229.568] (-230.860) (-231.724) -- 0:00:38
356000 -- (-231.352) [-231.322] (-228.956) (-228.540) * [-228.608] (-228.207) (-230.127) (-230.996) -- 0:00:37
356500 -- (-229.292) (-230.163) [-228.552] (-233.205) * [-229.982] (-229.095) (-229.588) (-228.789) -- 0:00:37
357000 -- (-232.504) (-228.113) [-228.552] (-230.570) * [-233.737] (-234.559) (-233.528) (-231.114) -- 0:00:39
357500 -- (-229.108) [-231.467] (-229.034) (-231.274) * [-230.792] (-233.164) (-232.310) (-232.835) -- 0:00:39
358000 -- (-228.028) [-230.760] (-229.467) (-228.054) * (-228.306) (-236.574) (-231.846) [-229.132] -- 0:00:39
358500 -- (-229.485) (-230.343) [-228.345] (-233.803) * (-228.293) (-230.284) (-229.159) [-230.015] -- 0:00:39
359000 -- [-230.987] (-229.838) (-229.299) (-229.431) * (-229.099) (-228.025) (-230.476) [-229.841] -- 0:00:39
359500 -- (-229.015) (-229.314) [-229.422] (-228.863) * [-231.753] (-230.816) (-229.285) (-231.685) -- 0:00:39
360000 -- (-228.185) (-232.016) [-229.055] (-230.019) * [-233.700] (-229.406) (-232.935) (-229.242) -- 0:00:39
Average standard deviation of split frequencies: 0.009068
360500 -- (-229.957) (-229.119) [-229.866] (-228.330) * [-228.230] (-228.603) (-231.837) (-236.548) -- 0:00:39
361000 -- (-230.819) (-229.377) [-229.650] (-229.253) * (-229.292) (-229.955) [-230.760] (-237.606) -- 0:00:38
361500 -- (-229.540) (-228.210) [-231.585] (-229.211) * [-230.881] (-229.004) (-229.315) (-232.116) -- 0:00:38
362000 -- (-234.524) (-228.302) (-232.429) [-229.390] * [-228.852] (-230.346) (-231.834) (-231.737) -- 0:00:38
362500 -- (-232.007) [-230.149] (-229.452) (-230.960) * [-231.591] (-229.030) (-233.882) (-229.425) -- 0:00:38
363000 -- [-229.190] (-230.221) (-229.068) (-231.096) * (-231.379) [-228.407] (-233.277) (-229.526) -- 0:00:38
363500 -- (-228.945) (-233.317) (-228.628) [-232.437] * (-228.889) [-230.069] (-232.823) (-230.409) -- 0:00:38
364000 -- (-229.380) (-228.676) (-230.476) [-231.597] * (-233.231) (-235.594) [-229.304] (-231.641) -- 0:00:38
364500 -- [-229.488] (-230.973) (-231.958) (-228.567) * (-234.340) [-230.430] (-228.957) (-235.113) -- 0:00:38
365000 -- (-227.958) (-230.259) (-233.596) [-230.379] * (-231.164) [-231.107] (-231.600) (-236.008) -- 0:00:38
Average standard deviation of split frequencies: 0.009177
365500 -- (-231.028) [-229.186] (-235.441) (-230.291) * (-229.149) (-228.495) (-228.615) [-231.545] -- 0:00:38
366000 -- (-230.642) (-230.521) [-230.605] (-230.631) * (-229.273) (-229.886) (-232.803) [-229.619] -- 0:00:38
366500 -- (-232.191) (-227.854) [-230.160] (-229.489) * (-228.359) (-233.504) (-230.163) [-230.303] -- 0:00:38
367000 -- (-231.012) (-228.617) [-232.251] (-233.556) * [-228.463] (-232.859) (-231.605) (-229.442) -- 0:00:37
367500 -- (-231.576) (-230.142) [-230.655] (-229.648) * (-229.792) (-229.328) [-229.563] (-230.074) -- 0:00:37
368000 -- (-229.441) [-229.631] (-231.878) (-233.229) * (-229.078) (-229.620) [-228.989] (-233.078) -- 0:00:37
368500 -- [-228.547] (-230.276) (-230.433) (-230.249) * (-229.701) (-233.198) (-228.487) [-230.453] -- 0:00:37
369000 -- (-230.875) [-233.844] (-230.839) (-229.875) * [-231.204] (-232.718) (-230.376) (-229.350) -- 0:00:37
369500 -- (-230.160) [-228.551] (-229.607) (-230.262) * (-230.645) (-229.554) (-229.263) [-229.754] -- 0:00:37
370000 -- (-231.800) (-228.826) [-234.326] (-228.114) * (-229.377) (-231.303) [-232.423] (-228.946) -- 0:00:37
Average standard deviation of split frequencies: 0.009127
370500 -- (-230.092) (-232.527) (-229.312) [-230.187] * [-231.000] (-231.834) (-233.672) (-229.514) -- 0:00:37
371000 -- (-237.838) [-230.453] (-229.094) (-231.086) * (-232.676) (-232.227) (-232.551) [-229.528] -- 0:00:37
371500 -- (-233.799) [-228.805] (-228.738) (-230.925) * [-229.761] (-230.107) (-235.768) (-228.415) -- 0:00:38
372000 -- (-232.005) (-229.799) [-229.042] (-234.812) * [-228.915] (-232.832) (-232.568) (-229.676) -- 0:00:38
372500 -- (-230.214) [-228.707] (-230.283) (-236.102) * [-229.276] (-232.822) (-234.606) (-231.862) -- 0:00:38
373000 -- (-229.613) (-230.475) (-228.941) [-229.753] * (-229.663) (-234.482) [-230.293] (-232.193) -- 0:00:38
373500 -- (-228.528) [-230.519] (-230.623) (-229.054) * (-232.138) (-232.277) (-230.163) [-230.037] -- 0:00:38
374000 -- (-229.817) [-230.241] (-232.481) (-227.975) * (-231.446) (-231.493) (-229.644) [-229.655] -- 0:00:38
374500 -- (-229.505) (-229.535) (-229.817) [-228.811] * (-228.700) (-233.797) (-231.535) [-229.597] -- 0:00:38
375000 -- (-230.264) (-233.489) (-230.541) [-231.588] * [-230.896] (-231.212) (-231.320) (-232.439) -- 0:00:38
Average standard deviation of split frequencies: 0.008855
375500 -- (-228.884) (-229.377) [-231.711] (-230.345) * [-230.589] (-228.625) (-230.446) (-232.239) -- 0:00:38
376000 -- (-233.912) (-231.457) [-230.736] (-232.412) * (-228.132) [-229.691] (-233.111) (-228.675) -- 0:00:38
376500 -- [-230.947] (-235.233) (-230.026) (-230.881) * (-229.197) (-229.620) [-230.598] (-228.841) -- 0:00:38
377000 -- (-229.246) [-233.696] (-229.804) (-228.505) * (-228.082) (-230.305) (-234.533) [-228.424] -- 0:00:38
377500 -- (-230.838) [-229.110] (-229.737) (-230.261) * (-228.411) (-229.369) (-231.123) [-228.742] -- 0:00:37
378000 -- (-234.425) [-231.280] (-228.689) (-230.584) * (-228.762) (-232.701) [-228.527] (-228.408) -- 0:00:37
378500 -- (-233.045) (-229.134) (-229.948) [-228.791] * (-230.109) [-231.153] (-229.376) (-229.250) -- 0:00:37
379000 -- (-231.958) (-231.840) (-235.117) [-231.837] * (-232.733) (-231.856) (-229.318) [-228.787] -- 0:00:37
379500 -- (-233.901) (-235.599) (-232.160) [-234.654] * (-229.706) [-231.371] (-228.978) (-230.497) -- 0:00:37
380000 -- (-230.085) (-233.810) [-229.348] (-230.814) * (-230.760) [-230.069] (-229.854) (-233.288) -- 0:00:37
Average standard deviation of split frequencies: 0.008338
380500 -- (-232.383) [-231.995] (-228.172) (-229.056) * [-232.160] (-230.616) (-228.432) (-231.273) -- 0:00:37
381000 -- (-229.273) [-228.005] (-230.487) (-233.178) * (-230.515) [-230.923] (-232.153) (-231.028) -- 0:00:37
381500 -- (-229.280) [-230.136] (-229.171) (-233.871) * (-227.899) [-230.279] (-232.025) (-232.165) -- 0:00:37
382000 -- (-229.065) (-228.647) [-228.586] (-232.301) * [-228.260] (-233.498) (-232.046) (-228.839) -- 0:00:37
382500 -- (-229.355) [-228.593] (-228.576) (-230.602) * (-233.913) (-229.294) (-231.361) [-228.194] -- 0:00:37
383000 -- (-229.245) (-228.231) (-228.023) [-228.386] * (-235.418) (-228.135) [-233.655] (-234.128) -- 0:00:37
383500 -- [-228.578] (-232.250) (-228.913) (-228.550) * (-228.019) (-237.424) [-230.322] (-234.951) -- 0:00:36
384000 -- (-230.571) [-231.493] (-229.324) (-234.047) * [-228.298] (-232.674) (-232.562) (-230.652) -- 0:00:36
384500 -- (-229.351) (-232.088) [-229.282] (-234.206) * (-229.176) (-231.127) (-228.722) [-229.049] -- 0:00:36
385000 -- (-230.929) (-232.325) (-230.614) [-233.120] * [-229.645] (-229.449) (-230.157) (-230.738) -- 0:00:36
Average standard deviation of split frequencies: 0.008386
385500 -- (-228.020) [-231.819] (-228.189) (-231.895) * (-230.044) [-229.123] (-229.621) (-228.726) -- 0:00:36
386000 -- (-229.128) [-231.197] (-229.131) (-230.349) * (-228.322) (-230.202) [-230.909] (-228.526) -- 0:00:38
386500 -- [-229.888] (-230.948) (-229.055) (-229.454) * (-229.387) (-233.063) [-230.069] (-229.247) -- 0:00:38
387000 -- [-229.507] (-229.969) (-228.835) (-230.500) * (-227.818) (-230.791) (-229.434) [-231.024] -- 0:00:38
387500 -- (-232.193) (-228.602) [-230.648] (-228.813) * (-231.273) (-231.528) [-232.055] (-230.251) -- 0:00:37
388000 -- (-229.871) (-232.016) (-232.584) [-229.304] * (-229.015) [-231.945] (-228.984) (-229.007) -- 0:00:37
388500 -- [-229.025] (-228.867) (-230.799) (-229.443) * (-232.132) (-228.847) [-229.839] (-230.867) -- 0:00:37
389000 -- (-228.412) [-228.991] (-228.843) (-229.535) * [-228.276] (-229.622) (-233.780) (-234.396) -- 0:00:37
389500 -- (-229.813) [-229.021] (-232.899) (-228.060) * (-229.321) (-230.474) [-229.265] (-229.508) -- 0:00:37
390000 -- (-232.224) (-228.790) (-230.616) [-229.524] * (-234.505) [-230.293] (-230.565) (-230.227) -- 0:00:37
Average standard deviation of split frequencies: 0.007391
390500 -- (-230.713) [-228.726] (-231.711) (-230.688) * (-235.366) (-228.659) [-228.913] (-229.448) -- 0:00:37
391000 -- (-229.684) [-230.435] (-229.830) (-235.318) * (-233.749) (-230.795) (-228.889) [-228.961] -- 0:00:37
391500 -- (-232.605) [-228.065] (-228.860) (-229.137) * (-232.728) [-229.318] (-229.791) (-228.633) -- 0:00:37
392000 -- (-230.189) (-229.687) (-230.124) [-231.191] * (-228.458) [-230.737] (-228.978) (-228.451) -- 0:00:37
392500 -- [-230.950] (-229.581) (-236.856) (-230.787) * [-230.110] (-232.205) (-229.766) (-230.044) -- 0:00:37
393000 -- (-230.741) (-229.825) (-229.302) [-232.117] * (-231.285) (-228.602) [-231.565] (-233.070) -- 0:00:37
393500 -- (-231.424) (-230.093) [-231.000] (-230.875) * (-232.478) (-231.500) (-230.669) [-227.929] -- 0:00:36
394000 -- (-230.587) (-228.919) [-229.697] (-229.004) * (-232.286) (-229.499) [-229.645] (-231.363) -- 0:00:36
394500 -- [-229.035] (-228.518) (-230.521) (-232.634) * [-228.871] (-233.276) (-230.101) (-230.780) -- 0:00:36
395000 -- (-229.092) (-232.873) [-228.700] (-228.246) * [-230.249] (-229.265) (-233.313) (-229.529) -- 0:00:36
Average standard deviation of split frequencies: 0.006825
395500 -- [-229.790] (-230.165) (-228.349) (-229.698) * (-232.068) [-233.970] (-229.360) (-228.565) -- 0:00:36
396000 -- (-231.955) (-230.140) (-228.153) [-230.949] * (-231.668) (-232.160) [-231.305] (-228.851) -- 0:00:36
396500 -- [-229.123] (-228.870) (-230.848) (-232.801) * [-233.139] (-228.580) (-232.770) (-229.493) -- 0:00:36
397000 -- (-228.774) (-228.456) (-228.947) [-228.563] * (-229.577) (-229.984) (-238.362) [-233.138] -- 0:00:36
397500 -- (-228.585) (-232.299) [-230.196] (-230.848) * (-229.547) (-231.303) (-231.626) [-231.745] -- 0:00:36
398000 -- (-228.868) (-228.929) [-229.889] (-229.187) * (-228.220) [-229.006] (-231.193) (-228.882) -- 0:00:36
398500 -- (-230.631) (-229.220) (-228.698) [-232.171] * (-228.848) (-229.148) [-230.129] (-228.924) -- 0:00:36
399000 -- (-231.249) (-229.084) [-233.163] (-229.504) * [-228.354] (-228.507) (-233.114) (-236.689) -- 0:00:36
399500 -- [-228.614] (-230.325) (-230.910) (-232.993) * [-228.232] (-228.296) (-231.800) (-233.661) -- 0:00:36
400000 -- (-228.690) (-230.081) [-230.572] (-227.986) * (-229.876) (-227.954) (-231.399) [-230.266] -- 0:00:37
Average standard deviation of split frequencies: 0.007059
400500 -- (-227.899) (-233.334) [-228.451] (-230.492) * (-230.367) [-229.622] (-230.233) (-229.361) -- 0:00:37
401000 -- [-229.891] (-228.875) (-229.031) (-230.344) * (-233.050) (-230.723) [-232.120] (-230.357) -- 0:00:37
401500 -- (-231.983) (-234.337) (-231.426) [-229.488] * (-228.978) (-230.400) (-228.789) [-229.602] -- 0:00:37
402000 -- (-230.244) (-229.187) (-229.583) [-229.396] * (-229.206) (-230.013) [-229.689] (-228.317) -- 0:00:37
402500 -- [-230.003] (-231.850) (-228.512) (-228.536) * (-228.968) (-231.387) [-229.856] (-230.851) -- 0:00:37
403000 -- (-231.692) (-228.900) (-228.615) [-230.121] * (-231.661) (-231.186) (-229.289) [-232.558] -- 0:00:37
403500 -- [-233.320] (-231.689) (-231.741) (-231.067) * (-235.010) (-230.277) (-228.845) [-234.247] -- 0:00:36
404000 -- (-233.891) [-228.715] (-231.316) (-232.707) * (-230.541) (-231.655) (-228.547) [-232.206] -- 0:00:36
404500 -- (-230.220) [-230.439] (-230.466) (-229.774) * (-230.485) (-233.473) (-230.928) [-229.749] -- 0:00:36
405000 -- (-233.070) (-228.970) [-229.060] (-228.931) * (-230.636) (-231.547) (-237.064) [-230.362] -- 0:00:36
Average standard deviation of split frequencies: 0.007039
405500 -- [-229.613] (-230.803) (-229.696) (-228.034) * (-231.820) [-231.362] (-231.949) (-232.766) -- 0:00:36
406000 -- (-229.690) (-230.010) [-228.310] (-231.124) * (-233.206) (-228.872) [-228.519] (-228.845) -- 0:00:36
406500 -- (-230.791) (-231.890) (-231.956) [-229.603] * [-229.370] (-229.240) (-229.177) (-229.446) -- 0:00:36
407000 -- (-231.714) (-230.986) [-229.703] (-228.485) * (-230.509) (-230.656) [-230.704] (-228.971) -- 0:00:36
407500 -- (-232.154) [-229.992] (-229.111) (-234.531) * [-228.601] (-230.377) (-229.609) (-229.781) -- 0:00:36
408000 -- (-231.325) (-230.236) [-228.936] (-228.652) * (-228.272) (-232.238) (-230.929) [-232.482] -- 0:00:36
408500 -- (-229.040) (-229.702) (-230.920) [-230.300] * (-230.780) (-230.365) (-230.132) [-230.961] -- 0:00:36
409000 -- [-229.134] (-237.566) (-229.743) (-229.511) * (-232.272) [-227.930] (-234.080) (-228.998) -- 0:00:36
409500 -- (-228.465) (-229.220) [-229.093] (-230.937) * (-232.777) [-229.574] (-232.106) (-228.973) -- 0:00:36
410000 -- (-228.350) (-232.678) (-229.743) [-230.651] * [-231.628] (-229.186) (-229.252) (-230.416) -- 0:00:35
Average standard deviation of split frequencies: 0.007174
410500 -- (-231.551) (-232.510) [-229.861] (-233.681) * (-233.729) (-232.225) (-229.301) [-230.277] -- 0:00:35
411000 -- (-230.181) (-235.844) (-228.290) [-229.678] * (-231.109) (-230.375) [-229.850] (-232.477) -- 0:00:35
411500 -- (-234.644) (-229.071) (-230.163) [-232.230] * (-229.701) [-228.580] (-229.059) (-228.965) -- 0:00:35
412000 -- (-230.221) (-230.388) (-229.550) [-233.506] * (-228.569) [-230.045] (-230.141) (-230.823) -- 0:00:35
412500 -- (-230.249) (-233.776) (-230.040) [-229.808] * (-231.290) (-229.925) (-229.154) [-228.877] -- 0:00:35
413000 -- [-230.957] (-232.495) (-230.831) (-228.579) * (-230.940) (-230.358) (-228.787) [-230.756] -- 0:00:35
413500 -- (-228.418) (-230.852) [-228.893] (-231.145) * [-228.544] (-232.999) (-229.169) (-230.547) -- 0:00:35
414000 -- (-229.041) (-233.215) (-229.123) [-231.143] * (-229.105) (-231.735) [-229.977] (-229.057) -- 0:00:35
414500 -- (-229.101) (-232.366) [-228.992] (-230.374) * [-229.539] (-230.493) (-228.357) (-231.108) -- 0:00:35
415000 -- (-229.424) (-230.494) (-228.129) [-229.640] * (-230.926) (-233.094) [-228.186] (-229.647) -- 0:00:35
Average standard deviation of split frequencies: 0.007224
415500 -- [-228.499] (-230.027) (-232.057) (-229.537) * (-231.210) (-228.983) [-228.717] (-231.381) -- 0:00:36
416000 -- (-231.363) (-230.415) (-240.449) [-231.693] * (-229.504) (-230.022) (-230.188) [-233.038] -- 0:00:36
416500 -- (-234.207) [-231.406] (-230.732) (-231.083) * [-231.056] (-229.814) (-230.550) (-236.930) -- 0:00:36
417000 -- (-229.362) (-231.620) [-231.081] (-230.576) * (-228.653) [-229.864] (-230.948) (-231.803) -- 0:00:36
417500 -- [-228.022] (-228.994) (-229.400) (-232.161) * (-229.760) [-229.153] (-228.297) (-232.212) -- 0:00:36
418000 -- (-231.016) [-231.896] (-229.908) (-231.465) * (-228.553) [-232.559] (-228.527) (-230.711) -- 0:00:36
418500 -- [-231.571] (-229.519) (-230.219) (-229.887) * [-228.244] (-231.296) (-233.509) (-229.950) -- 0:00:36
419000 -- (-228.246) [-228.460] (-228.657) (-228.993) * (-231.369) (-232.918) [-228.966] (-231.588) -- 0:00:36
419500 -- [-231.256] (-228.413) (-232.100) (-228.032) * (-231.735) [-231.572] (-229.201) (-231.855) -- 0:00:35
420000 -- (-229.020) (-230.442) [-230.731] (-230.932) * [-231.292] (-230.588) (-228.757) (-230.693) -- 0:00:35
Average standard deviation of split frequencies: 0.007914
420500 -- [-230.332] (-228.594) (-230.053) (-232.662) * (-229.299) (-228.459) [-229.928] (-229.612) -- 0:00:35
421000 -- (-232.459) (-228.474) (-233.344) [-228.059] * (-230.903) (-233.423) (-228.155) [-229.343] -- 0:00:35
421500 -- [-235.008] (-228.883) (-232.360) (-229.127) * [-231.207] (-229.853) (-228.796) (-229.192) -- 0:00:35
422000 -- (-236.377) [-232.030] (-233.785) (-230.437) * (-229.918) [-233.561] (-228.902) (-229.727) -- 0:00:35
422500 -- (-228.936) (-231.297) (-230.893) [-230.939] * (-231.238) (-228.023) (-231.022) [-228.992] -- 0:00:35
423000 -- (-230.020) [-233.117] (-229.648) (-230.328) * (-232.114) [-227.880] (-230.154) (-235.679) -- 0:00:35
423500 -- (-229.121) (-232.171) [-227.894] (-228.609) * [-228.094] (-228.307) (-229.370) (-230.019) -- 0:00:35
424000 -- [-230.952] (-234.141) (-232.955) (-229.886) * (-228.190) (-228.792) [-228.829] (-229.965) -- 0:00:35
424500 -- [-230.832] (-229.465) (-230.713) (-229.554) * (-229.941) (-229.554) [-228.723] (-231.944) -- 0:00:35
425000 -- (-228.711) (-230.871) (-231.568) [-229.321] * [-229.647] (-230.628) (-231.127) (-232.932) -- 0:00:35
Average standard deviation of split frequencies: 0.008161
425500 -- [-229.455] (-233.004) (-230.814) (-232.264) * (-228.373) (-228.944) (-230.668) [-231.235] -- 0:00:35
426000 -- (-230.852) (-231.388) [-230.712] (-229.480) * (-228.713) (-235.857) (-229.961) [-229.142] -- 0:00:35
426500 -- (-230.997) [-230.103] (-230.422) (-233.140) * [-230.990] (-229.205) (-229.342) (-231.036) -- 0:00:34
427000 -- [-230.064] (-230.418) (-228.573) (-232.193) * (-229.336) (-230.681) (-231.748) [-230.283] -- 0:00:34
427500 -- (-232.600) (-231.434) [-229.974] (-230.498) * (-228.736) (-228.593) (-230.251) [-228.466] -- 0:00:34
428000 -- (-229.639) (-231.559) [-230.902] (-231.707) * [-232.314] (-228.944) (-228.668) (-228.773) -- 0:00:34
428500 -- [-228.855] (-228.829) (-229.629) (-230.186) * (-230.846) (-234.357) [-229.652] (-229.411) -- 0:00:34
429000 -- (-228.687) (-230.168) [-229.938] (-229.339) * (-229.681) (-233.215) [-229.230] (-231.200) -- 0:00:34
429500 -- [-229.909] (-229.081) (-233.006) (-229.687) * (-229.163) [-230.711] (-229.777) (-234.192) -- 0:00:34
430000 -- (-229.629) (-231.765) (-231.102) [-228.242] * (-229.323) (-229.278) [-229.135] (-229.571) -- 0:00:34
Average standard deviation of split frequencies: 0.007867
430500 -- (-234.128) (-232.045) (-233.465) [-228.831] * (-228.732) (-229.241) [-228.648] (-230.099) -- 0:00:34
431000 -- (-230.930) [-230.257] (-230.936) (-232.556) * (-229.719) (-228.556) [-230.185] (-229.398) -- 0:00:34
431500 -- [-229.374] (-230.277) (-229.699) (-230.380) * (-228.829) [-229.309] (-228.401) (-229.868) -- 0:00:34
432000 -- (-229.124) (-230.578) (-229.286) [-228.693] * (-230.060) (-229.461) (-231.031) [-229.303] -- 0:00:35
432500 -- (-231.921) (-230.267) [-230.193] (-228.579) * [-229.102] (-229.836) (-229.065) (-232.676) -- 0:00:35
433000 -- (-229.651) [-229.964] (-228.745) (-229.449) * (-230.561) (-230.218) [-229.612] (-231.360) -- 0:00:35
433500 -- (-231.012) [-232.479] (-230.974) (-232.424) * (-230.946) (-227.895) [-231.966] (-235.460) -- 0:00:35
434000 -- (-230.234) (-231.839) (-228.294) [-229.363] * (-240.108) (-229.294) [-234.585] (-232.541) -- 0:00:35
434500 -- [-229.233] (-228.387) (-229.608) (-231.216) * [-229.647] (-228.777) (-228.712) (-230.938) -- 0:00:35
435000 -- (-229.029) (-228.545) [-231.112] (-230.176) * (-228.934) (-231.863) (-228.423) [-230.710] -- 0:00:35
Average standard deviation of split frequencies: 0.007636
435500 -- (-229.464) [-229.001] (-230.752) (-229.815) * (-231.060) (-232.726) [-230.307] (-229.807) -- 0:00:34
436000 -- (-228.975) [-233.363] (-231.583) (-229.474) * (-230.545) (-229.818) (-228.569) [-231.359] -- 0:00:34
436500 -- (-229.484) (-232.369) (-230.019) [-234.633] * (-231.768) (-230.047) (-228.955) [-228.927] -- 0:00:34
437000 -- (-230.035) (-230.805) [-230.188] (-229.319) * (-231.151) (-232.674) (-228.372) [-231.055] -- 0:00:34
437500 -- (-228.660) (-230.286) (-228.020) [-230.093] * (-230.316) (-232.036) [-228.488] (-231.847) -- 0:00:34
438000 -- (-230.292) (-229.874) [-231.247] (-229.344) * (-230.245) (-231.940) [-229.089] (-229.795) -- 0:00:34
438500 -- (-229.015) (-230.152) (-229.435) [-228.491] * (-228.270) (-229.470) [-231.080] (-231.653) -- 0:00:34
439000 -- (-231.647) (-232.185) [-232.601] (-230.362) * (-229.983) (-232.841) [-229.846] (-230.128) -- 0:00:34
439500 -- (-231.566) [-228.945] (-229.528) (-231.741) * [-230.953] (-231.491) (-229.532) (-233.796) -- 0:00:34
440000 -- (-232.087) (-230.506) (-231.354) [-229.856] * (-231.698) (-232.607) [-229.383] (-228.962) -- 0:00:34
Average standard deviation of split frequencies: 0.007488
440500 -- (-236.039) [-230.981] (-233.204) (-230.078) * (-229.701) [-230.504] (-230.121) (-228.546) -- 0:00:34
441000 -- (-231.975) [-229.066] (-231.265) (-228.399) * (-232.798) (-238.030) [-230.368] (-230.122) -- 0:00:34
441500 -- (-230.279) [-229.584] (-228.450) (-229.077) * (-228.555) (-231.865) [-228.690] (-231.737) -- 0:00:34
442000 -- (-228.696) (-231.556) (-232.335) [-230.799] * [-229.053] (-231.765) (-229.732) (-228.407) -- 0:00:34
442500 -- (-228.155) (-230.128) (-230.992) [-230.264] * (-229.947) (-229.450) (-231.256) [-228.515] -- 0:00:34
443000 -- (-227.889) (-231.941) (-229.989) [-228.458] * [-228.596] (-228.336) (-230.174) (-231.416) -- 0:00:33
443500 -- (-229.031) (-232.890) (-229.600) [-229.051] * (-228.978) (-228.885) (-231.941) [-232.375] -- 0:00:33
444000 -- [-230.501] (-229.790) (-229.873) (-229.395) * (-232.613) (-228.890) [-230.132] (-232.610) -- 0:00:33
444500 -- [-230.181] (-228.688) (-228.914) (-228.961) * (-231.774) (-230.332) [-229.966] (-228.980) -- 0:00:33
445000 -- [-229.767] (-230.540) (-232.424) (-228.337) * (-229.936) (-229.392) [-230.865] (-229.659) -- 0:00:33
Average standard deviation of split frequencies: 0.007647
445500 -- [-231.391] (-230.090) (-228.742) (-228.201) * (-232.866) (-228.921) [-229.408] (-228.809) -- 0:00:33
446000 -- (-232.690) (-233.970) [-228.650] (-229.909) * [-230.428] (-228.444) (-231.479) (-232.580) -- 0:00:33
446500 -- (-229.298) [-231.711] (-236.175) (-229.116) * [-229.548] (-230.212) (-232.073) (-229.453) -- 0:00:33
447000 -- [-231.318] (-229.416) (-236.263) (-230.580) * (-232.958) (-231.123) [-228.535] (-228.223) -- 0:00:33
447500 -- [-232.473] (-231.397) (-230.198) (-229.358) * (-228.110) (-231.823) (-229.560) [-229.857] -- 0:00:33
448000 -- [-230.444] (-232.904) (-229.570) (-229.447) * [-228.899] (-230.274) (-230.436) (-229.865) -- 0:00:33
448500 -- (-232.441) (-231.423) (-230.905) [-229.232] * (-232.256) (-229.837) [-229.345] (-229.823) -- 0:00:33
449000 -- (-228.471) (-231.357) (-228.159) [-234.172] * (-232.652) (-230.272) [-228.811] (-228.418) -- 0:00:34
449500 -- [-228.716] (-230.651) (-234.235) (-229.024) * (-232.057) (-229.188) (-232.062) [-230.088] -- 0:00:34
450000 -- (-228.057) (-231.087) [-230.728] (-228.441) * (-229.269) (-228.931) (-229.880) [-229.946] -- 0:00:34
Average standard deviation of split frequencies: 0.007876
450500 -- (-232.372) (-229.628) (-231.355) [-233.199] * (-230.176) (-233.613) (-229.073) [-232.232] -- 0:00:34
451000 -- (-229.638) (-228.520) (-229.500) [-229.436] * (-230.266) (-229.732) (-231.785) [-231.975] -- 0:00:34
451500 -- [-230.428] (-237.509) (-228.585) (-230.406) * (-228.898) (-228.861) (-235.372) [-229.494] -- 0:00:34
452000 -- (-232.900) [-234.900] (-229.102) (-235.028) * (-231.660) (-229.427) (-231.629) [-233.039] -- 0:00:33
452500 -- (-231.257) (-233.064) [-230.467] (-230.862) * (-229.836) [-228.382] (-232.724) (-231.963) -- 0:00:33
453000 -- (-230.399) [-228.943] (-233.209) (-233.766) * (-232.629) (-230.517) (-229.876) [-228.974] -- 0:00:33
453500 -- (-231.784) (-229.693) (-236.682) [-229.109] * (-230.816) (-229.719) [-229.828] (-230.507) -- 0:00:33
454000 -- (-230.897) (-228.819) [-233.839] (-230.567) * (-232.173) (-236.186) [-228.318] (-231.234) -- 0:00:33
454500 -- (-229.773) [-231.543] (-229.774) (-231.324) * (-234.718) [-232.365] (-231.141) (-228.373) -- 0:00:33
455000 -- (-229.634) [-228.930] (-229.060) (-230.631) * (-230.439) [-230.331] (-231.486) (-230.994) -- 0:00:33
Average standard deviation of split frequencies: 0.008270
455500 -- (-230.368) (-228.907) [-228.335] (-232.483) * (-234.146) [-228.490] (-232.766) (-230.162) -- 0:00:33
456000 -- (-230.890) (-229.286) [-229.596] (-230.322) * (-229.915) (-228.113) (-228.056) [-233.513] -- 0:00:33
456500 -- (-228.808) (-233.278) [-230.523] (-231.548) * [-230.881] (-230.036) (-231.215) (-233.346) -- 0:00:33
457000 -- [-231.597] (-231.593) (-233.229) (-229.749) * (-231.349) [-229.078] (-228.859) (-234.023) -- 0:00:33
457500 -- (-230.226) [-233.300] (-234.972) (-230.996) * (-231.784) (-228.950) (-230.450) [-230.850] -- 0:00:33
458000 -- (-228.923) [-230.805] (-229.932) (-231.748) * (-231.745) (-233.299) [-228.473] (-229.383) -- 0:00:33
458500 -- (-229.723) (-229.214) [-228.875] (-230.488) * [-228.160] (-228.938) (-231.416) (-228.993) -- 0:00:33
459000 -- (-228.705) (-230.222) (-230.250) [-231.585] * (-229.622) (-232.901) (-230.887) [-230.124] -- 0:00:33
459500 -- (-230.423) (-230.259) (-232.578) [-234.943] * (-229.207) [-228.122] (-232.610) (-234.353) -- 0:00:32
460000 -- (-232.662) (-236.249) (-231.819) [-230.668] * (-230.724) (-228.657) [-229.689] (-233.973) -- 0:00:32
Average standard deviation of split frequencies: 0.008126
460500 -- (-230.512) (-233.369) [-231.828] (-231.708) * (-230.616) (-230.767) [-228.618] (-229.355) -- 0:00:32
461000 -- (-231.752) [-228.256] (-229.885) (-229.712) * (-231.598) (-229.547) (-230.491) [-229.152] -- 0:00:32
461500 -- (-228.655) (-233.501) [-230.812] (-231.238) * (-228.861) [-230.060] (-233.168) (-229.773) -- 0:00:32
462000 -- (-231.232) [-233.483] (-229.156) (-229.598) * (-230.793) (-230.270) (-231.760) [-228.593] -- 0:00:32
462500 -- (-233.743) [-231.489] (-228.655) (-228.324) * (-228.405) [-229.965] (-229.203) (-228.864) -- 0:00:32
463000 -- (-230.159) [-228.372] (-232.074) (-228.534) * (-230.818) [-234.574] (-231.069) (-230.673) -- 0:00:32
463500 -- (-229.052) (-228.929) (-229.832) [-228.485] * [-230.030] (-234.045) (-231.004) (-230.155) -- 0:00:32
464000 -- (-234.201) (-229.511) (-230.338) [-229.223] * (-231.654) (-234.421) (-230.335) [-229.418] -- 0:00:32
464500 -- (-231.045) (-229.973) [-231.038] (-229.652) * (-229.143) (-230.519) (-231.194) [-229.886] -- 0:00:32
465000 -- (-232.145) (-231.069) (-229.301) [-231.419] * (-231.453) (-231.248) [-228.796] (-229.797) -- 0:00:32
Average standard deviation of split frequencies: 0.007438
465500 -- (-237.257) [-229.474] (-231.231) (-229.570) * (-234.160) [-230.148] (-230.764) (-228.937) -- 0:00:33
466000 -- (-230.273) [-229.439] (-231.377) (-229.251) * (-235.694) (-230.772) [-237.508] (-232.404) -- 0:00:33
466500 -- (-231.167) (-231.487) [-230.158] (-229.733) * (-235.076) (-234.229) [-229.166] (-229.465) -- 0:00:33
467000 -- (-233.460) [-234.070] (-230.655) (-228.881) * (-228.518) (-228.939) (-231.193) [-230.858] -- 0:00:33
467500 -- [-230.575] (-236.416) (-229.405) (-230.357) * (-228.767) (-229.169) (-230.515) [-228.958] -- 0:00:33
468000 -- (-230.874) [-232.484] (-233.618) (-230.683) * (-230.476) (-229.242) (-237.627) [-230.310] -- 0:00:32
468500 -- (-237.231) (-229.469) (-229.435) [-231.443] * [-232.476] (-232.426) (-229.910) (-229.485) -- 0:00:32
469000 -- (-232.382) [-231.133] (-229.004) (-232.374) * (-231.878) (-232.865) (-228.177) [-229.706] -- 0:00:32
469500 -- [-231.107] (-231.799) (-231.791) (-228.759) * [-233.348] (-228.149) (-231.238) (-235.498) -- 0:00:32
470000 -- (-228.878) (-233.000) (-233.038) [-228.924] * (-232.343) (-230.511) [-229.380] (-230.787) -- 0:00:32
Average standard deviation of split frequencies: 0.007541
470500 -- [-228.898] (-231.618) (-232.080) (-232.880) * (-232.673) (-229.039) (-228.488) [-229.804] -- 0:00:32
471000 -- (-229.661) (-233.842) (-228.240) [-228.811] * (-233.461) (-228.374) [-230.654] (-231.096) -- 0:00:32
471500 -- (-230.416) (-233.679) [-230.402] (-229.012) * (-228.799) (-228.761) [-228.751] (-229.233) -- 0:00:32
472000 -- [-229.108] (-233.057) (-231.726) (-229.610) * (-234.031) (-228.123) [-229.599] (-230.742) -- 0:00:32
472500 -- (-232.227) (-229.620) (-230.168) [-229.417] * (-234.315) (-228.947) (-229.099) [-229.799] -- 0:00:32
473000 -- (-228.443) (-230.849) (-230.172) [-231.449] * (-232.012) (-232.647) (-230.279) [-229.641] -- 0:00:32
473500 -- [-229.254] (-230.349) (-232.010) (-230.312) * (-232.094) (-230.134) (-232.629) [-230.010] -- 0:00:32
474000 -- (-228.047) [-232.243] (-230.144) (-233.345) * [-229.433] (-231.171) (-234.437) (-229.031) -- 0:00:32
474500 -- (-230.017) (-230.381) [-228.874] (-233.804) * (-229.824) [-228.859] (-231.336) (-230.489) -- 0:00:32
475000 -- (-228.102) (-228.042) (-229.180) [-228.289] * [-228.625] (-231.241) (-230.835) (-228.405) -- 0:00:32
Average standard deviation of split frequencies: 0.007165
475500 -- [-228.672] (-229.194) (-229.325) (-231.271) * [-229.258] (-229.638) (-229.284) (-229.756) -- 0:00:31
476000 -- (-229.751) [-230.921] (-234.372) (-230.496) * [-228.830] (-237.033) (-228.439) (-228.912) -- 0:00:31
476500 -- (-230.055) (-232.646) [-233.654] (-233.707) * [-230.787] (-233.559) (-228.928) (-232.120) -- 0:00:31
477000 -- (-231.495) [-232.386] (-229.896) (-230.900) * (-231.108) [-229.354] (-231.206) (-233.130) -- 0:00:31
477500 -- (-232.253) (-229.292) [-230.582] (-233.362) * (-232.275) (-229.769) (-232.148) [-230.599] -- 0:00:31
478000 -- (-230.077) (-232.065) [-228.849] (-231.856) * (-229.516) [-227.723] (-228.003) (-230.440) -- 0:00:31
478500 -- [-229.098] (-231.744) (-229.343) (-229.816) * (-231.664) [-231.526] (-232.672) (-233.780) -- 0:00:31
479000 -- (-229.517) [-229.305] (-230.542) (-228.890) * (-233.868) (-230.519) [-232.779] (-230.594) -- 0:00:31
479500 -- (-228.591) [-229.594] (-230.309) (-229.005) * [-228.798] (-229.244) (-231.204) (-232.718) -- 0:00:31
480000 -- (-229.937) (-228.905) [-232.652] (-230.481) * (-229.267) [-232.794] (-231.576) (-233.800) -- 0:00:31
Average standard deviation of split frequencies: 0.007955
480500 -- (-231.466) (-230.328) [-229.209] (-230.463) * (-231.964) (-228.377) (-233.828) [-230.813] -- 0:00:31
481000 -- (-230.420) (-233.265) (-228.922) [-232.210] * (-231.226) (-229.188) [-231.540] (-229.584) -- 0:00:31
481500 -- [-229.687] (-231.495) (-228.141) (-230.424) * (-229.838) (-235.359) (-229.952) [-230.028] -- 0:00:31
482000 -- (-234.371) (-231.287) [-228.304] (-231.094) * [-229.496] (-230.048) (-229.345) (-230.367) -- 0:00:32
482500 -- [-235.900] (-230.754) (-228.924) (-229.332) * (-228.645) (-231.923) [-229.037] (-230.841) -- 0:00:32
483000 -- (-230.638) [-234.596] (-229.416) (-232.102) * (-229.491) (-235.677) [-230.813] (-231.416) -- 0:00:32
483500 -- (-229.666) [-233.564] (-232.459) (-230.094) * (-233.674) (-230.526) (-231.724) [-231.048] -- 0:00:32
484000 -- (-232.272) (-233.508) [-229.246] (-228.999) * (-229.998) [-228.350] (-230.106) (-228.850) -- 0:00:31
484500 -- (-232.857) (-230.030) (-229.776) [-230.426] * (-229.589) (-230.327) [-232.985] (-229.699) -- 0:00:31
485000 -- (-229.944) [-231.119] (-230.153) (-230.823) * (-231.812) (-229.915) (-229.133) [-229.979] -- 0:00:31
Average standard deviation of split frequencies: 0.008406
485500 -- (-233.159) [-234.061] (-230.295) (-228.743) * (-229.881) (-228.922) (-229.372) [-230.196] -- 0:00:31
486000 -- (-235.278) [-230.797] (-230.308) (-232.337) * [-229.430] (-228.829) (-229.223) (-232.386) -- 0:00:31
486500 -- [-232.832] (-231.598) (-230.288) (-234.198) * [-229.515] (-228.274) (-227.909) (-233.629) -- 0:00:31
487000 -- [-228.505] (-231.641) (-231.953) (-236.468) * (-228.861) (-230.516) [-228.772] (-230.808) -- 0:00:31
487500 -- (-228.318) (-228.726) (-230.912) [-233.991] * [-230.173] (-232.856) (-230.579) (-229.760) -- 0:00:31
488000 -- (-229.405) (-230.296) (-229.338) [-229.741] * (-229.715) (-230.407) (-230.927) [-229.086] -- 0:00:31
488500 -- (-230.208) (-228.463) [-232.900] (-230.066) * (-229.703) [-234.351] (-230.868) (-228.296) -- 0:00:31
489000 -- (-230.042) [-228.752] (-229.358) (-229.881) * (-229.841) (-231.436) (-236.980) [-229.067] -- 0:00:31
489500 -- (-228.811) (-228.959) [-230.999] (-231.567) * (-229.275) [-232.894] (-231.177) (-231.229) -- 0:00:31
490000 -- [-228.106] (-229.887) (-229.523) (-233.934) * (-233.727) (-234.788) [-231.527] (-231.050) -- 0:00:31
Average standard deviation of split frequencies: 0.008006
490500 -- (-229.540) (-229.070) [-228.645] (-234.233) * (-228.184) (-233.667) [-231.339] (-231.456) -- 0:00:31
491000 -- (-232.085) (-228.297) [-229.351] (-231.905) * [-229.534] (-234.366) (-230.128) (-233.441) -- 0:00:31
491500 -- (-228.712) [-230.368] (-230.502) (-228.857) * (-229.001) (-233.897) (-228.231) [-232.345] -- 0:00:31
492000 -- (-229.789) [-228.057] (-231.517) (-229.158) * (-229.589) [-230.500] (-229.441) (-230.426) -- 0:00:30
492500 -- (-231.772) (-227.925) (-232.378) [-228.454] * (-228.640) (-230.874) (-232.459) [-231.131] -- 0:00:30
493000 -- [-228.417] (-229.881) (-229.660) (-229.950) * [-230.510] (-232.032) (-228.181) (-229.802) -- 0:00:30
493500 -- (-231.795) (-233.556) [-230.052] (-231.440) * (-228.548) (-230.731) [-230.228] (-231.722) -- 0:00:30
494000 -- (-230.844) (-232.143) [-228.901] (-230.340) * (-229.705) [-230.217] (-231.953) (-231.854) -- 0:00:30
494500 -- (-228.410) (-231.876) (-228.159) [-229.998] * [-227.961] (-229.983) (-231.449) (-230.737) -- 0:00:30
495000 -- (-231.515) (-229.244) [-230.034] (-230.680) * (-229.508) [-230.760] (-230.808) (-231.711) -- 0:00:30
Average standard deviation of split frequencies: 0.007920
495500 -- (-234.170) (-228.541) [-231.464] (-231.808) * (-228.266) (-231.834) (-232.832) [-230.346] -- 0:00:30
496000 -- (-230.746) (-230.404) [-230.258] (-233.302) * (-228.763) [-230.660] (-232.205) (-229.051) -- 0:00:30
496500 -- (-228.155) (-233.439) (-229.770) [-230.427] * [-229.658] (-228.701) (-230.365) (-228.344) -- 0:00:30
497000 -- (-229.590) [-230.481] (-229.253) (-228.934) * (-229.857) [-229.616] (-228.859) (-229.363) -- 0:00:30
497500 -- (-231.464) (-231.697) (-230.624) [-228.943] * (-235.852) (-232.788) (-228.891) [-228.642] -- 0:00:31
498000 -- (-230.803) [-230.565] (-231.388) (-231.305) * (-231.093) (-233.197) (-231.377) [-228.813] -- 0:00:31
498500 -- (-229.772) (-231.719) [-233.715] (-230.291) * (-230.489) [-229.298] (-228.972) (-228.725) -- 0:00:31
499000 -- (-233.352) (-230.575) [-233.080] (-229.855) * [-231.799] (-233.092) (-232.929) (-230.226) -- 0:00:31
499500 -- (-230.426) (-229.157) (-232.479) [-229.101] * (-231.732) (-230.361) (-233.347) [-229.847] -- 0:00:31
500000 -- (-228.443) (-228.689) [-229.651] (-228.997) * (-232.612) (-231.531) [-229.425] (-229.540) -- 0:00:31
Average standard deviation of split frequencies: 0.008003
500500 -- (-230.425) (-231.516) [-229.238] (-230.921) * (-231.207) [-233.651] (-230.371) (-229.361) -- 0:00:30
501000 -- (-229.694) [-228.344] (-233.237) (-231.365) * (-230.934) (-231.443) (-229.812) [-231.362] -- 0:00:30
501500 -- [-229.533] (-231.464) (-232.272) (-231.043) * (-229.955) (-233.159) (-232.460) [-228.368] -- 0:00:30
502000 -- (-230.225) (-233.852) (-233.544) [-231.374] * (-229.949) (-229.017) [-228.916] (-228.998) -- 0:00:30
502500 -- (-229.015) (-232.234) [-230.390] (-231.595) * (-233.783) (-234.619) [-230.342] (-233.256) -- 0:00:30
503000 -- (-230.696) (-229.782) [-230.371] (-229.586) * (-229.575) (-228.212) [-229.898] (-239.738) -- 0:00:30
503500 -- [-229.741] (-231.364) (-230.806) (-232.390) * [-230.420] (-229.469) (-230.796) (-229.103) -- 0:00:30
504000 -- (-230.359) (-229.630) (-233.403) [-229.417] * (-233.762) [-230.551] (-230.291) (-228.015) -- 0:00:30
504500 -- (-231.517) (-228.903) [-228.949] (-233.230) * [-228.838] (-230.834) (-232.549) (-228.841) -- 0:00:30
505000 -- [-229.943] (-229.231) (-228.353) (-230.014) * (-232.316) [-229.408] (-228.437) (-232.217) -- 0:00:30
Average standard deviation of split frequencies: 0.007971
505500 -- [-231.085] (-232.370) (-230.620) (-230.376) * (-232.409) [-228.470] (-235.186) (-228.183) -- 0:00:30
506000 -- (-229.985) (-233.637) (-238.890) [-234.567] * (-231.638) (-229.328) (-235.013) [-229.025] -- 0:00:30
506500 -- (-229.889) (-230.306) (-239.653) [-231.789] * (-230.587) [-230.047] (-231.737) (-229.594) -- 0:00:30
507000 -- [-228.943] (-229.463) (-230.334) (-230.086) * (-230.122) [-228.510] (-230.413) (-231.816) -- 0:00:30
507500 -- (-231.145) [-229.003] (-229.248) (-229.236) * (-229.806) (-228.504) (-231.002) [-231.828] -- 0:00:30
508000 -- (-231.444) (-228.157) (-231.498) [-229.836] * (-229.715) (-233.500) [-230.817] (-230.924) -- 0:00:30
508500 -- (-231.105) (-228.723) (-228.984) [-228.623] * [-230.502] (-228.869) (-230.459) (-230.254) -- 0:00:29
509000 -- (-230.999) [-229.963] (-232.776) (-228.435) * (-231.595) [-229.121] (-232.730) (-230.327) -- 0:00:29
509500 -- (-229.503) (-236.579) [-229.120] (-229.127) * (-229.471) [-231.810] (-232.252) (-230.664) -- 0:00:29
510000 -- (-230.539) (-229.412) [-229.128] (-233.508) * (-233.495) (-229.282) (-231.968) [-230.019] -- 0:00:29
Average standard deviation of split frequencies: 0.008154
510500 -- [-231.838] (-233.130) (-229.166) (-231.690) * (-229.221) [-229.032] (-228.956) (-228.867) -- 0:00:29
511000 -- [-231.937] (-231.059) (-230.599) (-228.672) * (-228.196) (-228.352) (-231.383) [-228.779] -- 0:00:29
511500 -- (-230.963) (-229.345) (-231.781) [-230.411] * (-230.316) (-229.373) [-229.970] (-229.163) -- 0:00:29
512000 -- (-229.174) (-228.460) (-229.313) [-231.226] * (-230.665) (-233.680) (-231.342) [-230.088] -- 0:00:29
512500 -- (-229.445) (-230.560) (-229.007) [-233.001] * [-228.774] (-235.452) (-233.454) (-229.305) -- 0:00:30
513000 -- (-234.363) [-232.170] (-228.363) (-230.853) * [-231.056] (-232.426) (-229.526) (-229.325) -- 0:00:30
513500 -- (-230.718) (-235.343) [-228.880] (-229.987) * (-230.450) (-230.292) [-230.835] (-229.637) -- 0:00:30
514000 -- [-232.124] (-232.427) (-228.903) (-230.348) * (-232.360) [-229.317] (-232.773) (-230.630) -- 0:00:30
514500 -- (-230.884) (-230.261) [-228.622] (-229.585) * (-228.306) (-232.416) (-229.853) [-233.267] -- 0:00:30
515000 -- (-230.700) (-231.342) [-231.871] (-228.799) * (-228.524) (-230.383) (-229.660) [-230.123] -- 0:00:30
Average standard deviation of split frequencies: 0.008070
515500 -- (-231.380) (-231.057) (-230.230) [-229.172] * (-228.512) (-232.014) (-231.610) [-228.602] -- 0:00:30
516000 -- (-233.444) (-229.664) [-228.310] (-230.020) * (-231.367) (-229.334) [-232.280] (-231.174) -- 0:00:30
516500 -- (-232.283) (-228.430) (-229.797) [-230.800] * (-234.901) (-230.054) (-229.720) [-228.275] -- 0:00:29
517000 -- (-231.712) (-230.541) (-235.708) [-231.005] * (-233.010) [-229.201] (-229.936) (-236.257) -- 0:00:29
517500 -- (-231.002) (-229.385) (-229.924) [-230.228] * [-230.690] (-229.929) (-231.670) (-231.968) -- 0:00:29
518000 -- [-231.764] (-232.265) (-233.996) (-230.974) * (-231.426) [-230.275] (-232.511) (-228.925) -- 0:00:29
518500 -- (-229.266) (-232.910) [-230.316] (-234.680) * (-232.379) [-229.371] (-232.716) (-228.940) -- 0:00:29
519000 -- (-228.960) (-230.312) [-229.641] (-229.813) * (-233.784) [-228.551] (-238.032) (-228.147) -- 0:00:29
519500 -- (-229.697) [-230.619] (-232.283) (-231.294) * [-230.653] (-229.214) (-239.556) (-229.244) -- 0:00:29
520000 -- (-228.749) [-233.513] (-230.069) (-231.092) * (-231.948) (-229.608) [-230.514] (-229.379) -- 0:00:29
Average standard deviation of split frequencies: 0.008299
520500 -- (-228.770) [-229.673] (-230.774) (-228.544) * (-231.766) [-231.147] (-228.947) (-229.311) -- 0:00:29
521000 -- [-232.078] (-229.571) (-230.391) (-230.603) * (-229.661) (-230.976) [-229.315] (-228.676) -- 0:00:29
521500 -- [-230.241] (-231.471) (-234.138) (-230.601) * [-229.455] (-231.376) (-230.115) (-231.067) -- 0:00:29
522000 -- (-235.691) (-230.980) (-228.765) [-228.999] * (-230.386) (-231.334) [-228.809] (-230.691) -- 0:00:29
522500 -- (-229.740) [-232.725] (-228.240) (-228.866) * (-228.579) [-230.897] (-229.967) (-230.681) -- 0:00:29
523000 -- [-229.846] (-234.748) (-230.573) (-229.056) * (-231.320) [-232.590] (-234.697) (-232.026) -- 0:00:29
523500 -- (-232.603) (-235.133) [-231.985] (-230.495) * (-229.993) (-228.780) [-229.685] (-229.292) -- 0:00:29
524000 -- [-231.477] (-234.828) (-230.841) (-230.377) * (-231.101) [-230.684] (-230.378) (-228.534) -- 0:00:29
524500 -- [-230.954] (-230.592) (-231.840) (-231.040) * [-230.808] (-230.276) (-229.476) (-229.717) -- 0:00:29
525000 -- [-229.813] (-230.150) (-233.255) (-231.367) * (-228.983) (-228.612) [-229.209] (-231.208) -- 0:00:28
Average standard deviation of split frequencies: 0.007966
525500 -- (-228.651) [-230.822] (-232.148) (-232.189) * [-230.836] (-231.248) (-228.581) (-230.277) -- 0:00:28
526000 -- (-230.080) [-230.238] (-233.793) (-230.089) * (-229.912) (-228.704) [-230.627] (-228.768) -- 0:00:28
526500 -- (-232.715) (-229.329) [-231.467] (-231.452) * (-229.549) (-229.488) [-229.417] (-234.291) -- 0:00:29
527000 -- (-228.975) (-230.083) (-229.674) [-229.163] * [-228.209] (-233.039) (-230.340) (-231.359) -- 0:00:29
527500 -- (-230.802) (-229.558) (-230.686) [-231.703] * (-228.513) (-231.410) [-229.314] (-229.124) -- 0:00:29
528000 -- (-228.739) (-231.734) (-232.802) [-229.103] * [-229.424] (-231.801) (-231.700) (-231.735) -- 0:00:29
528500 -- (-228.859) (-233.433) (-233.762) [-229.834] * (-230.443) (-232.862) [-229.994] (-229.616) -- 0:00:29
529000 -- [-228.687] (-231.784) (-233.604) (-235.391) * (-228.834) (-232.549) (-228.910) [-228.424] -- 0:00:29
529500 -- [-227.958] (-232.368) (-231.093) (-236.129) * (-229.822) (-230.453) (-227.999) [-228.561] -- 0:00:29
530000 -- [-228.039] (-231.192) (-230.550) (-228.675) * (-233.974) (-231.516) [-229.756] (-230.804) -- 0:00:29
Average standard deviation of split frequencies: 0.007995
530500 -- (-230.981) [-229.788] (-231.579) (-229.046) * (-234.002) [-232.096] (-233.804) (-228.965) -- 0:00:29
531000 -- [-230.425] (-233.170) (-233.393) (-229.336) * (-233.686) (-228.543) [-229.918] (-234.040) -- 0:00:29
531500 -- [-231.194] (-228.711) (-230.063) (-228.710) * (-230.511) (-229.522) [-235.009] (-233.443) -- 0:00:29
532000 -- (-228.153) [-229.030] (-232.781) (-231.170) * (-229.891) (-229.013) [-229.760] (-229.321) -- 0:00:29
532500 -- (-230.576) (-228.314) [-230.377] (-231.588) * (-232.323) (-229.138) [-230.509] (-235.865) -- 0:00:28
533000 -- (-229.280) [-229.350] (-229.939) (-229.004) * (-229.550) [-231.288] (-231.552) (-238.112) -- 0:00:28
533500 -- (-227.986) (-229.306) (-228.518) [-228.028] * [-229.513] (-228.035) (-229.979) (-232.520) -- 0:00:28
534000 -- [-229.377] (-232.127) (-228.800) (-229.252) * [-229.894] (-229.234) (-230.070) (-228.742) -- 0:00:28
534500 -- (-230.316) (-230.096) (-229.784) [-232.220] * [-229.514] (-231.950) (-231.616) (-228.537) -- 0:00:28
535000 -- (-232.089) [-228.228] (-231.117) (-234.118) * [-229.509] (-229.314) (-230.378) (-228.557) -- 0:00:28
Average standard deviation of split frequencies: 0.008062
535500 -- (-231.134) (-228.104) [-228.186] (-232.180) * [-232.113] (-230.328) (-231.085) (-229.281) -- 0:00:28
536000 -- (-230.299) (-232.443) (-228.944) [-231.740] * (-228.523) [-229.665] (-228.458) (-231.696) -- 0:00:28
536500 -- [-232.870] (-229.177) (-228.754) (-232.604) * (-228.937) [-229.168] (-228.418) (-227.945) -- 0:00:28
537000 -- (-229.762) (-229.986) [-232.355] (-230.460) * (-233.314) (-229.096) (-233.576) [-230.601] -- 0:00:28
537500 -- [-229.759] (-231.127) (-229.514) (-239.600) * (-229.687) (-230.289) (-235.484) [-228.412] -- 0:00:28
538000 -- [-231.082] (-228.346) (-229.796) (-235.891) * [-231.014] (-230.966) (-233.184) (-228.417) -- 0:00:28
538500 -- (-231.508) (-229.197) (-229.442) [-229.703] * [-228.062] (-230.859) (-236.121) (-228.822) -- 0:00:28
539000 -- (-231.085) (-234.458) [-231.855] (-228.590) * (-235.549) [-229.659] (-229.053) (-229.897) -- 0:00:28
539500 -- (-229.114) [-232.578] (-231.630) (-229.463) * (-228.836) (-231.431) (-229.889) [-229.477] -- 0:00:28
540000 -- (-233.795) (-229.555) (-231.709) [-229.731] * (-233.623) (-232.403) (-228.372) [-233.785] -- 0:00:28
Average standard deviation of split frequencies: 0.006719
540500 -- (-229.884) (-234.170) (-233.854) [-229.890] * (-231.086) (-228.401) (-230.366) [-232.028] -- 0:00:28
541000 -- (-230.351) (-230.893) [-230.342] (-228.328) * [-232.883] (-234.455) (-230.841) (-231.376) -- 0:00:27
541500 -- (-233.670) [-233.133] (-229.044) (-230.835) * (-230.218) [-230.588] (-233.405) (-231.700) -- 0:00:27
542000 -- (-232.818) (-229.370) (-230.622) [-227.848] * (-229.041) (-231.702) (-228.513) [-230.371] -- 0:00:27
542500 -- (-232.236) (-232.187) [-229.043] (-231.580) * (-228.901) (-231.155) [-228.937] (-229.304) -- 0:00:27
543000 -- (-236.090) (-230.032) [-229.414] (-230.852) * [-232.429] (-230.138) (-230.168) (-228.175) -- 0:00:28
543500 -- (-230.354) [-230.220] (-229.606) (-233.535) * (-233.668) (-229.710) [-232.748] (-228.308) -- 0:00:28
544000 -- (-230.340) (-228.972) [-231.302] (-229.966) * (-236.296) (-228.947) [-232.205] (-232.463) -- 0:00:28
544500 -- [-230.999] (-228.350) (-229.307) (-229.254) * (-229.271) (-228.938) [-230.651] (-231.543) -- 0:00:28
545000 -- (-229.080) (-233.771) [-228.466] (-229.567) * (-234.637) (-229.843) (-232.032) [-229.354] -- 0:00:28
Average standard deviation of split frequencies: 0.006247
545500 -- (-230.354) (-231.191) [-231.271] (-229.349) * [-233.868] (-229.398) (-231.509) (-229.542) -- 0:00:28
546000 -- [-232.195] (-230.643) (-232.404) (-229.958) * (-234.104) (-231.561) [-229.345] (-232.733) -- 0:00:28
546500 -- (-230.776) (-231.296) [-228.523] (-228.428) * (-229.913) (-229.245) (-231.641) [-230.133] -- 0:00:28
547000 -- (-232.963) (-230.490) (-230.226) [-229.440] * [-230.514] (-228.379) (-230.788) (-230.070) -- 0:00:28
547500 -- [-230.374] (-230.923) (-230.415) (-232.107) * (-229.012) (-229.798) [-229.030] (-233.562) -- 0:00:28
548000 -- (-229.981) (-229.755) (-229.642) [-230.453] * (-229.647) (-229.452) [-230.705] (-231.728) -- 0:00:28
548500 -- (-230.028) [-228.618] (-231.488) (-230.078) * (-230.869) (-228.272) [-230.934] (-229.779) -- 0:00:27
549000 -- (-229.055) (-228.482) [-228.118] (-229.540) * [-228.819] (-230.743) (-230.638) (-233.527) -- 0:00:27
549500 -- (-234.507) (-230.740) (-229.807) [-232.030] * (-229.353) [-230.031] (-228.052) (-229.746) -- 0:00:27
550000 -- (-230.034) (-234.895) [-230.073] (-234.702) * [-228.977] (-229.990) (-228.911) (-229.284) -- 0:00:27
Average standard deviation of split frequencies: 0.006563
550500 -- (-229.246) (-229.905) [-228.211] (-236.201) * (-228.042) (-229.137) [-228.531] (-229.989) -- 0:00:27
551000 -- (-231.698) (-232.764) [-228.878] (-230.402) * [-228.893] (-228.777) (-231.653) (-230.239) -- 0:00:27
551500 -- [-228.771] (-231.883) (-229.077) (-230.434) * (-230.529) (-228.041) (-232.389) [-228.614] -- 0:00:27
552000 -- (-229.906) [-230.484] (-231.640) (-229.421) * (-230.423) (-230.338) (-235.202) [-229.580] -- 0:00:27
552500 -- (-229.976) [-228.720] (-229.828) (-229.187) * [-231.864] (-230.726) (-228.699) (-232.840) -- 0:00:27
553000 -- (-233.046) (-228.946) [-231.837] (-228.251) * (-231.033) (-230.812) (-230.421) [-232.355] -- 0:00:27
553500 -- [-230.481] (-228.376) (-231.197) (-228.729) * [-228.856] (-229.247) (-229.670) (-232.144) -- 0:00:27
554000 -- (-231.743) [-229.771] (-228.959) (-230.828) * (-229.595) (-231.473) [-228.234] (-230.013) -- 0:00:27
554500 -- (-236.626) [-229.153] (-229.877) (-230.764) * (-231.551) (-228.776) [-228.493] (-228.963) -- 0:00:27
555000 -- [-232.860] (-230.487) (-230.630) (-229.239) * [-229.350] (-228.716) (-231.870) (-232.892) -- 0:00:27
Average standard deviation of split frequencies: 0.005985
555500 -- (-230.870) (-230.234) [-232.423] (-230.062) * (-234.634) [-229.874] (-232.945) (-230.347) -- 0:00:27
556000 -- (-229.044) [-229.293] (-229.128) (-230.163) * (-228.876) [-229.311] (-229.770) (-229.482) -- 0:00:27
556500 -- (-229.437) (-228.938) [-231.262] (-228.489) * [-231.553] (-231.147) (-228.672) (-232.566) -- 0:00:27
557000 -- [-231.198] (-232.123) (-228.213) (-231.336) * (-230.534) [-234.235] (-229.765) (-228.506) -- 0:00:27
557500 -- (-231.152) (-228.453) [-229.073] (-230.253) * (-230.107) (-233.711) (-231.352) [-229.985] -- 0:00:26
558000 -- [-229.813] (-227.852) (-230.862) (-228.268) * [-229.653] (-234.576) (-233.255) (-230.905) -- 0:00:26
558500 -- (-229.760) (-230.099) [-232.007] (-229.255) * (-231.345) (-230.444) (-231.995) [-230.279] -- 0:00:26
559000 -- (-228.410) [-230.152] (-230.722) (-233.831) * [-229.262] (-231.587) (-232.108) (-230.531) -- 0:00:26
559500 -- (-229.697) [-227.903] (-232.493) (-232.687) * (-232.398) [-228.752] (-232.147) (-234.085) -- 0:00:26
560000 -- [-228.875] (-229.462) (-231.528) (-231.607) * (-230.421) (-230.972) [-229.554] (-231.716) -- 0:00:27
Average standard deviation of split frequencies: 0.006096
560500 -- (-228.394) (-229.627) [-227.958] (-231.949) * (-231.076) [-229.455] (-228.293) (-228.420) -- 0:00:27
561000 -- (-232.055) (-232.827) (-232.957) [-231.036] * (-238.319) (-230.654) (-231.171) [-229.570] -- 0:00:27
561500 -- (-230.663) [-232.663] (-230.601) (-229.645) * (-232.032) (-231.984) [-230.294] (-229.135) -- 0:00:27
562000 -- (-234.771) (-230.226) [-228.598] (-230.806) * (-231.826) (-228.510) (-231.254) [-230.532] -- 0:00:27
562500 -- (-228.744) [-233.271] (-228.419) (-231.826) * (-230.679) (-231.372) [-229.780] (-231.839) -- 0:00:27
563000 -- (-229.415) (-230.674) [-228.449] (-233.048) * (-231.422) (-236.703) (-228.432) [-229.889] -- 0:00:27
563500 -- (-230.101) (-229.911) (-230.661) [-229.101] * (-231.174) (-231.544) (-232.578) [-231.750] -- 0:00:27
564000 -- (-230.173) [-232.277] (-232.734) (-229.350) * (-231.329) (-230.055) (-230.336) [-231.016] -- 0:00:27
564500 -- (-229.699) (-229.480) [-230.996] (-230.118) * [-230.519] (-231.920) (-232.327) (-229.798) -- 0:00:27
565000 -- (-230.713) (-230.541) (-232.650) [-231.862] * [-228.275] (-234.017) (-230.155) (-231.816) -- 0:00:26
Average standard deviation of split frequencies: 0.007349
565500 -- (-231.218) [-230.042] (-231.129) (-231.244) * [-230.814] (-232.977) (-232.122) (-229.279) -- 0:00:26
566000 -- (-231.486) [-231.941] (-232.431) (-227.791) * (-228.313) (-228.613) (-232.667) [-229.129] -- 0:00:26
566500 -- (-232.865) (-230.075) (-228.656) [-230.308] * (-228.913) (-229.313) (-230.651) [-231.042] -- 0:00:26
567000 -- (-230.116) (-240.216) (-228.232) [-229.278] * [-228.308] (-229.617) (-230.991) (-234.276) -- 0:00:26
567500 -- (-228.327) [-228.907] (-228.302) (-229.380) * (-230.985) [-228.962] (-231.665) (-229.351) -- 0:00:26
568000 -- (-231.402) (-228.660) [-229.715] (-228.453) * (-229.068) [-231.180] (-233.249) (-230.639) -- 0:00:26
568500 -- [-229.602] (-228.874) (-231.571) (-229.698) * (-230.953) [-230.481] (-232.039) (-229.885) -- 0:00:26
569000 -- (-229.198) (-232.543) (-232.643) [-228.365] * [-231.720] (-230.344) (-229.798) (-230.008) -- 0:00:26
569500 -- [-229.677] (-229.926) (-231.245) (-228.343) * (-231.852) (-232.983) [-228.608] (-229.926) -- 0:00:26
570000 -- (-230.246) (-230.181) [-228.673] (-229.234) * (-229.610) (-229.263) (-230.181) [-228.664] -- 0:00:26
Average standard deviation of split frequencies: 0.007337
570500 -- [-233.302] (-230.013) (-229.416) (-228.242) * (-232.256) [-228.561] (-229.686) (-229.487) -- 0:00:26
571000 -- [-229.011] (-229.423) (-230.073) (-229.970) * (-230.492) (-232.776) (-230.733) [-228.908] -- 0:00:26
571500 -- (-231.787) (-231.320) (-232.278) [-228.898] * (-231.867) (-230.197) (-229.703) [-231.666] -- 0:00:26
572000 -- [-228.469] (-232.282) (-229.561) (-231.536) * [-231.548] (-231.778) (-229.279) (-229.742) -- 0:00:26
572500 -- (-229.822) [-229.607] (-229.560) (-232.639) * (-229.842) [-230.845] (-229.086) (-229.414) -- 0:00:26
573000 -- [-232.301] (-228.948) (-229.721) (-229.862) * (-231.082) (-229.998) [-229.341] (-233.247) -- 0:00:26
573500 -- (-234.230) [-229.332] (-230.878) (-229.226) * (-235.481) (-230.372) (-229.182) [-229.715] -- 0:00:26
574000 -- (-237.327) (-228.638) (-232.194) [-229.141] * (-228.846) [-227.987] (-231.627) (-229.531) -- 0:00:26
574500 -- (-230.636) (-229.054) (-233.535) [-228.927] * (-231.699) (-229.034) [-230.834] (-232.084) -- 0:00:26
575000 -- (-229.444) (-228.718) [-229.920] (-230.078) * (-229.717) (-230.695) [-232.025] (-229.286) -- 0:00:26
Average standard deviation of split frequencies: 0.007318
575500 -- (-229.299) [-229.521] (-227.797) (-230.664) * (-233.548) (-229.518) [-229.900] (-231.494) -- 0:00:26
576000 -- (-228.886) [-232.940] (-229.092) (-230.545) * (-231.457) (-231.954) [-230.629] (-229.648) -- 0:00:26
576500 -- [-231.538] (-229.685) (-228.902) (-230.336) * (-233.570) (-234.622) [-229.460] (-229.716) -- 0:00:26
577000 -- (-229.551) [-229.999] (-228.988) (-231.060) * [-229.433] (-233.341) (-230.246) (-233.586) -- 0:00:26
577500 -- (-228.038) [-235.891] (-230.601) (-230.921) * [-229.391] (-229.586) (-232.759) (-228.625) -- 0:00:26
578000 -- (-231.244) (-233.787) (-230.442) [-230.791] * [-228.617] (-228.279) (-231.213) (-233.934) -- 0:00:26
578500 -- [-229.937] (-233.721) (-229.986) (-232.852) * [-229.165] (-232.783) (-229.088) (-230.187) -- 0:00:26
579000 -- (-231.180) (-237.970) (-228.329) [-233.295] * (-234.493) [-231.680] (-233.103) (-234.404) -- 0:00:26
579500 -- [-229.580] (-230.090) (-228.269) (-228.999) * (-234.853) (-228.787) [-231.223] (-228.349) -- 0:00:26
580000 -- [-235.900] (-232.551) (-235.539) (-231.153) * (-229.112) (-230.698) (-229.097) [-228.165] -- 0:00:26
Average standard deviation of split frequencies: 0.007002
580500 -- [-230.597] (-230.794) (-229.786) (-232.896) * (-229.456) (-230.559) [-228.632] (-229.753) -- 0:00:26
581000 -- (-228.133) [-229.501] (-230.498) (-237.118) * (-232.162) (-230.090) (-228.090) [-229.228] -- 0:00:25
581500 -- (-229.395) (-230.009) (-230.361) [-230.126] * (-229.538) (-229.154) [-229.282] (-229.972) -- 0:00:25
582000 -- [-228.840] (-228.618) (-228.838) (-237.155) * (-229.514) (-231.022) [-228.712] (-234.046) -- 0:00:25
582500 -- (-228.223) (-229.170) [-235.222] (-230.166) * (-227.938) [-229.145] (-231.205) (-231.205) -- 0:00:25
583000 -- (-228.190) (-230.240) [-232.052] (-228.429) * (-229.341) (-228.941) [-231.587] (-231.142) -- 0:00:25
583500 -- (-230.608) (-232.351) [-228.912] (-231.123) * (-229.643) (-231.058) (-229.446) [-228.767] -- 0:00:25
584000 -- (-231.539) [-230.737] (-229.245) (-232.620) * (-231.156) (-230.668) [-230.113] (-230.294) -- 0:00:25
584500 -- (-229.202) [-228.511] (-231.000) (-229.385) * [-229.618] (-231.243) (-228.985) (-232.749) -- 0:00:25
585000 -- [-230.577] (-228.911) (-229.660) (-232.237) * (-231.648) (-236.866) (-232.345) [-232.319] -- 0:00:25
Average standard deviation of split frequencies: 0.006838
585500 -- [-233.631] (-232.267) (-233.487) (-230.915) * [-231.117] (-232.994) (-229.774) (-229.776) -- 0:00:25
586000 -- (-229.526) (-233.152) [-229.297] (-232.924) * (-230.074) (-230.527) (-228.051) [-231.155] -- 0:00:25
586500 -- (-231.134) (-237.391) [-233.889] (-230.863) * (-230.416) [-232.472] (-229.775) (-231.982) -- 0:00:25
587000 -- (-229.402) (-233.208) [-229.203] (-228.731) * (-230.785) (-231.218) (-228.601) [-231.778] -- 0:00:26
587500 -- (-228.937) (-230.885) [-228.766] (-228.480) * [-234.313] (-228.963) (-231.121) (-228.374) -- 0:00:25
588000 -- (-234.901) [-229.529] (-231.468) (-230.196) * (-232.208) (-229.411) (-233.801) [-231.455] -- 0:00:25
588500 -- (-235.396) [-231.858] (-231.076) (-229.268) * (-232.275) (-229.656) [-228.655] (-230.295) -- 0:00:25
589000 -- (-231.985) (-233.423) [-230.175] (-234.163) * (-230.589) [-228.212] (-228.650) (-232.443) -- 0:00:25
589500 -- [-230.555] (-231.129) (-229.643) (-229.621) * (-231.223) [-230.890] (-229.095) (-235.376) -- 0:00:25
590000 -- [-228.071] (-230.114) (-230.739) (-230.543) * (-232.977) (-230.522) [-228.169] (-233.782) -- 0:00:25
Average standard deviation of split frequencies: 0.006332
590500 -- (-231.724) (-229.440) [-228.768] (-233.278) * [-232.487] (-229.780) (-231.456) (-231.658) -- 0:00:25
591000 -- (-229.463) (-229.931) [-231.897] (-231.081) * [-230.797] (-237.334) (-228.016) (-232.229) -- 0:00:25
591500 -- [-229.737] (-229.672) (-228.822) (-235.999) * (-229.746) (-230.019) (-229.429) [-228.783] -- 0:00:25
592000 -- (-232.868) (-229.828) (-230.355) [-230.460] * (-232.014) [-230.466] (-229.610) (-231.692) -- 0:00:25
592500 -- [-231.279] (-229.128) (-229.501) (-228.262) * (-232.475) [-232.023] (-229.084) (-230.232) -- 0:00:25
593000 -- (-228.433) (-228.720) (-229.939) [-230.219] * (-232.625) (-230.710) (-230.269) [-231.147] -- 0:00:25
593500 -- (-228.875) [-228.904] (-229.793) (-231.181) * (-233.670) (-229.149) (-229.581) [-231.538] -- 0:00:25
594000 -- (-231.853) (-232.313) [-229.057] (-228.698) * [-230.506] (-228.178) (-231.146) (-230.716) -- 0:00:25
594500 -- (-231.926) (-230.147) [-229.472] (-230.576) * (-231.034) (-228.049) [-233.631] (-229.001) -- 0:00:25
595000 -- (-229.515) [-228.826] (-229.489) (-231.259) * (-230.090) (-228.406) [-231.303] (-231.882) -- 0:00:25
Average standard deviation of split frequencies: 0.006908
595500 -- (-229.856) (-230.935) [-229.867] (-231.207) * (-230.193) (-228.811) [-228.800] (-234.988) -- 0:00:25
596000 -- [-228.252] (-233.186) (-228.665) (-233.663) * (-231.867) (-228.598) [-230.420] (-230.984) -- 0:00:25
596500 -- [-230.502] (-229.046) (-230.398) (-230.103) * (-232.361) (-230.631) [-232.515] (-230.066) -- 0:00:25
597000 -- [-229.445] (-228.903) (-228.809) (-231.570) * [-229.885] (-233.214) (-229.454) (-232.122) -- 0:00:24
597500 -- (-227.903) [-230.313] (-230.863) (-229.302) * [-228.700] (-231.084) (-232.764) (-232.185) -- 0:00:24
598000 -- (-231.632) (-228.967) [-234.588] (-228.702) * (-230.778) [-229.194] (-229.777) (-233.374) -- 0:00:24
598500 -- (-229.084) (-230.823) (-230.593) [-230.384] * [-230.908] (-229.805) (-231.395) (-233.626) -- 0:00:24
599000 -- (-228.481) [-229.700] (-230.471) (-230.716) * (-230.817) (-234.367) (-230.444) [-231.887] -- 0:00:24
599500 -- (-229.767) (-229.379) [-229.903] (-229.849) * [-233.650] (-234.121) (-229.911) (-230.040) -- 0:00:24
600000 -- (-231.185) (-229.283) [-229.290] (-229.248) * (-234.940) (-232.168) (-233.906) [-230.988] -- 0:00:24
Average standard deviation of split frequencies: 0.007011
600500 -- (-232.403) (-232.711) [-228.509] (-229.742) * (-231.095) [-234.704] (-231.985) (-230.129) -- 0:00:24
601000 -- (-228.709) (-231.325) (-232.083) [-229.049] * (-231.632) (-232.245) (-231.977) [-233.079] -- 0:00:24
601500 -- [-232.717] (-232.516) (-231.053) (-228.163) * (-232.264) (-229.927) (-231.963) [-228.473] -- 0:00:24
602000 -- [-230.430] (-230.667) (-230.906) (-229.288) * (-230.577) [-228.162] (-230.270) (-228.223) -- 0:00:24
602500 -- [-232.754] (-228.728) (-233.314) (-234.928) * [-228.981] (-228.709) (-230.768) (-229.063) -- 0:00:25
603000 -- (-228.979) (-235.982) [-229.006] (-228.637) * (-230.455) (-234.665) (-230.564) [-229.598] -- 0:00:25
603500 -- (-230.356) [-233.432] (-231.365) (-228.953) * (-227.756) (-231.029) [-229.335] (-229.870) -- 0:00:24
604000 -- (-228.041) (-229.642) (-232.911) [-229.348] * (-228.340) (-230.137) (-230.164) [-228.189] -- 0:00:24
604500 -- (-233.799) [-228.941] (-231.368) (-231.228) * (-228.909) (-234.152) [-230.085] (-229.662) -- 0:00:24
605000 -- (-229.657) [-228.850] (-233.094) (-230.288) * (-229.949) (-232.770) (-231.630) [-229.786] -- 0:00:24
Average standard deviation of split frequencies: 0.007730
605500 -- (-230.650) [-228.991] (-231.373) (-231.154) * [-230.791] (-229.942) (-228.341) (-229.539) -- 0:00:24
606000 -- (-231.848) (-230.092) [-229.935] (-229.287) * (-230.968) (-229.125) (-228.998) [-228.402] -- 0:00:24
606500 -- (-232.615) (-228.709) [-233.733] (-229.630) * (-234.760) (-230.176) (-229.054) [-228.680] -- 0:00:24
607000 -- (-228.393) (-231.146) [-234.037] (-233.079) * [-231.642] (-232.739) (-229.695) (-231.531) -- 0:00:24
607500 -- (-228.778) (-231.615) [-228.966] (-228.660) * (-231.086) [-231.392] (-228.227) (-233.115) -- 0:00:24
608000 -- (-229.124) (-232.501) [-229.190] (-229.433) * [-230.069] (-230.053) (-228.280) (-230.865) -- 0:00:24
608500 -- [-228.847] (-228.095) (-231.947) (-230.077) * [-229.280] (-230.444) (-233.485) (-231.225) -- 0:00:24
609000 -- (-229.188) (-228.298) (-229.497) [-228.641] * (-228.782) [-229.515] (-228.196) (-233.793) -- 0:00:24
609500 -- (-229.062) [-234.600] (-232.475) (-229.042) * [-229.801] (-229.233) (-229.573) (-230.259) -- 0:00:24
610000 -- (-228.182) (-236.774) (-234.947) [-230.686] * [-230.831] (-228.121) (-230.322) (-232.237) -- 0:00:24
Average standard deviation of split frequencies: 0.007102
610500 -- (-229.399) [-229.549] (-230.136) (-230.400) * (-229.761) (-233.334) [-228.968] (-230.959) -- 0:00:24
611000 -- (-229.181) [-228.905] (-230.710) (-229.260) * (-233.972) (-230.463) (-229.219) [-229.405] -- 0:00:24
611500 -- (-231.845) (-236.022) [-234.575] (-230.374) * [-229.095] (-228.678) (-229.543) (-235.406) -- 0:00:24
612000 -- (-237.133) [-228.393] (-234.097) (-231.935) * (-228.238) (-229.433) [-228.782] (-228.141) -- 0:00:24
612500 -- (-230.227) [-232.095] (-230.082) (-231.080) * [-228.012] (-229.265) (-229.240) (-229.406) -- 0:00:24
613000 -- (-230.431) [-229.725] (-231.040) (-230.640) * (-229.565) (-228.736) (-228.913) [-229.557] -- 0:00:23
613500 -- (-232.640) (-231.027) [-229.827] (-228.273) * (-232.972) [-230.182] (-231.282) (-229.642) -- 0:00:23
614000 -- (-231.159) (-228.732) [-231.729] (-230.458) * (-230.770) (-229.708) (-229.537) [-228.615] -- 0:00:23
614500 -- (-230.086) (-232.161) (-230.076) [-229.191] * (-229.789) [-228.569] (-236.915) (-231.771) -- 0:00:23
615000 -- (-229.306) (-233.610) [-230.950] (-228.225) * (-231.390) (-229.967) [-228.618] (-228.857) -- 0:00:23
Average standard deviation of split frequencies: 0.006836
615500 -- [-228.915] (-233.043) (-231.138) (-228.136) * (-228.416) (-228.968) [-232.526] (-232.977) -- 0:00:23
616000 -- (-230.525) [-228.752] (-231.559) (-229.857) * (-229.617) [-230.464] (-233.412) (-232.181) -- 0:00:23
616500 -- [-232.015] (-229.302) (-228.515) (-229.535) * (-238.514) [-231.270] (-230.224) (-229.001) -- 0:00:23
617000 -- [-229.006] (-228.687) (-231.984) (-228.863) * (-233.093) (-231.888) (-229.189) [-232.495] -- 0:00:23
617500 -- (-229.111) (-229.133) (-233.871) [-229.272] * (-230.187) (-231.431) (-229.176) [-231.246] -- 0:00:24
618000 -- (-233.290) (-235.966) [-233.534] (-233.441) * (-233.347) [-229.450] (-229.768) (-229.953) -- 0:00:24
618500 -- (-231.994) [-230.089] (-232.279) (-231.457) * (-236.285) [-233.984] (-228.203) (-229.534) -- 0:00:24
619000 -- (-228.405) (-229.729) [-231.620] (-235.321) * (-228.402) [-230.734] (-228.404) (-233.289) -- 0:00:24
619500 -- (-230.374) [-228.194] (-233.188) (-229.712) * [-229.808] (-231.328) (-229.390) (-229.899) -- 0:00:23
620000 -- (-231.692) (-229.335) [-228.167] (-234.671) * (-229.003) (-228.577) [-229.311] (-231.643) -- 0:00:23
Average standard deviation of split frequencies: 0.008117
620500 -- (-232.134) (-229.967) [-228.993] (-228.535) * (-228.828) (-229.488) [-228.824] (-231.748) -- 0:00:23
621000 -- (-233.005) (-233.263) (-229.541) [-229.820] * (-231.407) [-230.200] (-228.374) (-231.103) -- 0:00:23
621500 -- (-231.919) [-229.932] (-230.665) (-232.305) * (-228.283) (-230.038) (-228.494) [-231.145] -- 0:00:23
622000 -- (-230.333) [-231.413] (-229.735) (-235.247) * (-229.002) [-229.121] (-229.323) (-229.421) -- 0:00:23
622500 -- (-230.062) (-230.169) (-228.622) [-230.204] * (-230.715) (-231.573) (-229.153) [-232.361] -- 0:00:23
623000 -- (-230.654) (-229.900) [-230.236] (-228.257) * (-228.924) [-229.746] (-230.448) (-230.132) -- 0:00:23
623500 -- (-228.669) (-233.938) (-229.641) [-228.401] * [-228.906] (-231.284) (-229.203) (-230.628) -- 0:00:23
624000 -- (-230.120) [-231.836] (-230.614) (-234.937) * [-229.343] (-230.318) (-232.088) (-228.813) -- 0:00:23
624500 -- (-228.059) [-229.302] (-231.779) (-238.904) * (-230.111) (-233.084) (-235.499) [-229.387] -- 0:00:23
625000 -- (-228.874) (-232.427) [-232.386] (-229.504) * [-229.855] (-227.990) (-229.038) (-229.582) -- 0:00:23
Average standard deviation of split frequencies: 0.008378
625500 -- [-228.678] (-230.274) (-229.465) (-228.687) * [-229.338] (-232.257) (-228.973) (-231.957) -- 0:00:23
626000 -- [-232.982] (-229.408) (-233.323) (-228.023) * (-230.757) (-233.652) (-229.119) [-228.780] -- 0:00:23
626500 -- (-232.703) [-228.490] (-231.772) (-228.681) * (-229.697) (-239.912) (-229.320) [-228.769] -- 0:00:23
627000 -- (-230.353) (-230.024) [-236.123] (-231.874) * (-229.023) (-237.626) [-229.161] (-229.998) -- 0:00:23
627500 -- [-230.108] (-229.249) (-232.484) (-232.844) * [-233.717] (-228.810) (-228.904) (-230.234) -- 0:00:23
628000 -- (-229.877) [-229.277] (-229.092) (-230.181) * (-231.704) (-230.545) [-228.959] (-233.707) -- 0:00:23
628500 -- (-230.653) (-236.405) (-228.897) [-229.308] * [-235.759] (-237.663) (-229.528) (-231.621) -- 0:00:23
629000 -- [-228.860] (-230.913) (-228.654) (-231.428) * (-230.143) (-229.506) (-229.933) [-229.468] -- 0:00:23
629500 -- (-229.060) (-229.470) [-234.241] (-233.905) * (-232.434) (-229.918) [-230.627] (-230.987) -- 0:00:22
630000 -- [-231.593] (-231.998) (-231.194) (-234.354) * (-230.753) [-228.558] (-232.433) (-230.252) -- 0:00:22
Average standard deviation of split frequencies: 0.008643
630500 -- (-228.568) [-229.606] (-230.481) (-229.339) * (-236.245) [-229.758] (-228.687) (-236.313) -- 0:00:22
631000 -- (-232.338) [-231.098] (-236.585) (-229.484) * (-232.888) (-232.737) [-229.984] (-229.867) -- 0:00:22
631500 -- [-230.121] (-229.415) (-231.547) (-231.228) * [-229.695] (-228.386) (-234.877) (-229.646) -- 0:00:22
632000 -- (-233.269) (-229.163) [-229.963] (-230.217) * (-230.272) (-228.299) [-233.874] (-230.003) -- 0:00:22
632500 -- (-229.219) (-229.582) (-232.512) [-231.289] * (-231.523) (-229.163) (-229.007) [-232.166] -- 0:00:22
633000 -- (-230.444) (-229.138) [-229.571] (-229.139) * (-230.186) (-228.918) [-229.055] (-228.687) -- 0:00:23
633500 -- [-229.982] (-228.933) (-232.366) (-235.667) * (-231.673) (-228.574) [-229.486] (-231.377) -- 0:00:23
634000 -- (-233.473) [-229.534] (-229.736) (-231.733) * (-228.346) [-234.956] (-229.524) (-233.792) -- 0:00:23
634500 -- (-232.430) (-229.742) (-232.758) [-230.938] * [-230.152] (-229.850) (-229.731) (-228.941) -- 0:00:23
635000 -- (-228.917) (-230.125) (-230.442) [-231.031] * (-231.743) (-230.231) [-231.460] (-230.960) -- 0:00:22
Average standard deviation of split frequencies: 0.008200
635500 -- (-230.569) (-230.363) (-230.953) [-229.869] * (-231.635) (-229.564) [-233.006] (-229.891) -- 0:00:22
636000 -- [-232.385] (-229.401) (-232.597) (-229.683) * (-229.701) (-230.146) [-232.971] (-231.849) -- 0:00:22
636500 -- (-230.058) (-230.260) [-234.229] (-228.678) * (-232.058) [-229.102] (-232.633) (-232.255) -- 0:00:22
637000 -- [-229.887] (-230.112) (-234.249) (-231.502) * (-231.572) (-230.752) [-231.324] (-232.136) -- 0:00:22
637500 -- (-228.725) (-231.816) (-232.444) [-231.997] * [-230.515] (-231.286) (-231.954) (-229.015) -- 0:00:22
638000 -- (-229.284) (-229.557) [-230.696] (-230.677) * (-228.961) (-231.191) [-232.134] (-230.237) -- 0:00:22
638500 -- [-231.511] (-229.873) (-229.437) (-228.446) * (-230.065) [-233.324] (-229.735) (-229.310) -- 0:00:22
639000 -- (-229.013) (-233.544) (-229.985) [-228.986] * (-229.340) (-231.320) (-229.119) [-231.346] -- 0:00:22
639500 -- (-231.107) (-232.969) [-228.823] (-228.653) * (-230.141) (-228.899) (-229.185) [-229.514] -- 0:00:22
640000 -- (-231.237) (-230.272) (-229.159) [-231.182] * [-229.706] (-231.311) (-232.568) (-233.587) -- 0:00:22
Average standard deviation of split frequencies: 0.008048
640500 -- [-228.579] (-229.352) (-228.450) (-232.724) * (-230.108) [-233.287] (-229.724) (-232.402) -- 0:00:22
641000 -- (-232.486) (-229.816) [-230.233] (-233.978) * (-233.101) (-230.536) (-230.861) [-230.943] -- 0:00:22
641500 -- (-229.420) (-228.680) (-231.157) [-231.403] * (-229.275) [-229.184] (-234.000) (-233.439) -- 0:00:22
642000 -- (-230.464) (-228.892) [-228.429] (-230.956) * (-230.103) (-229.253) (-232.164) [-228.981] -- 0:00:22
642500 -- (-235.909) (-230.077) [-236.619] (-229.540) * (-233.038) [-229.691] (-231.875) (-229.203) -- 0:00:22
643000 -- (-230.952) (-229.675) [-229.023] (-229.359) * (-228.938) (-231.928) (-229.062) [-232.433] -- 0:00:22
643500 -- (-228.487) [-227.873] (-229.639) (-229.698) * (-228.385) (-228.971) (-230.279) [-228.754] -- 0:00:22
644000 -- (-228.258) [-228.664] (-229.616) (-229.434) * [-232.064] (-230.082) (-235.158) (-230.813) -- 0:00:22
644500 -- [-228.618] (-229.011) (-232.487) (-229.052) * [-230.192] (-233.499) (-233.297) (-228.069) -- 0:00:22
645000 -- (-229.582) (-230.122) [-231.127] (-230.263) * (-232.170) (-231.019) [-230.863] (-231.964) -- 0:00:22
Average standard deviation of split frequencies: 0.007684
645500 -- (-231.244) (-235.009) [-232.543] (-230.125) * (-229.880) [-230.242] (-228.855) (-229.877) -- 0:00:21
646000 -- (-229.828) [-231.223] (-230.886) (-228.718) * (-230.046) (-234.804) (-229.781) [-230.928] -- 0:00:21
646500 -- [-232.599] (-230.440) (-235.264) (-232.545) * [-228.815] (-229.790) (-228.726) (-229.666) -- 0:00:21
647000 -- (-229.230) [-228.744] (-229.594) (-231.051) * [-231.242] (-230.354) (-230.276) (-231.901) -- 0:00:21
647500 -- (-230.927) (-233.135) (-230.749) [-230.733] * (-231.329) (-229.069) [-232.984] (-230.051) -- 0:00:21
648000 -- (-229.226) [-230.076] (-230.907) (-229.497) * (-231.021) [-230.279] (-229.192) (-229.727) -- 0:00:21
648500 -- (-229.431) (-228.502) (-232.327) [-229.333] * [-231.734] (-229.681) (-229.533) (-230.844) -- 0:00:21
649000 -- (-232.553) (-228.025) (-229.999) [-230.626] * (-229.282) (-230.709) [-228.741] (-231.447) -- 0:00:22
649500 -- (-231.814) [-228.439] (-230.514) (-229.385) * [-230.604] (-230.982) (-230.016) (-228.321) -- 0:00:22
650000 -- (-232.343) (-228.477) (-229.914) [-229.487] * (-228.254) [-229.786] (-231.173) (-234.360) -- 0:00:22
Average standard deviation of split frequencies: 0.008286
650500 -- (-229.207) (-228.430) [-234.749] (-228.637) * (-231.360) [-232.880] (-228.905) (-229.128) -- 0:00:22
651000 -- [-229.693] (-227.862) (-228.865) (-229.436) * (-230.477) (-236.402) (-230.708) [-228.760] -- 0:00:21
651500 -- [-230.813] (-228.095) (-229.146) (-231.453) * (-232.126) (-229.022) (-231.963) [-228.569] -- 0:00:21
652000 -- (-230.660) (-229.235) (-233.023) [-229.496] * (-230.405) (-230.609) [-231.978] (-231.298) -- 0:00:21
652500 -- (-236.782) [-230.045] (-229.837) (-234.739) * [-228.580] (-231.557) (-230.489) (-229.503) -- 0:00:21
653000 -- (-229.113) (-229.263) [-228.880] (-232.179) * (-229.957) [-234.953] (-230.792) (-229.201) -- 0:00:21
653500 -- [-229.308] (-230.367) (-228.535) (-230.019) * (-233.037) (-230.116) [-229.775] (-229.228) -- 0:00:21
654000 -- [-228.615] (-228.530) (-229.136) (-229.457) * [-229.144] (-231.842) (-229.781) (-230.828) -- 0:00:21
654500 -- (-228.373) (-228.488) [-231.134] (-229.142) * [-229.213] (-233.401) (-234.038) (-229.909) -- 0:00:21
655000 -- (-228.949) [-228.886] (-232.512) (-229.782) * (-231.156) [-231.633] (-234.738) (-238.740) -- 0:00:21
Average standard deviation of split frequencies: 0.008668
655500 -- [-229.942] (-228.690) (-231.382) (-230.630) * (-230.056) (-229.906) [-233.331] (-227.899) -- 0:00:21
656000 -- (-229.262) (-231.121) [-231.236] (-230.861) * (-232.542) (-230.418) [-232.204] (-232.028) -- 0:00:21
656500 -- (-229.851) [-228.947] (-232.489) (-232.321) * (-229.353) [-228.004] (-229.228) (-228.220) -- 0:00:21
657000 -- [-229.253] (-233.418) (-231.785) (-233.687) * (-228.429) [-232.486] (-229.482) (-229.251) -- 0:00:21
657500 -- (-231.182) (-229.249) (-231.804) [-228.933] * [-232.012] (-228.156) (-228.164) (-230.129) -- 0:00:21
658000 -- (-231.272) (-229.192) (-232.548) [-228.840] * (-229.279) (-231.937) (-231.736) [-229.847] -- 0:00:21
658500 -- (-229.437) (-229.237) [-229.523] (-230.764) * (-230.335) (-230.676) (-235.043) [-232.554] -- 0:00:21
659000 -- (-231.075) (-228.627) (-230.627) [-231.173] * (-228.143) [-229.771] (-231.885) (-232.871) -- 0:00:21
659500 -- (-229.637) [-230.039] (-230.149) (-228.746) * [-233.855] (-232.198) (-229.752) (-230.835) -- 0:00:21
660000 -- (-228.940) [-230.324] (-228.583) (-230.025) * (-231.746) [-231.425] (-233.204) (-228.772) -- 0:00:21
Average standard deviation of split frequencies: 0.008562
660500 -- (-229.055) (-231.839) (-228.886) [-229.352] * (-232.147) [-227.894] (-229.496) (-229.508) -- 0:00:21
661000 -- (-229.455) (-232.447) [-232.143] (-231.603) * [-230.278] (-229.743) (-229.010) (-230.903) -- 0:00:21
661500 -- (-229.749) (-229.031) (-228.755) [-228.395] * (-228.768) [-229.726] (-228.236) (-232.336) -- 0:00:20
662000 -- (-229.375) (-229.032) [-229.680] (-232.442) * [-229.603] (-231.479) (-230.211) (-230.172) -- 0:00:20
662500 -- (-230.508) [-229.927] (-235.040) (-230.484) * [-229.568] (-229.645) (-227.897) (-229.577) -- 0:00:20
663000 -- (-229.038) (-233.033) (-228.597) [-229.289] * [-228.388] (-228.801) (-228.082) (-227.860) -- 0:00:20
663500 -- (-232.178) (-232.446) (-232.814) [-229.474] * (-231.900) (-228.694) [-229.598] (-228.461) -- 0:00:20
664000 -- (-229.737) (-231.711) (-233.692) [-228.373] * (-232.006) [-228.703] (-228.339) (-233.313) -- 0:00:20
664500 -- (-231.111) (-228.375) (-233.397) [-229.567] * (-229.494) (-229.236) (-231.013) [-231.226] -- 0:00:20
665000 -- (-229.101) (-230.029) [-228.798] (-228.927) * (-229.138) [-228.734] (-230.430) (-228.770) -- 0:00:20
Average standard deviation of split frequencies: 0.008671
665500 -- (-228.578) (-239.172) [-230.810] (-231.451) * (-229.293) [-228.512] (-232.022) (-230.642) -- 0:00:20
666000 -- [-229.654] (-234.810) (-229.375) (-228.698) * (-229.363) [-229.164] (-229.674) (-231.045) -- 0:00:21
666500 -- (-228.833) (-229.747) [-231.575] (-228.873) * (-229.194) [-231.705] (-230.918) (-228.620) -- 0:00:21
667000 -- (-231.558) [-231.180] (-229.764) (-228.571) * (-236.718) (-228.459) (-231.558) [-229.124] -- 0:00:20
667500 -- (-231.863) (-229.949) [-228.799] (-236.702) * [-234.338] (-230.442) (-229.367) (-228.096) -- 0:00:20
668000 -- (-231.362) (-229.429) (-233.373) [-230.140] * [-234.257] (-230.419) (-230.414) (-230.172) -- 0:00:20
668500 -- (-232.015) (-230.501) (-229.364) [-230.042] * (-241.987) (-230.839) [-230.278] (-228.789) -- 0:00:20
669000 -- (-231.492) (-229.113) (-231.786) [-228.839] * [-229.091] (-229.420) (-229.386) (-233.595) -- 0:00:20
669500 -- (-228.890) (-229.777) (-233.110) [-230.808] * [-229.524] (-230.053) (-228.009) (-230.368) -- 0:00:20
670000 -- [-229.277] (-229.525) (-234.362) (-229.831) * [-230.173] (-228.164) (-229.868) (-229.130) -- 0:00:20
Average standard deviation of split frequencies: 0.008523
670500 -- (-232.157) (-231.457) (-227.863) [-229.246] * (-229.687) (-228.828) (-232.611) [-231.439] -- 0:00:20
671000 -- (-235.847) (-230.573) [-235.000] (-229.256) * (-230.139) (-228.172) [-229.827] (-232.281) -- 0:00:20
671500 -- [-228.547] (-228.666) (-229.588) (-229.426) * [-229.919] (-228.724) (-229.078) (-232.138) -- 0:00:20
672000 -- (-229.259) (-231.905) (-229.466) [-231.678] * (-229.559) (-229.508) [-232.261] (-230.222) -- 0:00:20
672500 -- (-228.291) [-232.350] (-229.668) (-228.641) * (-229.937) (-235.350) (-230.109) [-228.770] -- 0:00:20
673000 -- (-229.141) (-231.068) [-230.056] (-229.502) * (-233.137) [-229.465] (-229.763) (-228.106) -- 0:00:20
673500 -- (-230.238) [-230.290] (-228.638) (-229.037) * (-231.554) [-229.726] (-229.330) (-233.048) -- 0:00:20
674000 -- (-229.016) (-229.909) [-229.968] (-227.993) * (-229.169) (-228.073) (-230.898) [-230.182] -- 0:00:20
674500 -- (-229.018) [-229.302] (-230.146) (-229.474) * (-229.709) (-231.875) [-229.146] (-231.367) -- 0:00:20
675000 -- (-230.617) [-228.693] (-232.999) (-229.232) * (-233.342) (-230.583) (-232.977) [-229.919] -- 0:00:20
Average standard deviation of split frequencies: 0.008063
675500 -- (-232.569) (-229.329) (-229.312) [-231.012] * (-228.578) (-233.627) [-229.153] (-230.872) -- 0:00:20
676000 -- [-231.481] (-228.836) (-228.775) (-232.384) * (-231.932) (-230.254) [-229.091] (-229.607) -- 0:00:20
676500 -- [-231.614] (-229.164) (-228.108) (-235.745) * (-229.595) [-228.763] (-230.753) (-228.945) -- 0:00:20
677000 -- (-229.873) (-230.597) (-228.387) [-230.099] * [-228.743] (-228.646) (-232.658) (-229.690) -- 0:00:20
677500 -- (-229.999) (-228.926) (-228.509) [-229.810] * (-230.382) (-231.189) [-228.578] (-228.538) -- 0:00:19
678000 -- (-229.565) [-228.524] (-234.589) (-228.495) * (-228.948) [-233.532] (-229.751) (-229.232) -- 0:00:19
678500 -- (-230.633) (-229.107) [-232.233] (-232.207) * [-232.150] (-231.215) (-230.056) (-233.016) -- 0:00:19
679000 -- (-232.489) (-231.542) (-229.491) [-230.030] * (-238.071) [-232.454] (-231.927) (-230.380) -- 0:00:19
679500 -- (-235.206) (-233.629) (-230.371) [-229.712] * (-234.536) (-228.658) (-230.951) [-230.300] -- 0:00:19
680000 -- (-231.919) (-232.128) (-232.410) [-228.103] * [-230.598] (-229.430) (-228.789) (-230.335) -- 0:00:19
Average standard deviation of split frequencies: 0.008700
680500 -- (-233.500) [-229.308] (-230.528) (-230.957) * (-230.327) (-231.156) [-229.185] (-228.815) -- 0:00:19
681000 -- [-232.656] (-228.426) (-231.556) (-229.744) * [-230.947] (-231.348) (-232.085) (-231.234) -- 0:00:19
681500 -- (-230.095) [-229.800] (-230.692) (-237.374) * (-231.511) [-228.951] (-236.470) (-230.392) -- 0:00:19
682000 -- (-230.015) [-230.482] (-229.713) (-233.982) * (-232.561) (-227.957) (-233.101) [-228.805] -- 0:00:19
682500 -- (-229.739) (-231.151) (-229.188) [-228.529] * [-230.497] (-228.126) (-230.917) (-230.222) -- 0:00:20
683000 -- (-232.433) (-233.492) (-229.383) [-228.569] * (-229.375) (-229.070) [-229.574] (-228.215) -- 0:00:19
683500 -- [-231.485] (-231.654) (-231.092) (-229.906) * (-230.946) [-228.575] (-228.469) (-228.134) -- 0:00:19
684000 -- (-234.836) [-231.219] (-229.599) (-230.336) * (-231.721) [-231.983] (-228.339) (-231.303) -- 0:00:19
684500 -- (-231.031) [-229.215] (-229.390) (-229.782) * [-228.614] (-232.786) (-232.219) (-231.108) -- 0:00:19
685000 -- [-230.748] (-228.936) (-229.752) (-231.177) * (-231.528) (-230.415) [-229.738] (-228.088) -- 0:00:19
Average standard deviation of split frequencies: 0.008418
685500 -- (-232.505) [-229.174] (-231.783) (-230.664) * (-232.176) [-229.063] (-230.444) (-230.208) -- 0:00:19
686000 -- [-233.182] (-232.939) (-231.646) (-229.583) * (-229.369) (-230.130) [-228.893] (-230.068) -- 0:00:19
686500 -- (-231.242) [-230.247] (-229.752) (-230.138) * (-228.674) (-230.963) [-229.596] (-230.208) -- 0:00:19
687000 -- (-229.066) (-231.011) [-228.826] (-231.858) * (-228.619) (-234.862) [-228.913] (-230.465) -- 0:00:19
687500 -- [-228.300] (-228.870) (-231.556) (-230.024) * [-230.721] (-234.739) (-229.710) (-232.873) -- 0:00:19
688000 -- (-233.236) (-228.613) [-231.324] (-231.468) * (-228.735) (-234.652) [-230.728] (-230.384) -- 0:00:19
688500 -- [-233.979] (-229.182) (-229.865) (-233.197) * (-234.215) (-232.209) [-229.820] (-231.242) -- 0:00:19
689000 -- [-230.454] (-229.153) (-228.873) (-228.845) * (-229.731) (-233.183) (-230.240) [-230.676] -- 0:00:19
689500 -- (-230.544) (-229.011) [-230.770] (-229.900) * (-229.964) (-230.436) (-235.047) [-230.735] -- 0:00:19
690000 -- (-229.501) (-230.975) [-233.125] (-235.503) * (-229.947) (-233.518) (-233.344) [-227.778] -- 0:00:19
Average standard deviation of split frequencies: 0.009086
690500 -- [-232.363] (-232.964) (-233.161) (-232.226) * [-229.874] (-232.667) (-233.285) (-236.653) -- 0:00:19
691000 -- (-231.117) (-233.490) (-229.426) [-233.207] * [-230.885] (-232.385) (-229.479) (-229.091) -- 0:00:19
691500 -- (-230.592) [-229.245] (-232.602) (-230.757) * [-228.693] (-230.856) (-229.221) (-230.485) -- 0:00:19
692000 -- (-230.614) (-232.205) [-230.300] (-228.379) * (-237.147) (-230.944) (-228.802) [-229.950] -- 0:00:19
692500 -- (-230.552) [-229.091] (-229.865) (-230.326) * (-231.931) [-231.795] (-228.828) (-229.506) -- 0:00:19
693000 -- (-231.354) [-228.945] (-230.726) (-231.629) * (-229.229) (-231.604) [-228.270] (-232.054) -- 0:00:19
693500 -- (-230.441) [-229.053] (-230.226) (-230.685) * [-231.136] (-228.398) (-230.109) (-229.061) -- 0:00:19
694000 -- (-231.048) (-230.714) (-231.256) [-231.765] * [-229.774] (-230.842) (-229.038) (-229.130) -- 0:00:18
694500 -- [-228.792] (-232.778) (-229.051) (-232.800) * [-230.461] (-233.004) (-231.340) (-229.794) -- 0:00:18
695000 -- [-229.696] (-229.395) (-230.549) (-229.484) * (-230.349) (-230.412) (-232.339) [-229.059] -- 0:00:18
Average standard deviation of split frequencies: 0.009101
695500 -- [-230.121] (-228.844) (-237.471) (-233.747) * (-236.682) (-228.257) [-235.418] (-228.534) -- 0:00:18
696000 -- [-232.739] (-228.765) (-230.789) (-229.341) * (-230.922) (-228.124) (-231.578) [-231.021] -- 0:00:18
696500 -- (-232.087) [-231.459] (-228.968) (-229.404) * (-228.578) (-229.244) (-231.341) [-229.106] -- 0:00:18
697000 -- (-230.677) (-229.013) [-228.215] (-231.203) * [-234.493] (-230.729) (-230.657) (-228.823) -- 0:00:18
697500 -- (-228.639) [-229.071] (-228.206) (-230.492) * (-229.203) (-231.262) [-231.284] (-232.573) -- 0:00:18
698000 -- [-228.584] (-229.464) (-229.769) (-229.289) * (-229.574) [-229.835] (-229.053) (-229.897) -- 0:00:18
698500 -- (-229.987) [-228.051] (-228.975) (-229.294) * [-229.478] (-230.305) (-229.338) (-230.324) -- 0:00:18
699000 -- (-238.202) (-230.085) (-231.268) [-228.974] * (-229.492) [-228.627] (-233.975) (-230.216) -- 0:00:18
699500 -- (-231.591) (-231.873) (-229.502) [-228.611] * (-230.346) (-229.227) (-232.553) [-229.906] -- 0:00:18
700000 -- [-231.471] (-229.014) (-229.294) (-233.893) * (-235.047) [-228.585] (-228.775) (-228.834) -- 0:00:18
Average standard deviation of split frequencies: 0.009251
700500 -- (-230.333) [-229.313] (-230.061) (-228.594) * [-235.700] (-231.246) (-230.936) (-230.031) -- 0:00:18
701000 -- (-228.913) (-231.098) (-229.160) [-230.809] * (-230.480) (-231.283) (-229.374) [-228.638] -- 0:00:18
701500 -- (-230.383) (-235.121) [-230.253] (-229.767) * (-236.809) (-230.940) (-229.115) [-229.331] -- 0:00:18
702000 -- (-231.102) (-238.889) [-231.557] (-231.819) * (-230.772) (-229.569) [-229.462] (-228.803) -- 0:00:18
702500 -- (-229.715) (-229.096) (-230.152) [-229.998] * (-230.956) [-231.197] (-228.876) (-229.068) -- 0:00:18
703000 -- (-228.278) [-230.085] (-230.312) (-231.390) * (-230.775) (-230.979) [-229.690] (-228.624) -- 0:00:18
703500 -- (-229.008) [-231.975] (-231.880) (-232.525) * (-230.221) (-230.920) (-229.585) [-229.940] -- 0:00:18
704000 -- (-228.853) [-234.068] (-228.492) (-231.475) * [-231.239] (-232.539) (-234.975) (-229.545) -- 0:00:18
704500 -- (-230.705) (-229.799) (-229.906) [-229.308] * [-229.588] (-232.725) (-231.580) (-230.648) -- 0:00:18
705000 -- (-230.171) [-230.474] (-229.230) (-230.881) * (-229.931) (-231.994) [-229.800] (-228.506) -- 0:00:18
Average standard deviation of split frequencies: 0.009598
705500 -- (-232.159) (-229.582) [-230.014] (-229.041) * (-231.384) [-231.051] (-231.311) (-230.287) -- 0:00:18
706000 -- (-232.170) [-230.385] (-230.377) (-230.876) * (-231.479) (-230.822) [-232.482] (-230.814) -- 0:00:18
706500 -- [-232.591] (-230.923) (-228.812) (-230.165) * (-229.645) (-233.481) [-228.328] (-229.659) -- 0:00:18
707000 -- (-231.374) [-232.661] (-229.574) (-232.357) * [-230.189] (-234.381) (-228.579) (-229.627) -- 0:00:18
707500 -- (-230.929) [-228.087] (-228.918) (-231.695) * (-228.985) (-229.507) (-230.764) [-230.272] -- 0:00:18
708000 -- (-230.022) [-228.135] (-230.030) (-231.821) * (-231.853) [-229.109] (-228.314) (-229.251) -- 0:00:18
708500 -- (-230.364) (-229.150) (-228.480) [-231.973] * [-228.115] (-228.882) (-228.772) (-231.670) -- 0:00:18
709000 -- [-228.805] (-230.787) (-230.498) (-234.623) * [-228.969] (-232.784) (-230.272) (-230.937) -- 0:00:18
709500 -- (-230.171) (-229.920) [-229.091] (-235.279) * (-229.306) (-235.629) [-232.172] (-231.103) -- 0:00:18
710000 -- (-232.165) (-229.990) [-230.873] (-229.181) * (-228.861) (-230.268) (-233.319) [-228.181] -- 0:00:17
Average standard deviation of split frequencies: 0.009701
710500 -- (-233.624) [-229.606] (-230.449) (-234.412) * [-228.535] (-228.250) (-235.722) (-229.332) -- 0:00:17
711000 -- (-229.338) (-232.183) (-228.168) [-231.152] * (-229.036) [-232.715] (-229.636) (-230.330) -- 0:00:17
711500 -- [-231.693] (-234.640) (-228.000) (-232.112) * [-229.161] (-232.123) (-231.257) (-232.325) -- 0:00:17
712000 -- (-230.283) (-230.657) [-228.972] (-231.046) * (-228.762) (-229.883) [-231.547] (-230.952) -- 0:00:17
712500 -- (-230.442) [-231.902] (-230.403) (-231.683) * (-230.338) (-230.645) [-230.198] (-229.593) -- 0:00:17
713000 -- (-229.567) [-229.603] (-230.873) (-230.016) * [-229.429] (-230.099) (-230.385) (-234.243) -- 0:00:17
713500 -- (-229.642) [-231.171] (-229.653) (-233.771) * (-229.642) (-232.580) [-230.360] (-230.409) -- 0:00:17
714000 -- (-229.307) (-231.755) [-229.711] (-232.901) * (-229.860) (-230.649) (-228.888) [-228.700] -- 0:00:18
714500 -- (-229.281) (-228.954) [-232.096] (-235.926) * (-230.675) (-233.317) (-231.579) [-232.547] -- 0:00:17
715000 -- (-228.592) [-229.767] (-231.760) (-233.667) * [-230.209] (-232.096) (-229.271) (-233.049) -- 0:00:17
Average standard deviation of split frequencies: 0.009300
715500 -- (-228.042) (-231.427) [-228.919] (-234.923) * [-229.692] (-233.309) (-232.927) (-232.541) -- 0:00:17
716000 -- [-230.054] (-228.927) (-231.242) (-231.435) * [-229.451] (-230.296) (-232.540) (-229.172) -- 0:00:17
716500 -- [-230.884] (-229.192) (-232.324) (-229.996) * (-229.526) (-228.801) [-230.684] (-230.355) -- 0:00:17
717000 -- (-229.891) [-229.688] (-235.592) (-230.454) * (-229.901) (-232.167) (-230.428) [-228.306] -- 0:00:17
717500 -- (-230.224) [-230.620] (-229.836) (-231.592) * (-230.769) (-231.803) (-229.112) [-228.928] -- 0:00:17
718000 -- (-232.368) (-230.645) (-234.015) [-232.163] * (-232.222) [-229.646] (-231.523) (-229.130) -- 0:00:17
718500 -- (-232.351) (-231.781) (-229.690) [-230.108] * (-231.160) (-229.890) (-228.624) [-228.586] -- 0:00:17
719000 -- (-232.025) (-230.186) [-231.193] (-232.520) * (-228.611) [-230.177] (-229.536) (-229.207) -- 0:00:17
719500 -- (-234.385) (-228.801) [-229.328] (-229.524) * [-228.415] (-228.717) (-229.117) (-229.388) -- 0:00:17
720000 -- (-229.442) (-230.762) (-230.751) [-228.860] * (-232.207) (-229.170) [-230.122] (-229.199) -- 0:00:17
Average standard deviation of split frequencies: 0.008994
720500 -- (-237.277) [-231.539] (-232.855) (-228.627) * (-230.238) [-229.728] (-228.933) (-230.464) -- 0:00:17
721000 -- [-229.971] (-232.661) (-233.244) (-231.005) * (-230.745) (-229.007) (-230.625) [-229.082] -- 0:00:17
721500 -- (-228.558) (-228.897) (-229.015) [-228.558] * (-232.816) (-231.457) (-229.791) [-229.366] -- 0:00:17
722000 -- [-229.970] (-231.011) (-229.976) (-229.190) * (-230.785) (-232.842) [-230.645] (-231.597) -- 0:00:17
722500 -- [-230.621] (-231.278) (-230.910) (-230.223) * [-232.214] (-233.511) (-230.013) (-230.306) -- 0:00:17
723000 -- (-227.993) (-230.984) (-229.134) [-230.272] * (-228.588) (-232.157) (-228.783) [-230.598] -- 0:00:17
723500 -- (-230.388) [-229.731] (-228.685) (-231.891) * (-230.299) (-230.555) (-228.795) [-232.105] -- 0:00:17
724000 -- (-228.185) (-231.275) [-232.605] (-230.720) * (-232.122) [-229.880] (-228.953) (-231.572) -- 0:00:17
724500 -- (-230.625) (-231.887) [-234.836] (-232.069) * (-231.428) (-229.853) [-230.399] (-228.027) -- 0:00:17
725000 -- (-228.363) (-229.456) [-232.068] (-229.763) * (-229.299) (-230.214) [-229.917] (-231.324) -- 0:00:17
Average standard deviation of split frequencies: 0.008644
725500 -- [-231.370] (-232.686) (-229.542) (-229.087) * (-229.394) [-230.486] (-231.857) (-228.726) -- 0:00:17
726000 -- (-235.800) (-228.970) (-232.044) [-232.239] * (-229.659) (-230.215) (-230.997) [-229.141] -- 0:00:16
726500 -- (-234.187) [-229.214] (-234.006) (-230.922) * (-229.734) (-232.367) [-231.683] (-229.584) -- 0:00:16
727000 -- (-230.400) (-232.093) [-232.448] (-228.943) * (-232.465) [-229.896] (-228.630) (-231.377) -- 0:00:16
727500 -- (-230.414) (-235.142) (-228.439) [-228.227] * (-232.050) [-230.262] (-229.048) (-228.498) -- 0:00:16
728000 -- (-236.947) (-233.333) [-229.710] (-229.603) * [-230.013] (-229.090) (-230.554) (-230.093) -- 0:00:16
728500 -- (-234.951) (-229.333) [-229.441] (-229.840) * (-233.088) (-228.974) (-228.709) [-232.180] -- 0:00:16
729000 -- (-235.952) (-229.912) [-228.328] (-233.858) * (-238.053) [-228.753] (-229.299) (-232.373) -- 0:00:16
729500 -- (-229.082) (-236.048) [-231.874] (-232.499) * (-230.573) [-228.782] (-228.358) (-229.488) -- 0:00:16
730000 -- [-230.005] (-229.142) (-230.673) (-228.910) * [-229.997] (-232.610) (-231.589) (-229.271) -- 0:00:16
Average standard deviation of split frequencies: 0.009113
730500 -- (-228.896) [-230.279] (-230.634) (-234.786) * (-231.197) (-229.219) (-231.422) [-228.344] -- 0:00:16
731000 -- (-230.328) [-229.750] (-230.183) (-237.008) * (-229.001) (-233.890) (-229.152) [-228.141] -- 0:00:16
731500 -- (-232.270) (-229.139) [-227.867] (-229.583) * [-233.056] (-230.913) (-229.949) (-228.925) -- 0:00:16
732000 -- [-228.772] (-231.438) (-227.987) (-231.054) * (-232.246) (-229.776) (-230.039) [-232.113] -- 0:00:16
732500 -- (-232.199) (-231.089) (-230.055) [-229.079] * (-228.874) (-231.531) (-229.826) [-231.157] -- 0:00:16
733000 -- (-230.562) [-229.240] (-230.747) (-228.995) * (-230.754) (-229.132) (-231.056) [-230.668] -- 0:00:16
733500 -- (-234.272) (-228.968) [-230.574] (-228.684) * (-230.568) (-230.265) [-232.819] (-229.777) -- 0:00:16
734000 -- (-230.636) [-228.820] (-229.462) (-230.088) * (-229.845) (-235.457) (-230.688) [-231.453] -- 0:00:16
734500 -- (-228.574) [-228.720] (-228.185) (-228.056) * (-232.228) (-229.566) [-229.891] (-238.539) -- 0:00:16
735000 -- (-228.176) [-229.039] (-229.123) (-229.651) * (-233.752) [-231.194] (-230.583) (-232.199) -- 0:00:16
Average standard deviation of split frequencies: 0.009087
735500 -- (-231.129) [-229.496] (-230.396) (-229.426) * (-232.736) (-230.352) (-229.627) [-229.693] -- 0:00:16
736000 -- (-230.267) (-228.864) [-229.119] (-228.192) * (-233.338) (-228.299) [-231.032] (-230.409) -- 0:00:16
736500 -- (-231.799) (-228.121) [-228.855] (-231.837) * (-229.037) (-229.153) (-231.830) [-233.643] -- 0:00:16
737000 -- (-230.028) (-228.717) (-230.929) [-230.102] * (-233.681) (-230.966) [-229.135] (-236.017) -- 0:00:16
737500 -- (-229.327) (-230.223) (-228.933) [-230.072] * (-230.087) (-231.822) (-229.153) [-230.784] -- 0:00:16
738000 -- (-234.118) (-229.704) [-230.029] (-231.344) * (-229.604) [-229.838] (-229.395) (-228.481) -- 0:00:16
738500 -- (-233.249) [-230.333] (-232.344) (-230.712) * (-229.523) [-230.932] (-231.158) (-231.584) -- 0:00:16
739000 -- (-231.640) (-230.117) [-229.989] (-229.121) * [-228.650] (-233.679) (-233.915) (-231.450) -- 0:00:16
739500 -- [-228.915] (-229.852) (-229.560) (-228.624) * (-229.053) (-230.279) (-230.923) [-229.594] -- 0:00:16
740000 -- (-229.162) [-235.894] (-229.829) (-230.260) * (-228.527) (-229.802) (-229.789) [-230.244] -- 0:00:16
Average standard deviation of split frequencies: 0.008871
740500 -- (-230.308) (-235.072) (-232.914) [-231.040] * (-230.512) (-230.114) [-232.991] (-230.840) -- 0:00:16
741000 -- (-229.645) (-229.655) [-229.930] (-232.684) * (-228.756) [-228.849] (-232.671) (-229.876) -- 0:00:16
741500 -- [-229.363] (-232.317) (-229.519) (-232.873) * (-231.607) (-229.960) [-230.047] (-229.037) -- 0:00:16
742000 -- (-228.674) [-230.965] (-228.535) (-231.450) * [-230.301] (-230.627) (-231.300) (-230.235) -- 0:00:15
742500 -- (-230.755) (-231.011) (-228.973) [-231.442] * [-230.095] (-233.263) (-231.564) (-228.465) -- 0:00:15
743000 -- (-237.922) (-229.769) (-228.624) [-232.702] * (-231.962) (-232.272) (-233.184) [-229.663] -- 0:00:15
743500 -- [-229.967] (-229.131) (-230.043) (-230.395) * (-230.809) (-228.679) (-233.396) [-232.495] -- 0:00:15
744000 -- [-230.407] (-229.476) (-228.973) (-230.400) * [-228.692] (-229.858) (-229.460) (-230.123) -- 0:00:15
744500 -- (-234.452) (-229.950) (-229.918) [-233.531] * (-228.389) (-230.369) [-229.830] (-231.461) -- 0:00:15
745000 -- (-230.664) [-230.882] (-229.742) (-233.584) * [-229.704] (-234.148) (-232.299) (-230.366) -- 0:00:15
Average standard deviation of split frequencies: 0.009479
745500 -- (-232.260) [-231.207] (-231.753) (-233.835) * (-228.280) (-228.966) [-233.734] (-231.685) -- 0:00:15
746000 -- (-233.619) (-235.104) (-228.955) [-232.312] * [-233.219] (-233.683) (-230.902) (-232.033) -- 0:00:15
746500 -- (-228.941) [-230.919] (-228.044) (-230.055) * (-230.217) (-229.231) (-230.582) [-234.280] -- 0:00:15
747000 -- [-228.826] (-231.533) (-229.653) (-229.498) * (-229.858) (-231.069) [-230.733] (-230.285) -- 0:00:15
747500 -- [-229.617] (-229.440) (-228.421) (-228.921) * (-229.026) (-232.966) [-230.532] (-230.256) -- 0:00:15
748000 -- (-229.012) (-230.200) [-228.569] (-232.301) * [-229.483] (-230.607) (-231.262) (-229.925) -- 0:00:15
748500 -- (-230.398) [-228.561] (-231.879) (-230.038) * (-228.656) (-229.608) (-234.835) [-229.011] -- 0:00:15
749000 -- (-232.189) (-233.943) (-232.577) [-228.952] * (-229.984) (-228.624) (-231.886) [-230.094] -- 0:00:15
749500 -- (-232.015) (-230.957) [-230.086] (-231.302) * (-230.671) (-228.741) (-231.252) [-231.343] -- 0:00:15
750000 -- (-231.060) (-230.543) (-229.643) [-228.884] * (-234.262) (-228.779) [-235.161] (-232.189) -- 0:00:15
Average standard deviation of split frequencies: 0.009498
750500 -- (-229.121) (-230.630) (-229.871) [-228.404] * (-229.589) (-229.339) [-232.857] (-230.637) -- 0:00:15
751000 -- (-228.729) (-228.539) (-229.606) [-231.931] * (-229.016) (-230.501) (-229.161) [-229.506] -- 0:00:15
751500 -- (-233.906) [-228.006] (-230.626) (-231.719) * [-228.718] (-231.329) (-232.782) (-231.298) -- 0:00:15
752000 -- (-232.245) (-231.090) [-229.217] (-233.135) * (-229.588) (-228.746) [-230.569] (-229.744) -- 0:00:15
752500 -- [-233.803] (-229.455) (-229.499) (-231.900) * [-232.725] (-230.840) (-229.954) (-228.979) -- 0:00:15
753000 -- (-229.623) (-232.897) [-227.975] (-234.324) * (-231.062) [-231.792] (-231.612) (-231.259) -- 0:00:15
753500 -- [-231.297] (-232.599) (-228.506) (-233.510) * [-231.320] (-230.792) (-229.401) (-233.497) -- 0:00:15
754000 -- (-232.356) (-231.657) [-230.372] (-230.437) * [-231.439] (-230.196) (-230.179) (-230.396) -- 0:00:15
754500 -- (-230.540) (-230.072) (-230.336) [-229.099] * (-234.937) [-230.592] (-230.828) (-230.958) -- 0:00:15
755000 -- [-229.767] (-232.755) (-230.687) (-229.399) * (-231.536) [-231.497] (-231.367) (-228.884) -- 0:00:15
Average standard deviation of split frequencies: 0.009626
755500 -- (-233.373) (-231.110) (-231.320) [-228.961] * (-230.849) (-231.820) [-230.813] (-230.647) -- 0:00:15
756000 -- (-230.941) [-229.777] (-229.731) (-230.726) * (-231.127) (-230.041) [-232.452] (-229.069) -- 0:00:15
756500 -- [-228.734] (-230.330) (-230.641) (-230.097) * (-230.180) [-228.914] (-232.695) (-229.564) -- 0:00:15
757000 -- [-229.526] (-232.028) (-228.700) (-230.149) * (-231.362) (-228.355) [-228.853] (-231.270) -- 0:00:15
757500 -- (-229.488) (-228.362) [-229.644] (-228.834) * (-229.434) (-232.944) [-228.657] (-231.764) -- 0:00:15
758000 -- [-229.636] (-234.568) (-229.482) (-232.262) * (-228.552) (-233.119) (-228.836) [-229.438] -- 0:00:15
758500 -- (-229.300) (-228.798) [-230.018] (-232.554) * (-231.354) (-233.317) (-235.549) [-230.744] -- 0:00:14
759000 -- (-231.269) [-231.260] (-231.579) (-236.850) * (-231.805) [-228.839] (-231.021) (-227.934) -- 0:00:14
759500 -- [-231.294] (-228.440) (-229.182) (-233.693) * [-230.442] (-232.139) (-231.636) (-228.397) -- 0:00:14
760000 -- (-230.271) (-230.897) (-231.842) [-232.037] * (-228.763) [-233.099] (-230.988) (-228.951) -- 0:00:14
Average standard deviation of split frequencies: 0.009567
760500 -- (-230.684) [-228.714] (-231.691) (-229.395) * (-231.299) (-229.769) [-228.450] (-231.712) -- 0:00:14
761000 -- [-229.101] (-230.833) (-231.413) (-232.438) * (-228.593) (-229.193) (-232.860) [-229.675] -- 0:00:14
761500 -- (-229.684) [-230.329] (-231.884) (-231.600) * (-228.406) [-232.056] (-233.297) (-233.095) -- 0:00:14
762000 -- (-232.043) [-229.578] (-230.426) (-229.835) * (-230.599) (-229.784) (-230.836) [-229.766] -- 0:00:14
762500 -- (-229.787) [-229.213] (-231.444) (-229.930) * [-229.541] (-231.108) (-229.189) (-229.850) -- 0:00:14
763000 -- (-228.477) (-229.832) [-232.717] (-229.322) * (-230.052) (-229.339) [-230.384] (-228.952) -- 0:00:14
763500 -- (-233.414) [-228.708] (-236.169) (-232.237) * (-229.470) (-228.768) (-232.198) [-229.684] -- 0:00:14
764000 -- [-231.493] (-231.562) (-230.003) (-229.730) * [-228.660] (-229.704) (-230.231) (-229.081) -- 0:00:14
764500 -- (-230.374) [-232.120] (-229.977) (-228.814) * [-227.937] (-228.878) (-238.668) (-230.719) -- 0:00:14
765000 -- (-229.646) [-230.446] (-229.698) (-229.065) * (-228.338) (-228.389) [-228.910] (-228.181) -- 0:00:14
Average standard deviation of split frequencies: 0.009539
765500 -- (-228.910) (-231.199) [-228.014] (-228.350) * (-229.376) [-228.337] (-229.289) (-229.393) -- 0:00:14
766000 -- (-229.890) (-231.478) (-233.130) [-228.342] * [-230.163] (-232.416) (-232.334) (-229.805) -- 0:00:14
766500 -- [-228.480] (-229.375) (-232.825) (-229.365) * (-232.619) (-232.244) [-229.801] (-229.723) -- 0:00:14
767000 -- (-229.714) [-230.259] (-230.897) (-229.039) * [-228.471] (-231.199) (-233.147) (-230.743) -- 0:00:14
767500 -- (-234.258) (-229.895) [-229.323] (-230.513) * [-232.127] (-228.616) (-230.913) (-228.983) -- 0:00:14
768000 -- (-229.548) (-229.761) (-228.883) [-230.583] * (-230.006) [-231.453] (-237.619) (-229.440) -- 0:00:14
768500 -- (-230.810) [-229.995] (-234.298) (-232.220) * (-229.196) (-230.614) [-228.024] (-229.517) -- 0:00:14
769000 -- (-231.995) [-229.326] (-231.384) (-229.813) * (-228.329) (-238.380) [-228.280] (-228.058) -- 0:00:14
769500 -- [-230.305] (-230.178) (-228.696) (-232.428) * (-228.491) (-233.962) [-227.896] (-229.479) -- 0:00:14
770000 -- (-229.988) (-228.316) [-232.227] (-229.956) * [-228.311] (-229.948) (-230.423) (-231.067) -- 0:00:14
Average standard deviation of split frequencies: 0.009481
770500 -- (-230.014) [-228.036] (-228.240) (-229.647) * (-230.161) [-228.369] (-228.158) (-237.469) -- 0:00:14
771000 -- (-230.152) [-229.274] (-228.508) (-230.196) * [-229.919] (-230.074) (-228.354) (-233.021) -- 0:00:14
771500 -- (-229.481) (-230.246) [-228.465] (-230.922) * (-229.815) [-231.542] (-227.942) (-228.985) -- 0:00:14
772000 -- (-228.684) (-229.182) (-232.351) [-230.117] * (-228.449) [-234.874] (-230.269) (-229.936) -- 0:00:14
772500 -- (-231.825) (-231.670) [-230.445] (-232.057) * (-230.057) (-231.210) [-230.097] (-229.050) -- 0:00:14
773000 -- (-230.569) [-230.218] (-235.471) (-230.949) * (-229.238) (-229.440) [-229.422] (-232.071) -- 0:00:14
773500 -- (-230.087) (-232.461) (-230.446) [-229.760] * (-229.885) (-230.639) (-230.718) [-227.921] -- 0:00:14
774000 -- (-230.630) (-230.751) [-231.151] (-230.630) * (-229.890) (-231.382) (-229.383) [-229.507] -- 0:00:14
774500 -- (-229.104) [-228.673] (-231.373) (-230.785) * [-229.378] (-231.149) (-230.773) (-230.524) -- 0:00:13
775000 -- (-230.963) (-228.933) (-231.760) [-231.238] * (-231.755) (-229.403) (-229.339) [-229.183] -- 0:00:13
Average standard deviation of split frequencies: 0.009302
775500 -- (-231.744) (-233.791) (-229.146) [-231.166] * [-228.974] (-230.288) (-229.171) (-233.415) -- 0:00:13
776000 -- (-229.926) [-230.858] (-232.133) (-229.482) * (-229.940) [-229.560] (-229.012) (-232.604) -- 0:00:13
776500 -- (-229.447) (-229.380) [-228.972] (-232.152) * (-232.839) (-231.196) [-230.361] (-231.726) -- 0:00:13
777000 -- (-231.771) [-228.786] (-230.048) (-229.333) * (-232.140) (-231.324) (-228.893) [-232.788] -- 0:00:13
777500 -- [-229.840] (-232.313) (-233.818) (-231.517) * (-234.721) (-235.412) [-228.467] (-235.172) -- 0:00:13
778000 -- [-229.309] (-230.115) (-229.027) (-229.478) * (-229.196) (-233.648) [-228.176] (-234.530) -- 0:00:13
778500 -- (-229.991) (-230.769) (-230.605) [-233.806] * (-232.254) [-228.760] (-230.780) (-234.670) -- 0:00:13
779000 -- [-231.988] (-232.569) (-230.031) (-228.490) * [-228.366] (-229.969) (-231.271) (-229.047) -- 0:00:13
779500 -- (-229.090) [-228.708] (-229.718) (-228.286) * [-230.666] (-230.053) (-228.571) (-233.682) -- 0:00:13
780000 -- (-232.975) [-229.422] (-232.006) (-228.715) * (-233.394) (-233.456) (-228.347) [-230.498] -- 0:00:13
Average standard deviation of split frequencies: 0.009397
780500 -- (-231.722) (-230.389) [-232.061] (-229.053) * (-231.914) (-232.264) (-230.942) [-233.155] -- 0:00:13
781000 -- [-230.445] (-228.698) (-232.129) (-230.725) * (-230.896) [-228.610] (-230.634) (-231.551) -- 0:00:13
781500 -- [-229.052] (-230.652) (-231.158) (-231.560) * [-229.455] (-230.717) (-229.578) (-230.363) -- 0:00:13
782000 -- (-228.358) (-231.690) [-231.163] (-230.710) * (-229.651) (-232.192) [-229.544] (-234.425) -- 0:00:13
782500 -- (-228.752) (-229.568) [-229.041] (-231.011) * (-229.351) (-232.303) (-229.466) [-229.295] -- 0:00:13
783000 -- (-230.700) [-228.875] (-229.211) (-232.345) * (-230.799) [-230.298] (-230.443) (-229.298) -- 0:00:13
783500 -- (-228.893) (-231.444) [-231.150] (-235.558) * (-233.388) (-229.767) (-230.605) [-230.994] -- 0:00:13
784000 -- (-229.893) (-231.716) (-235.539) [-230.660] * (-234.193) [-229.438] (-229.196) (-228.847) -- 0:00:13
784500 -- (-229.500) [-228.606] (-233.666) (-235.195) * (-230.235) (-229.131) [-229.038] (-233.848) -- 0:00:13
785000 -- (-229.670) [-231.507] (-230.370) (-231.958) * [-228.737] (-231.423) (-232.271) (-234.666) -- 0:00:13
Average standard deviation of split frequencies: 0.009561
785500 -- (-229.853) [-230.005] (-228.983) (-228.430) * (-228.165) (-229.512) [-230.648] (-236.290) -- 0:00:13
786000 -- [-228.839] (-230.454) (-230.910) (-230.332) * (-229.046) (-229.735) [-229.384] (-231.737) -- 0:00:13
786500 -- (-233.894) [-231.360] (-230.976) (-228.492) * (-231.017) (-229.781) [-230.659] (-229.374) -- 0:00:13
787000 -- (-232.259) (-231.242) (-231.445) [-229.619] * (-229.288) (-230.080) [-229.340] (-229.585) -- 0:00:13
787500 -- [-230.096] (-228.942) (-232.110) (-232.466) * (-234.273) (-229.094) [-229.151] (-230.057) -- 0:00:13
788000 -- (-231.719) (-229.613) [-230.660] (-231.044) * (-229.295) (-229.115) [-231.622] (-231.180) -- 0:00:13
788500 -- (-230.247) (-228.593) (-229.291) [-228.767] * (-232.205) [-229.724] (-235.212) (-229.928) -- 0:00:13
789000 -- (-228.878) [-228.346] (-228.995) (-228.978) * [-230.399] (-231.073) (-231.465) (-231.037) -- 0:00:13
789500 -- (-229.373) [-229.557] (-228.286) (-230.659) * (-228.118) [-229.286] (-229.183) (-229.077) -- 0:00:13
790000 -- (-230.503) (-228.528) [-228.395] (-234.830) * (-228.726) (-231.264) [-228.919] (-228.563) -- 0:00:13
Average standard deviation of split frequencies: 0.009539
790500 -- [-230.666] (-230.388) (-228.083) (-229.240) * (-228.210) [-230.513] (-231.345) (-230.833) -- 0:00:12
791000 -- (-230.476) [-230.725] (-228.773) (-229.638) * (-230.224) (-229.153) [-229.250] (-232.633) -- 0:00:12
791500 -- (-228.379) (-230.234) (-229.306) [-228.505] * [-230.982] (-228.616) (-233.143) (-231.780) -- 0:00:12
792000 -- (-230.545) [-229.011] (-231.986) (-235.321) * (-229.121) [-229.796] (-232.113) (-235.088) -- 0:00:12
792500 -- (-228.307) [-230.679] (-229.368) (-238.675) * (-232.996) (-229.266) [-229.341] (-231.287) -- 0:00:12
793000 -- (-228.991) (-231.560) [-228.445] (-234.276) * [-230.018] (-230.132) (-233.873) (-230.657) -- 0:00:12
793500 -- (-228.059) (-233.454) [-228.175] (-232.569) * (-232.290) (-233.778) (-232.642) [-228.969] -- 0:00:12
794000 -- [-228.737] (-228.547) (-230.112) (-228.743) * (-230.223) (-232.073) [-228.915] (-232.124) -- 0:00:12
794500 -- (-227.991) (-230.939) (-232.042) [-228.894] * (-230.196) (-234.670) [-229.509] (-230.030) -- 0:00:12
795000 -- (-228.644) [-229.373] (-229.862) (-228.763) * [-229.340] (-231.807) (-228.251) (-229.353) -- 0:00:12
Average standard deviation of split frequencies: 0.009475
795500 -- (-229.733) (-228.132) (-234.948) [-228.971] * (-228.694) (-230.895) [-228.985] (-231.713) -- 0:00:12
796000 -- (-232.700) (-229.542) (-239.372) [-230.912] * (-228.913) (-229.800) [-228.621] (-229.216) -- 0:00:12
796500 -- [-229.378] (-233.856) (-232.036) (-231.729) * [-231.530] (-229.359) (-230.280) (-231.650) -- 0:00:12
797000 -- (-230.691) [-229.715] (-231.991) (-230.621) * [-232.129] (-228.087) (-229.735) (-233.206) -- 0:00:12
797500 -- [-229.063] (-228.885) (-232.404) (-228.854) * (-232.174) [-230.416] (-232.775) (-231.959) -- 0:00:12
798000 -- (-229.873) (-229.576) (-228.274) [-231.929] * (-230.344) [-229.008] (-237.682) (-231.158) -- 0:00:12
798500 -- (-228.294) (-228.600) (-230.144) [-229.279] * (-229.594) (-228.992) (-231.751) [-230.734] -- 0:00:12
799000 -- (-230.742) [-227.952] (-232.959) (-229.790) * [-228.493] (-230.715) (-237.712) (-229.439) -- 0:00:12
799500 -- [-228.814] (-229.649) (-229.841) (-229.211) * (-230.188) (-228.534) [-229.548] (-232.126) -- 0:00:12
800000 -- (-229.384) [-228.686] (-232.308) (-230.005) * (-229.304) [-231.023] (-230.004) (-234.982) -- 0:00:12
Average standard deviation of split frequencies: 0.009386
800500 -- (-228.496) (-229.821) (-230.628) [-229.055] * (-228.263) (-228.348) [-228.495] (-233.160) -- 0:00:12
801000 -- (-230.334) (-232.998) [-229.569] (-232.450) * (-229.664) [-229.464] (-230.802) (-229.853) -- 0:00:12
801500 -- (-229.705) (-232.118) (-229.951) [-231.394] * (-229.093) (-232.039) [-230.001] (-232.075) -- 0:00:12
802000 -- (-229.736) (-230.529) (-228.894) [-228.908] * (-228.662) (-231.582) [-228.262] (-228.848) -- 0:00:12
802500 -- (-229.442) (-230.033) (-230.413) [-228.384] * (-229.515) [-230.857] (-231.873) (-228.162) -- 0:00:12
803000 -- [-230.040] (-231.401) (-232.747) (-230.660) * (-232.002) [-228.719] (-230.949) (-228.037) -- 0:00:12
803500 -- [-228.400] (-230.012) (-231.913) (-230.320) * (-229.198) (-236.230) (-229.592) [-229.406] -- 0:00:12
804000 -- (-228.954) (-232.589) [-231.654] (-231.630) * (-229.450) [-230.559] (-229.649) (-229.406) -- 0:00:12
804500 -- (-229.670) (-230.273) (-233.776) [-228.250] * (-228.750) (-231.098) (-228.671) [-229.104] -- 0:00:12
805000 -- [-229.178] (-232.395) (-230.186) (-233.222) * (-231.135) [-230.251] (-234.539) (-230.613) -- 0:00:12
Average standard deviation of split frequencies: 0.009117
805500 -- (-231.659) [-230.115] (-236.432) (-230.394) * [-228.257] (-229.842) (-237.013) (-229.603) -- 0:00:12
806000 -- [-232.746] (-228.681) (-231.229) (-228.483) * (-232.544) (-232.613) [-228.013] (-229.613) -- 0:00:12
806500 -- (-231.427) (-228.406) [-229.630] (-229.415) * [-232.435] (-229.061) (-228.635) (-229.276) -- 0:00:11
807000 -- [-229.817] (-233.691) (-229.824) (-228.028) * (-228.173) (-238.503) [-229.857] (-230.956) -- 0:00:11
807500 -- (-231.113) (-230.000) [-230.590] (-229.569) * (-230.605) [-228.836] (-231.311) (-229.531) -- 0:00:11
808000 -- (-229.257) (-231.150) [-232.184] (-229.511) * (-230.822) (-229.687) (-228.757) [-231.645] -- 0:00:11
808500 -- (-231.902) [-229.897] (-228.698) (-229.815) * [-230.854] (-230.975) (-229.948) (-231.808) -- 0:00:11
809000 -- [-230.406] (-228.606) (-229.566) (-229.897) * [-230.339] (-229.638) (-229.208) (-233.465) -- 0:00:11
809500 -- (-229.065) (-233.068) (-232.891) [-229.111] * (-229.886) (-229.655) (-229.759) [-229.521] -- 0:00:11
810000 -- [-234.062] (-232.417) (-229.994) (-228.782) * (-230.329) (-230.910) (-229.564) [-228.785] -- 0:00:11
Average standard deviation of split frequencies: 0.009304
810500 -- (-234.442) (-230.380) [-229.766] (-231.429) * (-228.219) (-228.685) (-230.251) [-230.121] -- 0:00:11
811000 -- (-228.144) (-228.004) (-229.966) [-229.009] * [-229.461] (-228.804) (-232.876) (-229.254) -- 0:00:11
811500 -- [-228.890] (-229.451) (-229.392) (-232.197) * [-229.479] (-227.873) (-232.799) (-230.249) -- 0:00:11
812000 -- [-228.856] (-235.197) (-232.193) (-228.637) * [-229.746] (-230.100) (-229.609) (-230.869) -- 0:00:11
812500 -- [-229.461] (-228.902) (-240.286) (-230.761) * [-231.535] (-230.633) (-229.069) (-228.182) -- 0:00:11
813000 -- (-231.781) (-232.778) [-234.670] (-233.432) * [-229.239] (-231.803) (-228.429) (-232.681) -- 0:00:11
813500 -- (-230.119) (-229.436) [-228.741] (-231.437) * (-230.370) (-229.925) (-230.620) [-230.149] -- 0:00:11
814000 -- (-235.656) (-228.457) [-228.530] (-228.271) * (-229.230) [-231.682] (-231.687) (-229.878) -- 0:00:11
814500 -- (-229.337) [-228.872] (-233.703) (-228.933) * (-229.610) [-229.907] (-230.082) (-231.938) -- 0:00:11
815000 -- (-230.716) (-230.101) [-228.892] (-230.011) * (-233.035) (-230.567) (-230.527) [-232.860] -- 0:00:11
Average standard deviation of split frequencies: 0.009549
815500 -- (-231.420) (-232.766) (-229.101) [-229.892] * (-230.128) (-228.855) [-228.683] (-232.746) -- 0:00:11
816000 -- [-229.422] (-228.317) (-228.526) (-232.728) * [-231.160] (-229.731) (-228.780) (-236.013) -- 0:00:11
816500 -- (-228.000) (-232.277) [-229.258] (-231.152) * (-230.581) (-228.344) (-230.519) [-234.445] -- 0:00:11
817000 -- (-230.617) (-230.537) (-228.036) [-229.240] * (-230.622) (-231.679) (-229.183) [-229.194] -- 0:00:11
817500 -- (-230.708) (-234.120) [-227.967] (-229.965) * (-231.336) [-234.803] (-228.581) (-231.151) -- 0:00:11
818000 -- (-230.989) (-233.352) [-228.253] (-228.838) * [-228.943] (-228.376) (-229.272) (-231.862) -- 0:00:11
818500 -- (-231.520) [-230.979] (-227.942) (-232.364) * (-228.997) (-233.177) [-229.115] (-228.184) -- 0:00:11
819000 -- (-230.399) (-233.846) (-229.458) [-231.295] * [-229.294] (-232.161) (-231.161) (-230.076) -- 0:00:11
819500 -- [-228.660] (-231.253) (-230.467) (-231.602) * (-235.842) (-230.052) (-229.149) [-232.172] -- 0:00:11
820000 -- (-228.634) (-236.153) (-230.569) [-229.991] * (-229.025) (-235.298) (-229.461) [-229.549] -- 0:00:11
Average standard deviation of split frequencies: 0.009900
820500 -- (-229.170) (-231.763) [-231.854] (-228.915) * [-230.291] (-231.218) (-230.375) (-231.740) -- 0:00:11
821000 -- (-230.014) (-229.952) (-231.415) [-230.255] * (-228.461) (-232.018) (-232.093) [-231.416] -- 0:00:11
821500 -- (-229.255) (-233.670) [-230.350] (-229.178) * (-230.544) (-232.036) (-231.750) [-232.950] -- 0:00:11
822000 -- [-229.038] (-232.812) (-232.056) (-230.706) * (-229.152) (-235.130) (-230.221) [-229.079] -- 0:00:11
822500 -- [-228.526] (-231.389) (-232.048) (-229.207) * (-231.013) (-229.293) [-229.643] (-230.221) -- 0:00:11
823000 -- [-229.003] (-228.705) (-229.381) (-231.517) * (-228.666) (-228.685) [-231.154] (-229.770) -- 0:00:10
823500 -- (-230.861) (-228.476) [-229.555] (-233.402) * [-229.904] (-230.214) (-231.200) (-230.790) -- 0:00:10
824000 -- (-229.772) (-228.478) (-232.318) [-229.571] * (-229.152) (-229.962) (-230.953) [-228.885] -- 0:00:10
824500 -- (-229.684) (-228.873) [-228.513] (-231.617) * [-229.687] (-231.867) (-229.730) (-229.083) -- 0:00:10
825000 -- (-231.747) (-231.755) [-233.292] (-229.280) * (-229.921) [-230.271] (-230.393) (-228.851) -- 0:00:10
Average standard deviation of split frequencies: 0.009601
825500 -- (-231.948) (-231.570) (-229.507) [-231.075] * (-229.105) [-228.341] (-231.304) (-233.532) -- 0:00:10
826000 -- (-233.812) (-228.382) (-230.135) [-228.412] * (-228.040) (-230.612) (-228.572) [-229.453] -- 0:00:10
826500 -- [-229.885] (-231.019) (-231.123) (-228.505) * (-230.703) [-230.302] (-231.545) (-231.967) -- 0:00:10
827000 -- (-235.006) [-230.864] (-229.426) (-229.758) * [-230.522] (-231.184) (-230.957) (-230.624) -- 0:00:10
827500 -- [-230.046] (-229.961) (-230.743) (-229.735) * (-229.155) (-229.914) (-229.176) [-229.919] -- 0:00:10
828000 -- (-229.604) (-231.145) [-229.428] (-233.044) * (-229.833) (-229.273) [-230.102] (-233.276) -- 0:00:10
828500 -- [-229.798] (-227.910) (-229.696) (-231.487) * [-228.727] (-229.756) (-230.936) (-232.729) -- 0:00:10
829000 -- [-230.881] (-230.307) (-229.822) (-229.739) * (-235.209) [-230.241] (-233.278) (-229.770) -- 0:00:10
829500 -- (-232.417) (-228.335) (-228.783) [-231.689] * (-233.123) (-233.233) [-230.739] (-230.531) -- 0:00:10
830000 -- (-230.588) (-230.496) [-230.374] (-228.933) * (-229.385) (-228.885) [-228.658] (-230.834) -- 0:00:10
Average standard deviation of split frequencies: 0.009748
830500 -- [-230.946] (-228.769) (-227.927) (-232.467) * [-229.145] (-229.132) (-228.576) (-229.290) -- 0:00:10
831000 -- (-228.767) (-232.384) (-230.065) [-233.009] * [-229.280] (-233.495) (-231.504) (-229.297) -- 0:00:10
831500 -- [-228.944] (-229.726) (-228.889) (-230.342) * (-233.619) (-230.760) (-228.818) [-229.711] -- 0:00:10
832000 -- (-229.210) (-229.773) [-228.201] (-231.378) * (-230.237) [-229.161] (-229.811) (-231.092) -- 0:00:10
832500 -- (-229.371) (-230.358) [-230.055] (-233.816) * (-231.192) [-228.714] (-231.331) (-228.792) -- 0:00:10
833000 -- (-231.470) [-231.045] (-229.512) (-230.554) * (-232.028) (-230.140) (-229.027) [-228.585] -- 0:00:10
833500 -- [-228.253] (-229.702) (-231.445) (-229.961) * [-231.244] (-228.210) (-231.887) (-229.199) -- 0:00:10
834000 -- (-231.500) (-228.460) (-230.352) [-234.413] * [-230.649] (-233.718) (-229.131) (-232.583) -- 0:00:10
834500 -- (-229.715) (-228.458) [-231.040] (-231.164) * [-232.377] (-233.511) (-230.619) (-234.399) -- 0:00:10
835000 -- (-228.791) [-228.348] (-233.929) (-229.600) * [-228.910] (-230.024) (-229.714) (-229.331) -- 0:00:10
Average standard deviation of split frequencies: 0.010050
835500 -- (-229.965) (-232.705) [-229.756] (-229.408) * (-229.689) (-236.609) [-230.017] (-230.226) -- 0:00:10
836000 -- (-228.569) [-231.607] (-228.879) (-233.652) * (-227.777) (-232.778) (-230.206) [-229.719] -- 0:00:10
836500 -- (-229.466) (-228.101) [-230.332] (-229.547) * (-233.513) (-230.790) [-228.352] (-233.530) -- 0:00:10
837000 -- (-230.209) [-229.246] (-228.727) (-232.789) * (-229.007) (-229.266) (-232.113) [-229.081] -- 0:00:10
837500 -- (-230.863) (-234.079) [-233.905] (-231.801) * (-228.677) (-228.556) (-229.189) [-229.441] -- 0:00:10
838000 -- (-233.212) [-228.728] (-231.699) (-230.548) * (-228.206) [-231.137] (-228.727) (-230.253) -- 0:00:10
838500 -- [-228.880] (-230.187) (-231.674) (-231.568) * (-229.023) (-232.774) [-228.685] (-230.530) -- 0:00:10
839000 -- [-236.446] (-230.960) (-232.196) (-229.288) * [-230.184] (-229.944) (-233.349) (-231.510) -- 0:00:09
839500 -- (-228.442) (-228.857) [-230.329] (-231.231) * (-231.565) [-228.571] (-234.334) (-231.082) -- 0:00:09
840000 -- (-228.581) (-229.464) (-230.651) [-230.334] * (-229.079) [-229.134] (-234.558) (-231.649) -- 0:00:09
Average standard deviation of split frequencies: 0.009665
840500 -- [-230.129] (-230.338) (-229.076) (-230.636) * (-228.204) [-230.179] (-230.073) (-231.606) -- 0:00:09
841000 -- (-234.844) (-229.181) [-230.699] (-228.279) * (-229.296) (-230.306) [-228.659] (-231.464) -- 0:00:09
841500 -- (-231.942) (-230.289) [-229.587] (-229.757) * [-230.849] (-229.765) (-230.088) (-230.266) -- 0:00:09
842000 -- (-230.894) (-229.189) [-233.301] (-229.823) * (-231.603) [-228.512] (-229.048) (-230.818) -- 0:00:09
842500 -- (-232.239) (-229.740) (-228.980) [-231.744] * (-229.540) (-228.346) (-230.358) [-230.618] -- 0:00:09
843000 -- [-232.393] (-228.431) (-230.279) (-232.704) * [-230.923] (-229.827) (-233.419) (-232.460) -- 0:00:09
843500 -- (-230.605) (-229.507) (-228.307) [-228.973] * (-230.490) (-228.187) [-228.898] (-232.077) -- 0:00:09
844000 -- (-230.646) [-229.440] (-229.718) (-228.712) * (-229.870) [-234.064] (-235.073) (-228.427) -- 0:00:09
844500 -- [-232.579] (-229.067) (-229.688) (-234.601) * (-230.345) (-231.095) [-238.227] (-229.942) -- 0:00:09
845000 -- (-233.759) (-230.283) [-229.456] (-231.273) * (-233.196) [-228.126] (-230.158) (-230.693) -- 0:00:09
Average standard deviation of split frequencies: 0.008706
845500 -- (-231.028) (-230.361) [-230.984] (-229.053) * (-229.233) (-229.654) (-230.013) [-229.368] -- 0:00:09
846000 -- (-231.351) [-229.001] (-231.550) (-237.033) * (-229.971) (-231.993) [-230.568] (-229.101) -- 0:00:09
846500 -- (-230.912) [-229.543] (-230.344) (-239.284) * (-230.457) (-235.072) [-232.483] (-234.216) -- 0:00:09
847000 -- (-229.382) (-229.000) [-231.563] (-232.624) * (-231.411) (-232.122) (-230.188) [-230.714] -- 0:00:09
847500 -- (-230.185) (-229.532) (-229.882) [-233.002] * (-228.633) (-232.624) [-229.714] (-230.031) -- 0:00:09
848000 -- (-228.776) (-230.145) (-230.568) [-230.945] * (-229.671) (-230.437) [-229.479] (-231.998) -- 0:00:09
848500 -- (-228.759) (-230.443) (-228.951) [-228.940] * [-229.039] (-230.896) (-228.514) (-228.692) -- 0:00:09
849000 -- (-229.323) (-230.426) (-230.765) [-231.293] * (-230.014) (-234.604) [-230.538] (-229.628) -- 0:00:09
849500 -- (-229.284) (-228.836) (-232.777) [-227.964] * [-229.327] (-234.407) (-229.190) (-232.774) -- 0:00:09
850000 -- (-232.627) (-228.378) [-230.572] (-235.460) * [-229.541] (-229.569) (-230.381) (-229.386) -- 0:00:09
Average standard deviation of split frequencies: 0.008555
850500 -- (-231.896) (-228.870) (-231.017) [-232.018] * (-229.822) (-228.535) [-230.444] (-232.117) -- 0:00:09
851000 -- (-232.202) (-230.981) [-231.378] (-234.248) * (-229.898) (-232.361) [-230.429] (-230.266) -- 0:00:09
851500 -- [-229.246] (-230.468) (-236.874) (-230.195) * (-230.339) (-233.258) [-229.618] (-228.352) -- 0:00:09
852000 -- [-229.418] (-229.690) (-228.315) (-229.217) * [-229.423] (-232.628) (-231.565) (-228.314) -- 0:00:09
852500 -- (-229.331) [-230.313] (-228.427) (-231.622) * [-228.939] (-229.577) (-232.765) (-228.522) -- 0:00:09
853000 -- (-230.148) (-235.378) (-229.678) [-230.978] * [-228.419] (-229.477) (-231.113) (-228.682) -- 0:00:09
853500 -- (-230.202) (-232.310) (-231.223) [-229.552] * (-228.537) (-230.152) (-230.737) [-229.070] -- 0:00:09
854000 -- [-230.971] (-228.590) (-230.647) (-230.012) * [-232.338] (-229.001) (-231.617) (-229.806) -- 0:00:09
854500 -- (-231.540) [-231.108] (-230.278) (-235.947) * (-230.764) (-229.466) [-230.468] (-229.381) -- 0:00:09
855000 -- (-231.496) (-229.330) [-229.609] (-232.140) * (-229.746) [-229.879] (-229.716) (-230.867) -- 0:00:08
Average standard deviation of split frequencies: 0.009052
855500 -- [-230.182] (-228.666) (-228.423) (-229.733) * (-228.840) [-230.265] (-230.185) (-230.373) -- 0:00:08
856000 -- (-228.739) [-231.516] (-229.081) (-230.781) * (-229.225) (-230.891) (-229.322) [-230.202] -- 0:00:08
856500 -- (-230.640) (-231.298) [-230.965] (-231.345) * (-229.054) (-228.639) (-228.091) [-230.685] -- 0:00:08
857000 -- (-228.766) (-229.434) [-230.003] (-228.679) * [-228.983] (-231.668) (-228.086) (-229.481) -- 0:00:08
857500 -- (-232.538) [-233.754] (-230.902) (-234.211) * [-229.960] (-230.468) (-228.076) (-230.042) -- 0:00:08
858000 -- (-230.854) (-228.269) (-230.108) [-231.976] * [-230.728] (-230.265) (-228.041) (-228.697) -- 0:00:08
858500 -- (-231.813) (-229.981) [-234.117] (-231.846) * (-229.497) (-233.571) (-228.616) [-230.016] -- 0:00:08
859000 -- (-228.286) (-231.021) [-231.433] (-228.794) * (-231.087) (-231.058) [-229.205] (-229.928) -- 0:00:08
859500 -- (-228.908) (-230.302) [-232.154] (-228.966) * [-229.722] (-231.210) (-230.154) (-229.746) -- 0:00:08
860000 -- (-229.875) [-232.048] (-232.970) (-230.240) * (-229.901) (-229.718) [-232.084] (-228.589) -- 0:00:08
Average standard deviation of split frequencies: 0.009174
860500 -- (-230.575) [-228.631] (-229.681) (-230.225) * (-228.878) [-234.270] (-228.884) (-230.935) -- 0:00:08
861000 -- [-232.424] (-228.739) (-230.208) (-229.357) * [-230.374] (-234.389) (-229.885) (-230.240) -- 0:00:08
861500 -- (-229.939) (-229.143) (-228.631) [-229.455] * (-228.627) (-230.191) [-232.168] (-230.488) -- 0:00:08
862000 -- (-230.034) (-228.947) (-229.791) [-229.596] * (-228.445) (-232.335) [-232.925] (-229.067) -- 0:00:08
862500 -- (-235.837) (-229.431) [-230.648] (-229.617) * (-230.566) (-230.616) [-232.979] (-237.186) -- 0:00:08
863000 -- (-235.251) (-231.264) (-230.719) [-231.139] * (-231.651) [-229.838] (-230.322) (-228.484) -- 0:00:08
863500 -- (-233.336) [-230.526] (-229.600) (-231.124) * (-231.634) [-229.030] (-230.430) (-230.233) -- 0:00:08
864000 -- [-234.768] (-230.308) (-228.113) (-229.090) * (-230.605) (-229.781) [-229.899] (-231.207) -- 0:00:08
864500 -- (-234.569) (-230.017) (-234.325) [-229.484] * (-229.626) (-232.547) [-230.785] (-229.584) -- 0:00:08
865000 -- [-230.448] (-228.057) (-233.690) (-229.504) * (-229.701) (-229.833) [-229.680] (-232.266) -- 0:00:08
Average standard deviation of split frequencies: 0.008676
865500 -- (-233.022) (-231.915) (-232.495) [-229.846] * (-229.470) (-232.240) [-229.786] (-229.765) -- 0:00:08
866000 -- (-230.802) (-229.141) (-231.854) [-233.896] * (-232.356) (-232.198) [-231.467] (-231.574) -- 0:00:08
866500 -- (-229.759) [-229.685] (-229.947) (-234.484) * (-230.308) (-229.120) [-230.059] (-229.239) -- 0:00:08
867000 -- (-232.195) [-230.976] (-231.092) (-229.567) * (-228.958) (-231.193) (-229.329) [-229.127] -- 0:00:08
867500 -- [-234.000] (-234.581) (-230.237) (-229.843) * (-231.802) (-233.209) [-228.945] (-228.758) -- 0:00:08
868000 -- (-232.551) [-229.689] (-229.846) (-231.966) * (-230.813) (-230.574) (-229.231) [-229.372] -- 0:00:08
868500 -- [-229.555] (-229.223) (-228.162) (-230.277) * (-231.864) (-228.452) [-228.793] (-229.487) -- 0:00:08
869000 -- [-231.128] (-232.930) (-228.869) (-229.823) * (-230.580) (-230.392) (-229.389) [-228.353] -- 0:00:08
869500 -- (-230.353) [-227.913] (-228.602) (-231.262) * (-230.361) [-230.670] (-230.345) (-229.041) -- 0:00:08
870000 -- (-227.982) (-228.668) (-228.244) [-233.720] * (-232.409) [-228.349] (-228.694) (-229.942) -- 0:00:08
Average standard deviation of split frequencies: 0.008697
870500 -- (-230.121) (-228.637) [-228.625] (-230.773) * [-229.322] (-231.293) (-230.802) (-230.084) -- 0:00:08
871000 -- (-229.152) (-234.268) [-229.602] (-232.243) * (-228.322) (-233.837) [-230.874] (-232.120) -- 0:00:07
871500 -- [-231.990] (-228.732) (-229.670) (-229.844) * (-230.635) (-234.860) [-231.717] (-231.177) -- 0:00:07
872000 -- (-231.062) [-229.526] (-229.136) (-231.939) * (-229.073) (-231.909) (-229.901) [-228.359] -- 0:00:07
872500 -- (-237.249) (-229.371) (-231.398) [-228.882] * (-229.828) (-231.781) [-230.727] (-228.401) -- 0:00:07
873000 -- (-229.681) (-228.610) (-230.457) [-230.890] * [-232.444] (-228.962) (-230.226) (-228.831) -- 0:00:07
873500 -- (-230.445) (-230.274) [-230.774] (-229.166) * (-229.548) (-229.701) [-228.865] (-230.729) -- 0:00:07
874000 -- [-229.087] (-233.433) (-229.663) (-230.476) * [-229.504] (-228.340) (-230.128) (-233.615) -- 0:00:07
874500 -- [-228.712] (-237.460) (-229.261) (-232.073) * (-229.429) (-231.046) (-230.246) [-229.325] -- 0:00:07
875000 -- [-229.492] (-231.342) (-230.223) (-230.918) * (-230.447) [-231.606] (-230.462) (-231.517) -- 0:00:07
Average standard deviation of split frequencies: 0.008610
875500 -- (-232.388) (-229.391) [-229.648] (-234.978) * (-231.035) (-230.288) [-228.454] (-230.080) -- 0:00:07
876000 -- (-231.956) (-230.757) [-231.621] (-229.413) * (-229.151) [-232.785] (-228.991) (-232.376) -- 0:00:07
876500 -- (-230.706) [-230.766] (-229.104) (-229.674) * (-235.099) [-229.770] (-229.149) (-229.462) -- 0:00:07
877000 -- [-230.853] (-229.616) (-232.837) (-229.067) * (-229.501) (-229.543) [-228.272] (-228.640) -- 0:00:07
877500 -- (-234.653) (-232.293) (-229.572) [-228.121] * [-229.810] (-233.324) (-230.342) (-233.187) -- 0:00:07
878000 -- (-231.232) (-230.718) [-229.912] (-230.034) * (-229.928) [-230.197] (-231.450) (-231.329) -- 0:00:07
878500 -- [-230.854] (-228.899) (-230.062) (-234.067) * (-230.612) (-229.095) [-231.049] (-233.199) -- 0:00:07
879000 -- (-231.281) (-229.069) (-230.299) [-227.969] * (-229.072) [-232.649] (-231.267) (-229.865) -- 0:00:07
879500 -- (-230.694) (-229.277) (-231.864) [-230.425] * (-231.824) (-232.259) [-229.102] (-228.732) -- 0:00:07
880000 -- (-229.961) (-230.180) [-231.770] (-228.290) * [-229.319] (-232.491) (-231.255) (-234.072) -- 0:00:07
Average standard deviation of split frequencies: 0.008631
880500 -- (-231.115) (-228.508) [-229.194] (-232.779) * (-230.084) (-230.683) (-230.649) [-232.746] -- 0:00:07
881000 -- (-230.410) (-230.800) [-230.178] (-228.110) * (-228.177) [-230.124] (-229.908) (-231.971) -- 0:00:07
881500 -- (-230.287) (-233.549) (-229.862) [-228.624] * (-230.279) (-231.698) (-229.121) [-229.205] -- 0:00:07
882000 -- [-229.188] (-236.501) (-231.224) (-230.287) * [-229.966] (-235.244) (-228.768) (-229.879) -- 0:00:07
882500 -- (-230.403) (-228.963) [-230.309] (-229.697) * [-228.763] (-229.360) (-231.686) (-233.117) -- 0:00:07
883000 -- (-230.230) (-231.525) (-229.113) [-230.275] * (-228.544) [-229.287] (-234.487) (-229.636) -- 0:00:07
883500 -- (-231.608) [-230.317] (-231.359) (-230.917) * [-230.002] (-233.212) (-230.381) (-233.519) -- 0:00:07
884000 -- (-234.213) (-230.283) (-229.872) [-228.354] * (-230.493) [-229.096] (-229.763) (-232.929) -- 0:00:07
884500 -- (-228.064) [-232.219] (-229.633) (-231.592) * [-232.057] (-230.156) (-230.062) (-228.108) -- 0:00:07
885000 -- (-229.622) [-232.501] (-230.938) (-229.286) * (-231.563) (-230.745) (-234.245) [-229.997] -- 0:00:07
Average standard deviation of split frequencies: 0.008546
885500 -- (-232.060) (-229.924) [-232.365] (-229.454) * [-229.891] (-231.753) (-228.941) (-231.442) -- 0:00:07
886000 -- [-231.333] (-229.496) (-228.545) (-228.199) * (-229.361) (-229.334) (-230.566) [-230.139] -- 0:00:07
886500 -- (-230.780) (-228.922) (-228.619) [-229.614] * [-228.020] (-229.911) (-230.236) (-231.236) -- 0:00:07
887000 -- (-231.250) (-229.697) [-230.048] (-237.881) * [-228.262] (-229.216) (-229.049) (-232.836) -- 0:00:07
887500 -- (-229.559) (-235.963) (-230.088) [-228.283] * (-229.462) (-232.557) (-229.356) [-229.436] -- 0:00:06
888000 -- (-229.398) (-232.678) (-228.577) [-232.748] * (-232.206) [-230.695] (-228.671) (-239.994) -- 0:00:06
888500 -- (-228.466) (-229.297) (-230.281) [-229.106] * (-232.337) [-231.005] (-230.009) (-234.650) -- 0:00:06
889000 -- (-229.122) [-233.199] (-232.162) (-233.969) * [-229.355] (-229.988) (-231.617) (-229.957) -- 0:00:06
889500 -- (-232.229) (-236.662) [-232.560] (-230.446) * (-228.540) (-230.290) [-231.031] (-229.531) -- 0:00:06
890000 -- [-229.352] (-233.183) (-231.714) (-230.392) * (-229.607) [-229.575] (-231.758) (-228.638) -- 0:00:06
Average standard deviation of split frequencies: 0.008080
890500 -- (-230.121) (-233.353) [-228.349] (-231.609) * [-230.519] (-229.123) (-228.724) (-229.696) -- 0:00:06
891000 -- (-230.115) (-236.451) [-229.899] (-230.435) * (-228.763) (-231.230) [-228.746] (-230.439) -- 0:00:06
891500 -- [-230.656] (-231.161) (-231.580) (-233.960) * (-230.257) (-236.825) [-229.073] (-229.544) -- 0:00:06
892000 -- (-230.283) [-233.348] (-230.003) (-228.883) * (-232.051) (-232.227) (-231.612) [-228.985] -- 0:00:06
892500 -- [-229.160] (-228.463) (-233.456) (-233.433) * [-228.987] (-230.727) (-230.527) (-228.092) -- 0:00:06
893000 -- (-230.125) (-230.068) [-233.490] (-233.266) * (-229.972) (-231.068) [-234.080] (-228.681) -- 0:00:06
893500 -- [-229.017] (-230.859) (-235.844) (-229.879) * (-231.719) [-229.346] (-232.819) (-229.820) -- 0:00:06
894000 -- (-232.047) (-230.577) (-232.997) [-231.291] * (-228.865) [-228.287] (-235.661) (-230.739) -- 0:00:06
894500 -- [-228.227] (-230.335) (-234.307) (-229.328) * (-229.424) [-230.552] (-229.865) (-232.229) -- 0:00:06
895000 -- (-231.201) [-228.460] (-232.053) (-229.842) * (-228.368) (-228.455) [-230.101] (-227.996) -- 0:00:06
Average standard deviation of split frequencies: 0.008313
895500 -- (-229.666) [-227.966] (-233.699) (-230.650) * (-229.777) (-230.337) [-229.788] (-230.059) -- 0:00:06
896000 -- (-228.395) (-228.916) [-232.391] (-230.270) * (-230.528) [-233.827] (-230.340) (-229.265) -- 0:00:06
896500 -- [-229.917] (-229.228) (-229.685) (-231.210) * (-230.351) (-229.719) [-230.828] (-233.384) -- 0:00:06
897000 -- (-231.191) (-228.947) [-229.826] (-230.710) * (-231.130) [-231.189] (-229.769) (-230.792) -- 0:00:06
897500 -- (-230.524) [-228.319] (-230.293) (-229.328) * (-231.310) (-235.460) (-230.054) [-230.769] -- 0:00:06
898000 -- (-228.801) (-228.669) [-228.451] (-230.187) * (-230.513) (-230.884) [-229.608] (-229.651) -- 0:00:06
898500 -- (-230.140) (-229.549) (-227.875) [-231.560] * [-230.905] (-229.467) (-229.604) (-229.100) -- 0:00:06
899000 -- (-230.193) [-228.658] (-231.358) (-228.107) * (-230.107) [-228.539] (-228.382) (-230.374) -- 0:00:06
899500 -- [-229.974] (-228.704) (-229.072) (-229.116) * (-229.021) (-232.974) [-229.761] (-231.521) -- 0:00:06
900000 -- (-229.217) (-230.187) [-229.458] (-233.299) * (-229.731) [-230.835] (-229.637) (-232.163) -- 0:00:06
Average standard deviation of split frequencies: 0.008619
900500 -- (-228.991) (-228.892) [-229.696] (-231.316) * [-229.663] (-230.466) (-231.053) (-231.160) -- 0:00:06
901000 -- (-233.289) (-230.543) [-230.581] (-230.456) * (-228.154) (-235.062) [-229.090] (-231.182) -- 0:00:06
901500 -- (-233.538) (-231.904) (-232.569) [-228.767] * (-231.205) (-231.529) [-229.824] (-232.462) -- 0:00:06
902000 -- (-233.239) (-230.498) [-229.681] (-229.169) * (-232.305) (-232.859) (-228.942) [-228.925] -- 0:00:06
902500 -- (-229.954) [-228.898] (-234.094) (-232.260) * (-229.488) (-230.245) [-231.890] (-228.740) -- 0:00:06
903000 -- (-228.595) [-230.205] (-233.030) (-228.915) * (-231.791) (-230.129) [-236.292] (-231.709) -- 0:00:06
903500 -- (-229.704) (-229.785) (-231.000) [-229.366] * (-229.175) [-228.965] (-233.597) (-228.975) -- 0:00:05
904000 -- (-232.783) (-231.893) [-234.276] (-231.059) * (-230.834) (-229.110) [-230.948] (-229.998) -- 0:00:05
904500 -- [-230.781] (-233.222) (-230.778) (-229.976) * (-230.991) [-229.450] (-231.527) (-229.213) -- 0:00:05
905000 -- (-228.292) [-231.023] (-229.435) (-229.801) * [-228.645] (-231.712) (-228.922) (-229.475) -- 0:00:05
Average standard deviation of split frequencies: 0.008707
905500 -- (-228.725) [-229.054] (-229.826) (-230.963) * (-229.845) (-230.599) (-229.536) [-228.843] -- 0:00:05
906000 -- [-228.899] (-229.118) (-231.631) (-230.914) * (-232.479) [-229.456] (-229.077) (-228.313) -- 0:00:05
906500 -- [-230.543] (-233.731) (-231.688) (-228.994) * [-232.683] (-230.073) (-231.974) (-232.102) -- 0:00:05
907000 -- (-228.347) (-228.768) (-232.718) [-230.264] * (-231.847) [-229.260] (-230.917) (-228.131) -- 0:00:05
907500 -- (-229.332) (-229.116) (-228.283) [-233.400] * (-229.958) (-227.928) [-230.548] (-231.479) -- 0:00:05
908000 -- (-233.165) [-229.281] (-229.783) (-233.171) * [-230.884] (-230.283) (-230.695) (-233.415) -- 0:00:05
908500 -- (-233.191) (-231.774) [-229.316] (-230.516) * [-228.718] (-230.437) (-230.720) (-228.600) -- 0:00:05
909000 -- [-229.689] (-230.955) (-228.287) (-234.223) * (-231.908) (-231.713) (-228.797) [-228.708] -- 0:00:05
909500 -- (-228.350) [-229.588] (-228.552) (-229.246) * [-229.827] (-232.311) (-230.566) (-230.701) -- 0:00:05
910000 -- (-232.338) [-229.718] (-230.533) (-230.821) * (-229.092) [-230.931] (-229.120) (-233.311) -- 0:00:05
Average standard deviation of split frequencies: 0.008558
910500 -- (-230.258) (-229.775) (-231.390) [-231.628] * (-233.983) (-229.772) (-229.004) [-230.684] -- 0:00:05
911000 -- (-232.635) [-231.170] (-229.499) (-228.960) * [-228.820] (-232.442) (-232.937) (-230.510) -- 0:00:05
911500 -- (-229.299) (-234.144) [-229.285] (-228.914) * (-230.067) [-229.125] (-230.912) (-231.383) -- 0:00:05
912000 -- [-231.242] (-230.637) (-231.643) (-231.040) * (-232.300) (-230.134) (-228.357) [-228.746] -- 0:00:05
912500 -- (-228.225) [-235.487] (-233.435) (-228.883) * (-229.297) [-229.414] (-229.609) (-231.745) -- 0:00:05
913000 -- (-228.129) [-231.293] (-233.318) (-230.315) * [-228.422] (-229.520) (-229.816) (-231.456) -- 0:00:05
913500 -- (-228.727) (-231.594) (-231.013) [-230.298] * (-228.148) (-228.697) [-227.963] (-229.125) -- 0:00:05
914000 -- (-229.088) (-229.029) (-229.221) [-230.082] * (-229.478) [-230.255] (-229.670) (-229.078) -- 0:00:05
914500 -- (-230.154) (-232.095) [-227.887] (-229.106) * (-233.786) (-231.284) [-229.462] (-231.396) -- 0:00:05
915000 -- (-231.791) [-235.588] (-231.250) (-229.289) * (-230.653) (-228.660) [-229.425] (-232.045) -- 0:00:05
Average standard deviation of split frequencies: 0.008303
915500 -- (-229.936) [-229.993] (-228.495) (-230.263) * [-228.803] (-231.224) (-233.218) (-231.253) -- 0:00:05
916000 -- (-229.281) (-228.328) [-228.397] (-231.411) * (-229.429) [-231.387] (-229.024) (-229.564) -- 0:00:05
916500 -- (-229.068) [-230.320] (-231.435) (-230.929) * (-232.043) (-230.399) [-232.517] (-229.648) -- 0:00:05
917000 -- (-232.828) (-230.712) [-230.173] (-235.661) * [-230.174] (-231.513) (-230.657) (-230.372) -- 0:00:05
917500 -- (-228.809) (-228.429) [-233.843] (-233.399) * [-229.670] (-228.281) (-231.250) (-229.999) -- 0:00:05
918000 -- (-231.902) [-227.974] (-229.526) (-230.671) * (-229.599) (-234.842) (-229.812) [-229.850] -- 0:00:05
918500 -- [-230.902] (-228.118) (-228.890) (-230.546) * [-228.596] (-230.561) (-232.106) (-231.661) -- 0:00:05
919000 -- (-232.091) (-228.267) [-229.624] (-227.964) * [-229.891] (-230.505) (-231.474) (-231.729) -- 0:00:05
919500 -- [-231.108] (-236.584) (-232.900) (-228.012) * [-236.366] (-229.910) (-230.932) (-230.166) -- 0:00:04
920000 -- [-229.617] (-230.963) (-231.557) (-233.214) * [-231.566] (-228.807) (-229.060) (-231.511) -- 0:00:04
Average standard deviation of split frequencies: 0.008363
920500 -- (-230.208) (-229.841) [-229.443] (-231.439) * [-232.553] (-234.507) (-230.857) (-228.965) -- 0:00:04
921000 -- (-236.182) (-230.618) (-230.861) [-232.521] * (-236.449) (-232.156) [-228.877] (-228.404) -- 0:00:04
921500 -- (-233.406) (-228.892) [-229.359] (-228.794) * (-229.764) (-230.599) (-229.005) [-233.055] -- 0:00:04
922000 -- (-231.492) (-228.857) (-229.752) [-230.543] * (-232.251) (-232.817) [-230.176] (-229.204) -- 0:00:04
922500 -- (-231.825) [-228.528] (-232.869) (-232.230) * [-228.358] (-232.207) (-231.467) (-233.047) -- 0:00:04
923000 -- (-230.071) [-228.901] (-229.323) (-231.300) * (-230.144) (-229.426) [-229.712] (-230.728) -- 0:00:04
923500 -- (-231.547) (-230.925) (-229.090) [-229.324] * (-231.713) [-228.967] (-233.437) (-231.255) -- 0:00:04
924000 -- (-229.293) (-231.006) [-229.712] (-231.751) * (-230.032) (-235.573) [-235.300] (-229.848) -- 0:00:04
924500 -- (-231.496) (-230.894) (-232.900) [-231.085] * (-230.954) (-231.792) [-230.566] (-229.137) -- 0:00:04
925000 -- (-231.515) (-235.397) [-232.623] (-229.808) * (-232.878) (-230.698) (-228.105) [-229.976] -- 0:00:04
Average standard deviation of split frequencies: 0.008722
925500 -- (-232.273) (-232.118) (-233.405) [-228.572] * (-229.479) (-237.320) [-229.296] (-228.641) -- 0:00:04
926000 -- (-231.342) [-230.025] (-233.822) (-228.078) * [-233.679] (-234.070) (-229.013) (-234.497) -- 0:00:04
926500 -- (-230.314) (-228.529) [-229.544] (-229.280) * (-233.422) (-229.732) (-235.338) [-231.425] -- 0:00:04
927000 -- (-229.246) (-228.559) (-230.696) [-231.036] * [-229.317] (-228.261) (-230.640) (-229.483) -- 0:00:04
927500 -- (-232.675) (-232.664) [-231.052] (-230.381) * [-228.431] (-230.938) (-229.634) (-230.077) -- 0:00:04
928000 -- (-229.769) (-230.608) [-228.616] (-229.734) * (-229.342) (-231.773) (-233.043) [-228.830] -- 0:00:04
928500 -- (-230.189) [-229.780] (-227.902) (-229.959) * [-229.223] (-229.327) (-230.572) (-229.398) -- 0:00:04
929000 -- [-229.866] (-230.937) (-233.776) (-230.174) * (-230.838) [-228.534] (-234.493) (-230.631) -- 0:00:04
929500 -- (-230.409) (-231.543) (-229.722) [-230.653] * [-229.468] (-228.375) (-234.718) (-230.795) -- 0:00:04
930000 -- (-228.341) (-230.251) (-230.191) [-231.096] * (-228.861) [-230.671] (-232.051) (-234.018) -- 0:00:04
Average standard deviation of split frequencies: 0.008915
930500 -- (-231.521) (-231.744) (-230.860) [-232.360] * (-231.471) [-233.304] (-230.538) (-228.684) -- 0:00:04
931000 -- (-233.748) [-228.261] (-229.317) (-230.382) * (-235.677) (-232.703) [-229.680] (-231.989) -- 0:00:04
931500 -- (-229.867) [-230.114] (-228.804) (-229.517) * (-238.419) [-231.693] (-229.268) (-230.471) -- 0:00:04
932000 -- [-229.169] (-229.043) (-229.206) (-229.219) * [-233.424] (-231.686) (-233.283) (-230.070) -- 0:00:04
932500 -- [-229.508] (-229.839) (-230.976) (-230.476) * (-233.559) (-229.788) [-229.094] (-232.299) -- 0:00:04
933000 -- (-228.667) [-229.518] (-229.250) (-228.472) * (-230.472) (-231.945) (-230.248) [-233.751] -- 0:00:04
933500 -- (-235.578) (-231.085) (-229.213) [-231.163] * (-232.203) [-231.323] (-230.707) (-231.513) -- 0:00:04
934000 -- (-230.790) [-229.827] (-229.112) (-232.543) * (-232.603) (-230.315) [-232.358] (-229.248) -- 0:00:04
934500 -- (-230.490) [-228.562] (-229.040) (-228.805) * (-230.288) (-230.784) (-235.714) [-229.077] -- 0:00:03
935000 -- (-232.555) [-232.456] (-230.480) (-229.727) * (-231.256) [-230.255] (-231.612) (-229.968) -- 0:00:04
Average standard deviation of split frequencies: 0.008998
935500 -- (-229.473) [-230.042] (-228.584) (-234.028) * (-230.723) (-230.944) (-229.812) [-229.441] -- 0:00:03
936000 -- (-228.721) (-229.818) (-230.689) [-231.937] * (-230.134) (-231.675) [-228.663] (-229.782) -- 0:00:03
936500 -- (-232.442) (-228.222) [-229.282] (-234.145) * [-230.257] (-229.722) (-229.091) (-232.416) -- 0:00:03
937000 -- (-230.199) (-230.341) [-229.104] (-235.751) * (-234.314) (-229.341) (-229.700) [-228.227] -- 0:00:03
937500 -- (-229.542) (-234.067) (-228.779) [-231.688] * (-232.368) [-229.609] (-231.963) (-228.632) -- 0:00:03
938000 -- [-230.669] (-234.899) (-233.184) (-229.158) * [-229.834] (-232.479) (-231.347) (-230.788) -- 0:00:03
938500 -- (-229.652) (-232.256) [-231.438] (-230.377) * (-229.993) [-228.746] (-233.045) (-231.810) -- 0:00:03
939000 -- (-228.853) (-230.080) (-231.962) [-232.647] * (-230.177) [-228.980] (-237.142) (-231.402) -- 0:00:03
939500 -- (-229.556) [-230.028] (-230.998) (-233.958) * (-230.413) (-231.766) [-229.286] (-231.434) -- 0:00:03
940000 -- [-231.092] (-230.631) (-231.403) (-229.185) * (-235.217) [-231.000] (-229.231) (-231.815) -- 0:00:03
Average standard deviation of split frequencies: 0.009240
940500 -- (-229.322) [-229.275] (-232.289) (-231.533) * (-231.149) [-230.185] (-231.008) (-228.325) -- 0:00:03
941000 -- (-229.459) [-229.500] (-231.688) (-230.931) * [-231.115] (-235.644) (-228.855) (-229.034) -- 0:00:03
941500 -- (-230.811) (-228.085) (-229.669) [-231.086] * (-230.229) (-231.875) [-228.706] (-228.631) -- 0:00:03
942000 -- (-230.877) [-228.973] (-229.130) (-229.749) * (-232.333) (-232.069) (-227.958) [-228.419] -- 0:00:03
942500 -- (-230.709) (-229.912) [-230.606] (-229.654) * (-232.145) (-232.578) (-228.339) [-230.041] -- 0:00:03
943000 -- (-228.669) [-229.116] (-231.732) (-231.024) * (-233.608) [-232.414] (-228.303) (-229.953) -- 0:00:03
943500 -- (-229.526) [-228.222] (-228.413) (-228.479) * (-233.410) (-229.067) (-229.183) [-235.497] -- 0:00:03
944000 -- (-229.070) [-228.494] (-230.926) (-230.080) * (-231.211) (-229.312) [-229.626] (-230.379) -- 0:00:03
944500 -- [-229.941] (-229.424) (-231.357) (-229.029) * (-231.379) [-228.505] (-235.690) (-229.335) -- 0:00:03
945000 -- (-228.171) [-228.701] (-230.819) (-229.269) * (-228.879) (-227.833) (-229.643) [-228.637] -- 0:00:03
Average standard deviation of split frequencies: 0.009343
945500 -- (-229.368) (-229.590) [-230.817] (-229.472) * (-228.893) [-227.867] (-228.738) (-230.378) -- 0:00:03
946000 -- (-230.237) [-230.026] (-231.444) (-227.945) * (-231.166) [-228.972] (-229.611) (-230.473) -- 0:00:03
946500 -- (-229.214) [-229.249] (-233.276) (-229.450) * (-231.742) (-231.419) (-229.530) [-229.788] -- 0:00:03
947000 -- (-228.900) (-228.765) (-229.956) [-228.702] * [-232.207] (-229.839) (-232.204) (-229.049) -- 0:00:03
947500 -- (-229.631) (-228.216) (-229.505) [-230.552] * (-232.117) (-228.920) [-229.121] (-237.231) -- 0:00:03
948000 -- (-228.973) (-228.666) [-228.650] (-229.450) * (-231.437) (-232.467) (-232.015) [-231.304] -- 0:00:03
948500 -- (-235.942) (-228.829) (-229.072) [-229.179] * (-231.634) (-233.257) (-228.865) [-229.563] -- 0:00:03
949000 -- (-230.306) (-233.552) (-229.214) [-228.511] * (-231.826) [-229.970] (-230.883) (-227.925) -- 0:00:03
949500 -- [-229.107] (-229.860) (-229.772) (-229.198) * (-230.779) (-230.249) (-228.244) [-230.242] -- 0:00:03
950000 -- [-229.267] (-230.183) (-228.305) (-230.351) * [-234.583] (-231.129) (-228.828) (-232.798) -- 0:00:03
Average standard deviation of split frequencies: 0.009700
950500 -- [-230.701] (-230.709) (-230.172) (-230.568) * (-233.500) (-228.306) [-230.322] (-231.407) -- 0:00:03
951000 -- (-233.264) [-230.060] (-230.039) (-230.517) * [-230.755] (-228.975) (-229.286) (-230.291) -- 0:00:02
951500 -- (-231.129) [-228.143] (-230.878) (-231.517) * (-230.387) [-228.513] (-230.354) (-228.865) -- 0:00:02
952000 -- (-233.173) (-228.658) [-229.776] (-231.297) * (-229.840) [-231.629] (-231.268) (-228.063) -- 0:00:02
952500 -- (-234.870) (-229.727) [-231.314] (-231.249) * (-229.307) (-229.079) (-230.980) [-230.393] -- 0:00:02
953000 -- [-229.632] (-229.343) (-229.416) (-229.431) * (-229.352) [-230.755] (-229.481) (-233.768) -- 0:00:02
953500 -- [-229.179] (-233.884) (-230.829) (-231.268) * (-229.109) [-228.534] (-230.221) (-228.928) -- 0:00:02
954000 -- (-229.460) (-231.867) (-229.795) [-229.884] * (-228.302) (-230.042) [-230.406] (-231.734) -- 0:00:02
954500 -- (-231.177) (-228.754) [-228.743] (-229.025) * [-229.772] (-230.513) (-228.612) (-230.182) -- 0:00:02
955000 -- (-229.928) (-232.348) [-230.555] (-229.796) * (-231.174) (-232.179) [-231.657] (-228.272) -- 0:00:02
Average standard deviation of split frequencies: 0.009492
955500 -- (-231.763) (-229.371) [-232.526] (-228.786) * (-228.608) (-232.317) (-231.190) [-230.316] -- 0:00:02
956000 -- (-237.073) [-229.723] (-231.254) (-233.160) * (-229.121) [-229.672] (-231.709) (-228.410) -- 0:00:02
956500 -- (-230.181) (-229.298) (-229.815) [-232.277] * (-229.334) [-230.342] (-231.394) (-231.357) -- 0:00:02
957000 -- (-230.719) (-229.878) [-228.354] (-228.374) * (-229.142) [-230.104] (-229.335) (-230.025) -- 0:00:02
957500 -- [-229.571] (-229.071) (-231.556) (-228.234) * (-229.112) (-233.604) [-230.014] (-230.438) -- 0:00:02
958000 -- [-230.367] (-228.238) (-231.419) (-230.653) * (-229.290) (-230.919) (-229.601) [-228.925] -- 0:00:02
958500 -- (-232.008) (-227.971) (-229.003) [-230.625] * [-231.267] (-230.682) (-228.323) (-229.846) -- 0:00:02
959000 -- [-229.602] (-230.168) (-230.900) (-232.686) * (-232.094) [-230.229] (-231.337) (-231.051) -- 0:00:02
959500 -- (-229.159) [-229.193] (-230.887) (-231.916) * (-230.438) (-229.297) [-231.235] (-229.169) -- 0:00:02
960000 -- (-231.901) (-228.982) [-233.000] (-228.999) * (-233.418) (-230.193) (-229.036) [-232.626] -- 0:00:02
Average standard deviation of split frequencies: 0.009507
960500 -- (-229.114) [-228.573] (-231.104) (-230.455) * (-231.628) (-230.067) [-233.205] (-232.074) -- 0:00:02
961000 -- [-228.546] (-232.468) (-232.571) (-230.727) * [-231.153] (-229.653) (-229.611) (-232.866) -- 0:00:02
961500 -- (-228.315) (-228.121) (-231.869) [-232.433] * (-229.437) (-231.281) [-231.559] (-228.300) -- 0:00:02
962000 -- (-227.873) (-228.122) (-231.347) [-229.459] * (-229.938) (-232.539) (-230.364) [-230.651] -- 0:00:02
962500 -- [-228.934] (-229.310) (-238.051) (-229.573) * (-230.818) (-230.852) (-229.926) [-233.001] -- 0:00:02
963000 -- (-230.414) (-230.025) (-232.034) [-229.457] * [-229.417] (-229.827) (-231.749) (-233.922) -- 0:00:02
963500 -- (-232.099) (-233.768) (-229.234) [-228.561] * (-230.335) (-230.974) [-230.515] (-232.214) -- 0:00:02
964000 -- (-231.361) (-229.264) [-230.165] (-230.247) * (-228.827) [-232.633] (-228.389) (-230.353) -- 0:00:02
964500 -- (-231.600) [-230.216] (-228.341) (-231.664) * [-231.286] (-228.900) (-229.421) (-231.284) -- 0:00:02
965000 -- (-228.765) (-232.395) [-229.601] (-230.656) * (-229.733) (-228.110) (-228.112) [-229.243] -- 0:00:02
Average standard deviation of split frequencies: 0.009363
965500 -- (-230.323) (-231.724) (-230.491) [-228.384] * (-232.326) (-229.072) (-232.894) [-229.097] -- 0:00:02
966000 -- [-229.769] (-228.802) (-230.029) (-231.083) * (-231.041) (-228.117) (-232.312) [-230.355] -- 0:00:02
966500 -- (-231.357) (-229.915) (-229.124) [-229.990] * (-228.048) (-228.545) [-228.307] (-228.934) -- 0:00:02
967000 -- (-230.863) (-229.791) (-229.229) [-231.555] * [-230.978] (-231.911) (-228.959) (-230.478) -- 0:00:02
967500 -- [-230.360] (-230.472) (-228.575) (-230.246) * (-229.727) (-230.474) (-230.458) [-228.830] -- 0:00:01
968000 -- (-230.861) (-229.506) [-232.851] (-231.377) * [-228.486] (-230.662) (-229.213) (-229.598) -- 0:00:01
968500 -- [-230.851] (-228.313) (-229.331) (-231.332) * (-233.308) [-231.551] (-228.467) (-230.868) -- 0:00:01
969000 -- [-230.819] (-232.316) (-228.685) (-229.929) * (-233.821) (-234.807) [-230.832] (-234.183) -- 0:00:01
969500 -- [-233.065] (-231.777) (-233.763) (-231.684) * (-229.573) (-230.055) [-231.345] (-230.484) -- 0:00:01
970000 -- [-228.869] (-231.273) (-231.536) (-231.262) * (-230.526) (-231.267) (-229.618) [-230.187] -- 0:00:01
Average standard deviation of split frequencies: 0.009318
970500 -- [-231.775] (-230.079) (-233.550) (-229.035) * (-233.058) (-230.084) [-231.677] (-229.588) -- 0:00:01
971000 -- (-230.222) (-229.758) (-230.767) [-229.889] * [-229.951] (-231.845) (-231.058) (-230.543) -- 0:00:01
971500 -- (-234.010) (-232.883) (-231.636) [-231.955] * [-229.182] (-229.164) (-230.714) (-230.569) -- 0:00:01
972000 -- (-231.073) (-229.679) [-230.159] (-231.491) * (-228.640) (-231.247) (-230.750) [-228.309] -- 0:00:01
972500 -- (-231.771) [-230.091] (-230.314) (-228.523) * (-233.123) [-230.921] (-232.027) (-228.024) -- 0:00:01
973000 -- (-230.498) (-231.258) (-230.875) [-229.069] * (-233.365) (-232.510) (-233.897) [-228.138] -- 0:00:01
973500 -- (-231.348) [-229.698] (-230.679) (-231.595) * (-236.354) (-233.599) [-232.303] (-232.446) -- 0:00:01
974000 -- (-230.253) [-228.523] (-230.422) (-229.293) * (-231.337) [-231.581] (-231.065) (-231.680) -- 0:00:01
974500 -- [-232.092] (-229.473) (-232.326) (-228.628) * (-230.425) (-229.477) (-231.572) [-228.981] -- 0:00:01
975000 -- (-234.645) [-228.974] (-230.395) (-230.230) * [-233.456] (-230.555) (-230.697) (-228.783) -- 0:00:01
Average standard deviation of split frequencies: 0.009056
975500 -- [-230.420] (-229.184) (-230.789) (-233.044) * [-234.261] (-230.445) (-231.663) (-232.003) -- 0:00:01
976000 -- (-229.572) (-229.155) [-233.471] (-229.226) * (-231.223) (-230.211) [-231.842] (-231.474) -- 0:00:01
976500 -- [-231.908] (-229.240) (-234.617) (-231.421) * [-231.566] (-230.714) (-228.494) (-236.163) -- 0:00:01
977000 -- (-234.219) [-229.376] (-230.426) (-230.339) * (-231.702) [-229.168] (-230.255) (-229.355) -- 0:00:01
977500 -- (-230.139) (-227.971) [-229.534] (-229.696) * (-232.921) (-228.464) (-231.728) [-229.972] -- 0:00:01
978000 -- (-230.980) (-229.051) (-233.626) [-229.678] * [-227.972] (-234.118) (-229.719) (-232.642) -- 0:00:01
978500 -- (-237.256) [-230.034] (-230.215) (-229.758) * [-228.180] (-230.208) (-229.371) (-234.944) -- 0:00:01
979000 -- (-231.344) [-228.963] (-228.611) (-231.981) * (-232.983) (-229.353) [-230.019] (-230.586) -- 0:00:01
979500 -- (-228.900) [-229.786] (-232.546) (-231.341) * (-233.206) (-228.264) [-230.653] (-229.343) -- 0:00:01
980000 -- (-230.139) (-230.037) (-229.659) [-230.214] * (-230.044) (-232.634) (-228.885) [-230.854] -- 0:00:01
Average standard deviation of split frequencies: 0.009043
980500 -- (-229.995) (-229.025) [-228.368] (-228.212) * [-229.643] (-232.343) (-233.138) (-231.882) -- 0:00:01
981000 -- (-230.827) [-228.946] (-229.472) (-228.605) * (-229.607) (-229.713) (-229.333) [-229.983] -- 0:00:01
981500 -- [-230.491] (-230.174) (-227.910) (-229.548) * (-228.342) [-232.449] (-230.030) (-231.537) -- 0:00:01
982000 -- (-228.904) (-229.762) (-228.122) [-229.030] * (-232.285) [-231.773] (-229.502) (-231.070) -- 0:00:01
982500 -- [-228.635] (-229.936) (-228.478) (-230.749) * (-232.318) (-234.407) [-228.521] (-229.496) -- 0:00:01
983000 -- (-233.315) (-230.077) [-230.934] (-228.411) * (-232.538) [-232.833] (-230.549) (-229.127) -- 0:00:01
983500 -- (-229.863) [-228.145] (-235.313) (-229.395) * (-229.786) (-233.213) (-229.795) [-230.339] -- 0:00:01
984000 -- (-229.256) (-229.582) [-231.135] (-228.934) * (-228.202) [-230.158] (-235.374) (-232.658) -- 0:00:00
984500 -- [-233.319] (-231.757) (-230.421) (-228.429) * (-227.918) (-233.130) (-236.395) [-229.583] -- 0:00:00
985000 -- [-229.167] (-232.131) (-229.800) (-228.245) * (-230.810) [-229.128] (-234.492) (-228.918) -- 0:00:00
Average standard deviation of split frequencies: 0.009024
985500 -- (-230.124) (-228.989) (-230.242) [-229.807] * (-230.583) (-228.578) [-229.518] (-230.778) -- 0:00:00
986000 -- (-230.373) (-229.824) [-231.536] (-241.705) * (-229.971) [-230.489] (-232.347) (-229.688) -- 0:00:00
986500 -- [-228.773] (-230.928) (-228.190) (-228.688) * (-231.338) [-228.338] (-234.674) (-229.409) -- 0:00:00
987000 -- [-227.943] (-231.666) (-229.521) (-230.837) * (-230.480) [-230.671] (-227.927) (-229.570) -- 0:00:00
987500 -- (-228.058) [-232.621] (-232.682) (-230.145) * (-227.882) (-232.069) (-230.511) [-229.139] -- 0:00:00
988000 -- (-229.883) (-229.538) [-234.035] (-234.399) * (-234.305) (-229.681) (-229.757) [-229.617] -- 0:00:00
988500 -- (-231.667) [-230.939] (-237.054) (-230.272) * (-233.641) (-232.727) [-230.064] (-228.567) -- 0:00:00
989000 -- [-229.792] (-230.333) (-231.167) (-229.669) * [-229.199] (-233.805) (-229.679) (-232.910) -- 0:00:00
989500 -- [-232.744] (-232.552) (-234.461) (-232.157) * (-231.046) (-233.854) [-228.233] (-231.488) -- 0:00:00
990000 -- (-228.874) (-229.170) (-235.438) [-235.629] * (-233.910) [-229.217] (-232.605) (-234.007) -- 0:00:00
Average standard deviation of split frequencies: 0.009279
990500 -- (-232.975) (-228.691) (-228.947) [-230.547] * (-229.755) [-232.053] (-231.690) (-230.903) -- 0:00:00
991000 -- (-230.701) (-229.627) (-229.527) [-232.279] * (-228.977) (-231.858) [-229.416] (-231.119) -- 0:00:00
991500 -- (-232.228) [-229.513] (-229.122) (-230.812) * (-229.664) (-230.534) (-234.178) [-228.402] -- 0:00:00
992000 -- (-234.738) [-229.734] (-229.430) (-229.447) * (-229.577) (-233.865) (-230.411) [-228.593] -- 0:00:00
992500 -- (-232.133) (-230.115) (-232.065) [-230.119] * (-229.515) [-234.041] (-228.142) (-228.356) -- 0:00:00
993000 -- (-228.668) [-228.463] (-234.177) (-230.189) * [-230.241] (-230.075) (-227.744) (-228.175) -- 0:00:00
993500 -- (-230.040) (-230.544) (-231.349) [-228.353] * (-228.344) (-229.271) [-234.398] (-232.886) -- 0:00:00
994000 -- [-228.631] (-231.762) (-229.556) (-228.342) * [-228.637] (-229.527) (-231.951) (-237.168) -- 0:00:00
994500 -- [-231.241] (-230.556) (-231.873) (-228.876) * [-228.945] (-230.319) (-231.451) (-229.533) -- 0:00:00
995000 -- (-230.086) (-234.498) [-231.311] (-236.401) * (-228.663) [-229.757] (-232.923) (-231.259) -- 0:00:00
Average standard deviation of split frequencies: 0.009496
995500 -- (-227.816) [-228.051] (-230.515) (-228.585) * (-230.880) [-231.259] (-231.932) (-231.480) -- 0:00:00
996000 -- (-230.249) (-228.277) (-230.450) [-229.022] * (-236.778) (-228.650) (-229.943) [-231.018] -- 0:00:00
996500 -- (-231.627) [-232.935] (-233.656) (-233.340) * [-233.859] (-231.453) (-231.196) (-231.088) -- 0:00:00
997000 -- [-231.779] (-228.960) (-233.558) (-231.282) * [-231.377] (-229.519) (-231.458) (-232.035) -- 0:00:00
997500 -- [-230.081] (-229.961) (-229.031) (-230.508) * (-230.682) (-229.095) [-228.907] (-230.667) -- 0:00:00
998000 -- (-230.033) (-231.955) [-229.707] (-232.771) * (-234.270) (-230.045) (-231.557) [-229.740] -- 0:00:00
998500 -- (-230.082) (-231.905) [-229.427] (-229.887) * [-228.354] (-232.737) (-230.074) (-229.328) -- 0:00:00
999000 -- (-229.244) [-229.016] (-231.544) (-229.871) * (-232.483) (-231.870) [-230.072] (-232.131) -- 0:00:00
999500 -- [-231.654] (-231.934) (-231.708) (-228.932) * (-229.873) [-232.658] (-230.911) (-231.219) -- 0:00:00
1000000 -- (-231.216) (-229.766) [-231.325] (-235.760) * (-230.821) (-228.840) (-229.295) [-229.592] -- 0:00:00
Average standard deviation of split frequencies: 0.009392
Analysis completed in 1 mins 2 seconds
Analysis used 60.46 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -227.72
Likelihood of best state for "cold" chain of run 2 was -227.72
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 77 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
50.4 % ( 45 %) Dirichlet(Pi{all})
46.7 % ( 36 %) Slider(Pi{all})
78.5 % ( 56 %) Multiplier(Alpha{1,2})
77.9 % ( 53 %) Multiplier(Alpha{3})
28.1 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.8 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 68 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
50.7 % ( 49 %) Dirichlet(Pi{all})
46.4 % ( 30 %) Slider(Pi{all})
78.4 % ( 48 %) Multiplier(Alpha{1,2})
78.1 % ( 59 %) Multiplier(Alpha{3})
28.2 % ( 28 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 97 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.3 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167529 0.82 0.67
3 | 166378 166379 0.83
4 | 166719 167008 165987
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166404 0.82 0.67
3 | 167312 166710 0.84
4 | 166390 166777 166407
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -229.40
| 1 |
| 2 1 |
| 1 2 2 2 |
| 2 2 2 1 22 1 |
|2 2 11 2 2 1 2 2 1 2 11 1 2 2 1 |
| 11 1 22 2 2 11 1 * 2 2 1 |
| 2 122 * 112 2 * 1 2 1*1 1 |
|1122 1 1 2 1 1 1 1 1 1 2 * 2|
| 2 2 2 2 1 2 1 2 *2 2 |
| 1 1 112* |
| 12 2 2 2 1 1|
| 1 2 22 2 1 2 |
| 1 1 |
| 1 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -231.22
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -229.48 -232.31
2 -229.48 -232.38
--------------------------------------
TOTAL -229.48 -232.35
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890708 0.092928 0.345102 1.498527 0.852784 1501.00 1501.00 1.000
r(A<->C){all} 0.161265 0.020819 0.000081 0.460901 0.119808 124.53 220.27 1.015
r(A<->G){all} 0.165899 0.019086 0.000210 0.440352 0.125234 186.26 197.67 1.006
r(A<->T){all} 0.169447 0.020613 0.000079 0.457314 0.129172 242.44 246.95 1.001
r(C<->G){all} 0.165707 0.019357 0.000056 0.453417 0.128977 108.87 136.82 1.000
r(C<->T){all} 0.170025 0.021562 0.000094 0.463068 0.129575 188.42 200.28 1.009
r(G<->T){all} 0.167658 0.020013 0.000016 0.439750 0.129626 157.40 212.51 1.000
pi(A){all} 0.171605 0.000813 0.120855 0.233208 0.170406 1250.37 1308.89 1.000
pi(C){all} 0.302566 0.001215 0.236268 0.370567 0.301735 1239.91 1245.60 1.000
pi(G){all} 0.354708 0.001339 0.283707 0.424079 0.353825 1053.91 1083.99 1.000
pi(T){all} 0.171121 0.000788 0.117881 0.225774 0.169970 1090.29 1164.32 1.000
alpha{1,2} 0.419989 0.227413 0.000430 1.428350 0.251080 1150.20 1199.10 1.000
alpha{3} 0.459637 0.240464 0.000153 1.395052 0.308159 1052.52 1276.76 1.000
pinvar{all} 0.989927 0.000145 0.967280 0.999996 0.993776 1217.32 1284.08 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- ...**.
9 -- .**...
10 -- .*.***
11 -- ..****
12 -- .**.**
13 -- ..*.*.
14 -- .*..*.
15 -- ...*.*
16 -- .****.
17 -- .***.*
18 -- ..**..
19 -- .*.*..
20 -- ..*..*
21 -- ....**
22 -- ...***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 472 0.157229 0.015075 0.146569 0.167888 2
8 468 0.155896 0.013191 0.146569 0.165223 2
9 450 0.149900 0.014133 0.139907 0.159893 2
10 439 0.146236 0.007066 0.141239 0.151233 2
11 438 0.145903 0.006595 0.141239 0.150566 2
12 436 0.145237 0.015075 0.134577 0.155896 2
13 434 0.144570 0.011306 0.136576 0.152565 2
14 430 0.143238 0.013191 0.133911 0.152565 2
15 429 0.142905 0.017430 0.130580 0.155230 2
16 425 0.141572 0.008009 0.135909 0.147235 2
17 420 0.139907 0.008480 0.133911 0.145903 2
18 411 0.136909 0.000471 0.136576 0.137242 2
19 404 0.134577 0.000942 0.133911 0.135243 2
20 394 0.131246 0.000942 0.130580 0.131912 2
21 381 0.126915 0.011777 0.118588 0.135243 2
22 288 0.095936 0.006595 0.091272 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099877 0.009640 0.000031 0.301572 0.068942 1.000 2
length{all}[2] 0.099301 0.009470 0.000078 0.295510 0.069883 1.000 2
length{all}[3] 0.096180 0.009732 0.000014 0.294538 0.064771 1.000 2
length{all}[4] 0.098376 0.009608 0.000039 0.289535 0.068907 1.000 2
length{all}[5] 0.097686 0.010327 0.000059 0.296221 0.066507 1.000 2
length{all}[6] 0.097859 0.009138 0.000002 0.290707 0.070758 1.000 2
length{all}[7] 0.102196 0.012640 0.000263 0.312916 0.062785 1.003 2
length{all}[8] 0.098294 0.009227 0.000667 0.291639 0.067367 0.998 2
length{all}[9] 0.101391 0.010319 0.000531 0.313366 0.066134 0.999 2
length{all}[10] 0.099863 0.009864 0.000227 0.303269 0.067690 1.000 2
length{all}[11] 0.106436 0.011162 0.000060 0.295817 0.073488 0.998 2
length{all}[12] 0.102560 0.010673 0.000155 0.322482 0.070964 0.998 2
length{all}[13] 0.104710 0.011194 0.000254 0.310500 0.070004 1.000 2
length{all}[14] 0.102096 0.009507 0.000251 0.313705 0.070730 0.999 2
length{all}[15] 0.086399 0.009037 0.000324 0.282668 0.056616 1.002 2
length{all}[16] 0.098697 0.010037 0.000239 0.300012 0.067877 1.000 2
length{all}[17] 0.106928 0.011502 0.000212 0.304456 0.072335 0.998 2
length{all}[18] 0.094728 0.009330 0.000086 0.262536 0.064772 0.998 2
length{all}[19] 0.093697 0.009639 0.000796 0.299012 0.062905 1.002 2
length{all}[20] 0.108066 0.009954 0.000161 0.299569 0.079824 1.000 2
length{all}[21] 0.101454 0.008951 0.000019 0.292173 0.072994 0.999 2
length{all}[22] 0.105152 0.010257 0.000342 0.294425 0.074465 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009392
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 171
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 28 patterns at 57 / 57 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 28 patterns at 57 / 57 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
27328 bytes for conP
2464 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018138 0.094312 0.077760 0.093458 0.051438 0.090363 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -239.115402
Iterating by ming2
Initial: fx= 239.115402
x= 0.01814 0.09431 0.07776 0.09346 0.05144 0.09036 0.30000 1.30000
1 h-m-p 0.0000 0.0003 135.8060 +++ 233.130520 m 0.0003 14 | 1/8
2 h-m-p 0.0011 0.0105 35.4022 -----------.. | 1/8
3 h-m-p 0.0000 0.0006 124.1393 +++ 223.879467 m 0.0006 46 | 2/8
4 h-m-p 0.0024 0.0138 28.1458 ------------.. | 2/8
5 h-m-p 0.0000 0.0005 111.5503 +++ 217.950288 m 0.0005 79 | 3/8
6 h-m-p 0.0022 0.0200 21.0965 ------------.. | 3/8
7 h-m-p 0.0000 0.0002 97.0007 +++ 215.801201 m 0.0002 112 | 4/8
8 h-m-p 0.0012 0.0302 15.3010 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 79.3649 ++ 215.448051 m 0.0001 143 | 5/8
10 h-m-p 0.0003 0.0481 10.1505 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 56.1466 ++ 215.399245 m 0.0000 173 | 6/8
12 h-m-p 0.0161 8.0000 0.0000 --------Y 215.399245 0 0.0000 192 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 --------Y 215.399245 0 0.0000 213
Out..
lnL = -215.399245
214 lfun, 214 eigenQcodon, 1284 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106677 0.072536 0.097021 0.042542 0.064284 0.075591 0.299708 0.543983 0.468545
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.420020
np = 9
lnL0 = -240.822660
Iterating by ming2
Initial: fx= 240.822660
x= 0.10668 0.07254 0.09702 0.04254 0.06428 0.07559 0.29971 0.54398 0.46854
1 h-m-p 0.0000 0.0008 132.8766 ++++ 226.902617 m 0.0008 16 | 1/9
2 h-m-p 0.0005 0.0025 58.3883 ++ 220.769216 m 0.0025 28 | 2/9
3 h-m-p 0.0001 0.0003 303.5648 ++ 218.470932 m 0.0003 40 | 3/9
4 h-m-p 0.0001 0.0003 225.9575 ++ 218.045512 m 0.0003 52 | 4/9
5 h-m-p 0.0000 0.0000 38769.5788 ++ 217.110575 m 0.0000 64 | 4/9
6 h-m-p 0.0008 0.0039 110.7046 -----------.. | 4/9
7 h-m-p 0.0000 0.0002 79.4950 +++ 215.943227 m 0.0002 98 | 5/9
8 h-m-p 0.0000 0.0000 2.8050 ----.. | 5/9
9 h-m-p 0.0000 0.0002 56.7437 +++ 215.399268 m 0.0002 125 | 6/9
10 h-m-p 0.5266 8.0000 0.0000 ++ 215.399268 m 8.0000 137 | 6/9
11 h-m-p 0.0103 0.0514 0.0011 ----C 215.399268 0 0.0000 156 | 6/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 215.399268 m 8.0000 174 | 6/9
13 h-m-p 0.0002 0.0009 0.4598 -----Y 215.399268 0 0.0000 194 | 6/9
14 h-m-p 0.0160 8.0000 0.0001 +++++ 215.399268 m 8.0000 212 | 6/9
15 h-m-p 0.0007 0.0036 0.4023 -------Y 215.399268 0 0.0000 234 | 6/9
16 h-m-p 0.0160 8.0000 0.0001 +++++ 215.399268 m 8.0000 252 | 6/9
17 h-m-p 0.0012 0.0061 0.3383 --------Y 215.399268 0 0.0000 275 | 6/9
18 h-m-p 0.0160 8.0000 0.0000 -------C 215.399268 0 0.0000 297 | 6/9
19 h-m-p 0.0160 8.0000 0.0001 +++++ 215.399268 m 8.0000 315 | 6/9
20 h-m-p 0.0016 0.0079 0.3534 -------Y 215.399268 0 0.0000 337 | 6/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 215.399268 m 8.0000 355 | 6/9
22 h-m-p 0.0005 0.0067 0.4549 ---------Y 215.399268 0 0.0000 379 | 6/9
23 h-m-p 0.0160 8.0000 0.0000 -Y 215.399268 0 0.0010 395 | 6/9
24 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
25 h-m-p 0.0160 8.0000 0.0001 +++++ 215.399268 m 8.0000 439 | 6/9
26 h-m-p 0.0038 1.9148 0.3049 +++++ 215.399248 m 1.9148 457 | 7/9
27 h-m-p 1.6000 8.0000 0.0397 ++ 215.399247 m 8.0000 472 | 7/9
28 h-m-p 0.0267 0.1333 4.4785 ----------C 215.399247 0 0.0000 496 | 7/9
29 h-m-p 0.0471 8.0000 0.0000 ++++ 215.399247 m 8.0000 510 | 7/9
30 h-m-p 0.0491 8.0000 0.0001 ++++ 215.399247 m 8.0000 526 | 7/9
31 h-m-p 0.0000 0.0021 278.7892 --------.. | 7/9
32 h-m-p 0.0160 8.0000 0.0000 +++++ 215.399247 m 8.0000 561 | 7/9
33 h-m-p 0.0251 8.0000 0.0046 --------Y 215.399247 0 0.0000 583 | 7/9
34 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
35 h-m-p 0.0160 8.0000 0.0000 +++++ 215.399247 m 8.0000 625 | 7/9
36 h-m-p 0.0160 8.0000 0.1824 ----------C 215.399247 0 0.0000 649 | 7/9
37 h-m-p 0.0160 8.0000 0.0000 --C 215.399247 0 0.0003 665 | 7/9
38 h-m-p 0.0160 8.0000 0.0000 +++++ 215.399247 m 8.0000 682 | 7/9
39 h-m-p 0.0003 0.1531 5.6876 ----------.. | 7/9
40 h-m-p 0.0160 8.0000 0.0000 +++++ 215.399247 m 8.0000 719 | 7/9
41 h-m-p 0.0288 8.0000 0.0042 +++++ 215.399246 m 8.0000 736 | 7/9
42 h-m-p 0.0274 8.0000 1.2327 -------------Y 215.399246 0 0.0000 763 | 7/9
43 h-m-p 0.0361 8.0000 0.0000 -C 215.399246 0 0.0021 776 | 7/9
44 h-m-p 0.0160 8.0000 0.0000 -----------N 215.399246 0 0.0000 801
Out..
lnL = -215.399246
802 lfun, 2406 eigenQcodon, 9624 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.016269 0.029021 0.097983 0.085593 0.030526 0.033553 0.007778 1.492433 0.423035 0.255029 1.347708
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.842580
np = 11
lnL0 = -231.345742
Iterating by ming2
Initial: fx= 231.345742
x= 0.01627 0.02902 0.09798 0.08559 0.03053 0.03355 0.00778 1.49243 0.42303 0.25503 1.34771
1 h-m-p 0.0000 0.0003 128.6150 +++ 226.205810 m 0.0003 17 | 1/11
2 h-m-p 0.0004 0.0020 41.2291 ++ 223.464617 m 0.0020 31 | 2/11
3 h-m-p 0.0000 0.0001 88.3459 ++ 223.190156 m 0.0001 45 | 3/11
4 h-m-p 0.0002 0.0009 24.3385 ++ 222.211293 m 0.0009 59 | 4/11
5 h-m-p 0.0001 0.0003 30.7409 ++ 222.083097 m 0.0003 73 | 5/11
6 h-m-p 0.0000 0.0022 189.0111 +++ 219.676392 m 0.0022 88 | 6/11
7 h-m-p 0.0017 0.0087 37.4316 ++ 215.399259 m 0.0087 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0741 ++ 215.399247 m 8.0000 116 | 7/11
9 h-m-p 0.0516 0.2582 0.5559 ++ 215.399245 m 0.2582 134 | 8/11
10 h-m-p 0.5695 8.0000 0.0314 ++ 215.399244 m 8.0000 152 | 8/11
11 h-m-p 0.3390 8.0000 0.7403 +C 215.399244 0 1.3560 170 | 8/11
12 h-m-p 1.6000 8.0000 0.0723 C 215.399244 0 1.3496 187 | 8/11
13 h-m-p 1.6000 8.0000 0.0057 Y 215.399244 0 0.9165 204 | 8/11
14 h-m-p 1.6000 8.0000 0.0002 ++ 215.399244 m 8.0000 221 | 8/11
15 h-m-p 0.2267 8.0000 0.0062 ++C 215.399244 0 4.3632 240 | 8/11
16 h-m-p 1.6000 8.0000 0.0001 ++ 215.399244 m 8.0000 257 | 8/11
17 h-m-p 0.0085 4.2332 1.4445 -----------Y 215.399244 0 0.0000 285 | 8/11
18 h-m-p 0.0027 1.3444 2.1723 ++++Y 215.399244 0 0.4390 303 | 8/11
19 h-m-p 1.6000 8.0000 0.0322 Y 215.399244 0 1.1739 317 | 8/11
20 h-m-p 1.6000 8.0000 0.0018 Y 215.399244 0 3.2487 334 | 8/11
21 h-m-p 1.6000 8.0000 0.0004 ++ 215.399244 m 8.0000 351 | 8/11
22 h-m-p 0.0247 8.0000 0.1210 +++Y 215.399244 0 2.7902 371 | 8/11
23 h-m-p 1.6000 8.0000 0.0376 ++ 215.399243 m 8.0000 388 | 8/11
24 h-m-p 0.0073 0.2529 41.0608 +Y 215.399242 0 0.0293 406 | 8/11
25 h-m-p 0.5487 2.7437 0.2549 -----------C 215.399242 0 0.0000 431 | 8/11
26 h-m-p 0.0160 8.0000 0.6310 +++C 215.399242 0 1.0240 451 | 8/11
27 h-m-p 1.6000 8.0000 0.0186 Y 215.399242 0 1.0626 468 | 8/11
28 h-m-p 1.6000 8.0000 0.0008 ----------Y 215.399242 0 0.0000 495
Out..
lnL = -215.399242
496 lfun, 1984 eigenQcodon, 8928 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -215.400369 S = -215.398262 -0.000804
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 28 patterns 0:06
did 20 / 28 patterns 0:06
did 28 / 28 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031422 0.096784 0.102897 0.018475 0.063077 0.055270 0.000100 0.910495 1.187888
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 12.859699
np = 9
lnL0 = -235.690050
Iterating by ming2
Initial: fx= 235.690050
x= 0.03142 0.09678 0.10290 0.01847 0.06308 0.05527 0.00011 0.91050 1.18789
1 h-m-p 0.0000 0.0000 130.9362 ++ 235.439975 m 0.0000 14 | 1/9
2 h-m-p 0.0002 0.0950 9.8242 ----------.. | 1/9
3 h-m-p 0.0000 0.0003 131.0472 +++ 229.785736 m 0.0003 47 | 2/9
4 h-m-p 0.0049 0.1192 8.0003 ------------.. | 2/9
5 h-m-p 0.0000 0.0002 121.6066 +++ 226.265563 m 0.0002 82 | 3/9
6 h-m-p 0.0049 0.2001 5.2750 ------------.. | 3/9
7 h-m-p 0.0000 0.0004 109.7933 +++ 220.964940 m 0.0004 117 | 4/9
8 h-m-p 0.0124 0.5385 3.3209 -------------.. | 4/9
9 h-m-p 0.0000 0.0001 96.7551 ++ 219.640600 m 0.0001 152 | 5/9
10 h-m-p 0.0040 0.5922 2.8035 ------------.. | 5/9
11 h-m-p 0.0000 0.0006 79.1300 +++ 215.759051 m 0.0006 187 | 6/9
12 h-m-p 0.0121 0.6551 2.8299 -------------.. | 6/9
13 h-m-p 0.0000 0.0001 57.0127 ++ 215.399269 m 0.0001 222 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 215.399269 m 8.0000 234 | 7/9
15 h-m-p 0.1259 8.0000 0.0000 ---------------.. | 7/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 215.399269 m 8.0000 278 | 7/9
17 h-m-p 0.0043 2.1294 0.9114 ++++
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
+ 215.399246 m 2.1294 295
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44938, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44913, 0.00500) = 1.000000e+00 2000 rounds
| 8/9
18 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.44930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44926, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.44926, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
Y 215.399246 0 0.0250 311
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44938, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44913, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.44925, 0.00500) = 1.000000e+00 2000 rounds
| 8/9
19 h-m-p 0.0160 8.0000 5.1481
QuantileBeta(0.85, 2.53162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.77874, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.76718, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 7.72095, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 23.53603, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 43.63437, 0.00500) = 1.000000e+00 2000 rounds
+ 215.399246 m 8.0000 327
QuantileBeta(0.85, 43.63437, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.63437, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.63437, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.63437, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.63437, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.63437, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.63437, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.63439, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.63437, 0.00500) = 1.000000e+00 2000 rounds
| 8/9
20 h-m-p 0.2617 1.3083 33.3486
QuantileBeta(0.85, 34.90850, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.45290, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 43.08900, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 43.49803, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.63437, 0.00500) = 1.000000e+00 2000 rounds
Y 215.399246 0 0.0010 342
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60031, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
| 8/9
21 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
N 215.399246 0 1.6000 354
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60100, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.59957, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
| 8/9
22 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
Y 215.399246 0 0.0160 367
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -215.399246
368 lfun, 4048 eigenQcodon, 22080 P(t)
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 43.60029, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031192 0.018815 0.022622 0.016640 0.094860 0.074693 0.000100 0.900000 1.073496 1.478673 1.300256
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.732651
np = 11
lnL0 = -229.668477
Iterating by ming2
Initial: fx= 229.668477
x= 0.03119 0.01881 0.02262 0.01664 0.09486 0.07469 0.00011 0.90000 1.07350 1.47867 1.30026
1 h-m-p 0.0000 0.0000 131.6142 ++ 229.286517 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0047 38.2353 +++ 223.998398 m 0.0047 31 | 2/11
3 h-m-p 0.0000 0.0001 59.8165 ++ 223.372007 m 0.0001 45 | 3/11
4 h-m-p 0.0005 0.0038 17.4051 ++ 223.171930 m 0.0038 59 | 4/11
5 h-m-p 0.0001 0.0006 901.9468 ++ 221.850748 m 0.0006 73 | 4/11
6 h-m-p 0.0002 0.0011 42.2475 ++ 221.230445 m 0.0011 87 | 5/11
7 h-m-p 0.0001 0.0004 94.6520 ++ 220.119332 m 0.0004 101 | 5/11
8 h-m-p 0.0049 0.2960 8.1239 ------------.. | 5/11
9 h-m-p 0.0000 0.0004 78.7343 +++ 217.528518 m 0.0004 140 | 6/11
10 h-m-p 0.0040 0.1800 5.7630 ------------.. | 6/11
11 h-m-p 0.0000 0.0007 56.0528 ++++ 215.399263 m 0.0007 180 | 7/11
12 h-m-p 1.6000 8.0000 0.0000 ++ 215.399263 m 8.0000 194 | 7/11
13 h-m-p 0.0000 0.0002 0.0183 ++ 215.399263 m 0.0002 212 | 7/11
14 h-m-p -0.0000 -0.0000 0.1159
h-m-p: -0.00000000e+00 -0.00000000e+00 1.15945228e-01 215.399263
.. | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 215.399263 m 8.0000 248 | 7/11
16 h-m-p 0.0020 0.9812 0.9966 +++++ 215.399242 m 0.9812 269 | 8/11
17 h-m-p 0.7371 3.6857 0.5369 +
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+ 215.399232 m 3.6857 287
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82839, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
18 h-m-p -0.0000 -0.0000 1.2747
h-m-p: -2.89697749e-17 -1.44848875e-16 1.27474687e+00 215.399232
..
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
19 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+ 215.399232 m 8.0000 318
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82839, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
20 h-m-p 0.0160 8.0000 0.0067
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+ 215.399231 m 8.0000 338
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82839, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
21 h-m-p 0.0439 8.0000 1.2237
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+ 215.399218 m 8.0000 357
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
22 h-m-p 1.6000 8.0000 0.4826
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+ 215.399217 m 8.0000 371
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82839, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
23 h-m-p 0.9258 8.0000 4.1705
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+ 215.399215 m 8.0000 388
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
24 h-m-p 1.6000 8.0000 1.9209
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
+ 215.399215 m 8.0000 402
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
25 h-m-p 1.6000 8.0000 3.7967
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-..
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
26 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
N 215.399215 0 0.0000 450
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -215.399215
451 lfun, 5412 eigenQcodon, 29766 P(t)
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -215.397970 S = -215.397905 -0.000028
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 28 patterns 0:20
did 20 / 28 patterns 0:21
did 28 / 28 patterns 0:21
QuantileBeta(0.85, 2.82853, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=57
NC_011896_1_WP_010907574_1_178_MLBR_RS00870 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
NC_002677_1_NP_301249_1_121_rpmF MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
NZ_CP029543_1_WP_010907574_1_178_rpmF MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
NZ_AP014567_1_WP_010907574_1_184_rpmF MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
**************************************************
NC_011896_1_WP_010907574_1_178_MLBR_RS00870 LIDLDRR
NC_002677_1_NP_301249_1_121_rpmF LIDLDRR
NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045 LIDLDRR
NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435 LIDLDRR
NZ_CP029543_1_WP_010907574_1_178_rpmF LIDLDRR
NZ_AP014567_1_WP_010907574_1_184_rpmF LIDLDRR
*******
>NC_011896_1_WP_010907574_1_178_MLBR_RS00870 ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT CTTATCGACCTTGACCGGCGT >NC_002677_1_NP_301249_1_121_rpmF ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT CTTATCGACCTTGACCGGCGT >NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045 ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT CTTATCGACCTTGACCGGCGT >NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435 ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT CTTATCGACCTTGACCGGCGT >NZ_CP029543_1_WP_010907574_1_178_rpmF ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT CTTATCGACCTTGACCGGCGT >NZ_AP014567_1_WP_010907574_1_184_rpmF ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT CTTATCGACCTTGACCGGCGT
>NC_011896_1_WP_010907574_1_178_MLBR_RS00870 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG LIDLDRR >NC_002677_1_NP_301249_1_121_rpmF MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG LIDLDRR >NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG LIDLDRR >NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435 MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG LIDLDRR >NZ_CP029543_1_WP_010907574_1_178_rpmF MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG LIDLDRR >NZ_AP014567_1_WP_010907574_1_184_rpmF MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG LIDLDRR
#NEXUS
[ID: 0256297858]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907574_1_178_MLBR_RS00870
NC_002677_1_NP_301249_1_121_rpmF
NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045
NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435
NZ_CP029543_1_WP_010907574_1_178_rpmF
NZ_AP014567_1_WP_010907574_1_184_rpmF
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907574_1_178_MLBR_RS00870,
2 NC_002677_1_NP_301249_1_121_rpmF,
3 NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045,
4 NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435,
5 NZ_CP029543_1_WP_010907574_1_178_rpmF,
6 NZ_AP014567_1_WP_010907574_1_184_rpmF
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06894229,2:0.06988251,3:0.06477143,4:0.06890659,5:0.0665073,6:0.07075788);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06894229,2:0.06988251,3:0.06477143,4:0.06890659,5:0.0665073,6:0.07075788);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -229.48 -232.31
2 -229.48 -232.38
--------------------------------------
TOTAL -229.48 -232.35
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890708 0.092928 0.345102 1.498527 0.852784 1501.00 1501.00 1.000
r(A<->C){all} 0.161265 0.020819 0.000081 0.460901 0.119808 124.53 220.27 1.015
r(A<->G){all} 0.165899 0.019086 0.000210 0.440352 0.125234 186.26 197.67 1.006
r(A<->T){all} 0.169447 0.020613 0.000079 0.457314 0.129172 242.44 246.95 1.001
r(C<->G){all} 0.165707 0.019357 0.000056 0.453417 0.128977 108.87 136.82 1.000
r(C<->T){all} 0.170025 0.021562 0.000094 0.463068 0.129575 188.42 200.28 1.009
r(G<->T){all} 0.167658 0.020013 0.000016 0.439750 0.129626 157.40 212.51 1.000
pi(A){all} 0.171605 0.000813 0.120855 0.233208 0.170406 1250.37 1308.89 1.000
pi(C){all} 0.302566 0.001215 0.236268 0.370567 0.301735 1239.91 1245.60 1.000
pi(G){all} 0.354708 0.001339 0.283707 0.424079 0.353825 1053.91 1083.99 1.000
pi(T){all} 0.171121 0.000788 0.117881 0.225774 0.169970 1090.29 1164.32 1.000
alpha{1,2} 0.419989 0.227413 0.000430 1.428350 0.251080 1150.20 1199.10 1.000
alpha{3} 0.459637 0.240464 0.000153 1.395052 0.308159 1052.52 1276.76 1.000
pinvar{all} 0.989927 0.000145 0.967280 0.999996 0.993776 1217.32 1284.08 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpmF/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 57
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 5 5 5 5 5 5
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 2 2 2 2 2 2 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 1 1 1 1 1 1 | ACC 2 2 2 2 2 2 | AAC 1 1 1 1 1 1 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 4 4 4 4 4 4 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 3 3 3 3 3 3 | Asp GAT 0 0 0 0 0 0 | Gly GGT 3 3 3 3 3 3
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 2 2 2 2 2 2 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 0 0 0 0 0 0
GTG 3 3 3 3 3 3 | GCG 4 4 4 4 4 4 | GAG 1 1 1 1 1 1 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907574_1_178_MLBR_RS00870
position 1: T:0.03509 C:0.38596 A:0.26316 G:0.31579
position 2: T:0.22807 C:0.26316 A:0.19298 G:0.31579
position 3: T:0.24561 C:0.26316 A:0.05263 G:0.43860
Average T:0.16959 C:0.30409 A:0.16959 G:0.35673
#2: NC_002677_1_NP_301249_1_121_rpmF
position 1: T:0.03509 C:0.38596 A:0.26316 G:0.31579
position 2: T:0.22807 C:0.26316 A:0.19298 G:0.31579
position 3: T:0.24561 C:0.26316 A:0.05263 G:0.43860
Average T:0.16959 C:0.30409 A:0.16959 G:0.35673
#3: NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045
position 1: T:0.03509 C:0.38596 A:0.26316 G:0.31579
position 2: T:0.22807 C:0.26316 A:0.19298 G:0.31579
position 3: T:0.24561 C:0.26316 A:0.05263 G:0.43860
Average T:0.16959 C:0.30409 A:0.16959 G:0.35673
#4: NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435
position 1: T:0.03509 C:0.38596 A:0.26316 G:0.31579
position 2: T:0.22807 C:0.26316 A:0.19298 G:0.31579
position 3: T:0.24561 C:0.26316 A:0.05263 G:0.43860
Average T:0.16959 C:0.30409 A:0.16959 G:0.35673
#5: NZ_CP029543_1_WP_010907574_1_178_rpmF
position 1: T:0.03509 C:0.38596 A:0.26316 G:0.31579
position 2: T:0.22807 C:0.26316 A:0.19298 G:0.31579
position 3: T:0.24561 C:0.26316 A:0.05263 G:0.43860
Average T:0.16959 C:0.30409 A:0.16959 G:0.35673
#6: NZ_AP014567_1_WP_010907574_1_184_rpmF
position 1: T:0.03509 C:0.38596 A:0.26316 G:0.31579
position 2: T:0.22807 C:0.26316 A:0.19298 G:0.31579
position 3: T:0.24561 C:0.26316 A:0.05263 G:0.43860
Average T:0.16959 C:0.30409 A:0.16959 G:0.35673
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 0 | TCC 0 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 12
CTC 6 | CCC 0 | CAC 6 | CGC 30
CTA 6 | CCA 0 | Gln Q CAA 0 | CGA 0
CTG 0 | CCG 0 | CAG 12 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 0
ATC 6 | ACC 12 | AAC 6 | AGC 6
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 12 | ACG 6 | AAG 24 | AGG 12
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 18 | Asp D GAT 0 | Gly G GGT 18
GTC 6 | GCC 0 | GAC 12 | GGC 0
GTA 0 | GCA 6 | Glu E GAA 0 | GGA 0
GTG 18 | GCG 24 | GAG 6 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.03509 C:0.38596 A:0.26316 G:0.31579
position 2: T:0.22807 C:0.26316 A:0.19298 G:0.31579
position 3: T:0.24561 C:0.26316 A:0.05263 G:0.43860
Average T:0.16959 C:0.30409 A:0.16959 G:0.35673
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -215.399245 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299708 1.300256
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907574_1_178_MLBR_RS00870: 0.000004, NC_002677_1_NP_301249_1_121_rpmF: 0.000004, NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045: 0.000004, NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435: 0.000004, NZ_CP029543_1_WP_010907574_1_178_rpmF: 0.000004, NZ_AP014567_1_WP_010907574_1_184_rpmF: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29971
omega (dN/dS) = 1.30026
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 127.2 43.8 1.3003 0.0000 0.0000 0.0 0.0
7..2 0.000 127.2 43.8 1.3003 0.0000 0.0000 0.0 0.0
7..3 0.000 127.2 43.8 1.3003 0.0000 0.0000 0.0 0.0
7..4 0.000 127.2 43.8 1.3003 0.0000 0.0000 0.0 0.0
7..5 0.000 127.2 43.8 1.3003 0.0000 0.0000 0.0 0.0
7..6 0.000 127.2 43.8 1.3003 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -215.399246 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.007778 0.000010 0.572578
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907574_1_178_MLBR_RS00870: 0.000004, NC_002677_1_NP_301249_1_121_rpmF: 0.000004, NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045: 0.000004, NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435: 0.000004, NZ_CP029543_1_WP_010907574_1_178_rpmF: 0.000004, NZ_AP014567_1_WP_010907574_1_184_rpmF: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00778
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.57258 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -215.399242 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.180016 0.522188 1.000000 1.634127
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907574_1_178_MLBR_RS00870: 0.000004, NC_002677_1_NP_301249_1_121_rpmF: 0.000004, NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045: 0.000004, NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435: 0.000004, NZ_CP029543_1_WP_010907574_1_178_rpmF: 0.000004, NZ_AP014567_1_WP_010907574_1_184_rpmF: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.18002 0.52219 0.29780
w: 1.00000 1.00000 1.63413
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 127.4 43.6 1.1888 0.0000 0.0000 0.0 0.0
7..2 0.000 127.4 43.6 1.1888 0.0000 0.0000 0.0 0.0
7..3 0.000 127.4 43.6 1.1888 0.0000 0.0000 0.0 0.0
7..4 0.000 127.4 43.6 1.1888 0.0000 0.0000 0.0 0.0
7..5 0.000 127.4 43.6 1.1888 0.0000 0.0000 0.0 0.0
7..6 0.000 127.4 43.6 1.1888 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907574_1_178_MLBR_RS00870)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907574_1_178_MLBR_RS00870)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -215.399246 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 43.600285 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907574_1_178_MLBR_RS00870: 0.000004, NC_002677_1_NP_301249_1_121_rpmF: 0.000004, NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045: 0.000004, NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435: 0.000004, NZ_CP029543_1_WP_010907574_1_178_rpmF: 0.000004, NZ_AP014567_1_WP_010907574_1_184_rpmF: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 43.60029 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 127.4 43.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:12
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -215.399215 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 2.828531 0.005000 64.567238
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907574_1_178_MLBR_RS00870: 0.000004, NC_002677_1_NP_301249_1_121_rpmF: 0.000004, NZ_LVXE01000071_1_WP_010907574_1_2582_A3216_RS13045: 0.000004, NZ_LYPH01000058_1_WP_010907574_1_2183_A8144_RS10435: 0.000004, NZ_CP029543_1_WP_010907574_1_178_rpmF: 0.000004, NZ_AP014567_1_WP_010907574_1_184_rpmF: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 2.82853 q = 0.00500
(p1 = 0.99999) w = 64.56724
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 64.56724
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 127.4 43.6 64.5666 0.0000 0.0000 0.0 0.0
7..2 0.000 127.4 43.6 64.5666 0.0000 0.0000 0.0 0.0
7..3 0.000 127.4 43.6 64.5666 0.0000 0.0000 0.0 0.0
7..4 0.000 127.4 43.6 64.5666 0.0000 0.0000 0.0 0.0
7..5 0.000 127.4 43.6 64.5666 0.0000 0.0000 0.0 0.0
7..6 0.000 127.4 43.6 64.5666 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907574_1_178_MLBR_RS00870)
Pr(w>1) post mean +- SE for w
1 M 1.000** 64.567
2 A 1.000** 64.567
3 T 1.000** 64.567
4 P 1.000** 64.567
5 K 1.000** 64.567
6 R 1.000** 64.567
7 R 1.000** 64.567
8 M 1.000** 64.567
9 S 1.000** 64.567
10 R 1.000** 64.567
11 A 1.000** 64.567
12 N 1.000** 64.567
13 T 1.000** 64.567
14 R 1.000** 64.567
15 S 1.000** 64.567
16 R 1.000** 64.567
17 R 1.000** 64.567
18 A 1.000** 64.567
19 Q 1.000** 64.567
20 W 1.000** 64.567
21 K 1.000** 64.567
22 A 1.000** 64.567
23 A 1.000** 64.567
24 R 1.000** 64.567
25 T 1.000** 64.567
26 E 1.000** 64.567
27 L 1.000** 64.567
28 V 1.000** 64.567
29 G 1.000** 64.567
30 V 1.000** 64.567
31 T 1.000** 64.567
32 V 1.000** 64.567
33 A 1.000** 64.567
34 G 1.000** 64.567
35 Q 1.000** 64.567
36 R 1.000** 64.567
37 H 1.000** 64.567
38 K 1.000** 64.567
39 V 1.000** 64.567
40 P 1.000** 64.567
41 R 1.000** 64.567
42 R 1.000** 64.567
43 L 1.000** 64.567
44 L 1.000** 64.567
45 K 1.000** 64.567
46 A 1.000** 64.567
47 A 1.000** 64.567
48 R 1.000** 64.567
49 L 1.000** 64.567
50 G 1.000** 64.567
51 L 1.000** 64.567
52 I 1.000** 64.567
53 D 1.000** 64.567
54 L 1.000** 64.567
55 D 1.000** 64.567
56 R 1.000** 64.567
57 R 1.000** 64.567
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907574_1_178_MLBR_RS00870)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:21
Model 1: NearlyNeutral -215.399246 Model 2: PositiveSelection -215.399242 Model 0: one-ratio -215.399245 Model 7: beta -215.399246 Model 8: beta&w>1 -215.399215 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 8.00000003664536E-6 Model 8 vs 7 6.20000000139953E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
