--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:01:53 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpmF/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -229.48          -232.31
2       -229.48          -232.38
--------------------------------------
TOTAL     -229.48          -232.35
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.890708    0.092928    0.345102    1.498527    0.852784   1501.00   1501.00    1.000
r(A<->C){all}   0.161265    0.020819    0.000081    0.460901    0.119808    124.53    220.27    1.015
r(A<->G){all}   0.165899    0.019086    0.000210    0.440352    0.125234    186.26    197.67    1.006
r(A<->T){all}   0.169447    0.020613    0.000079    0.457314    0.129172    242.44    246.95    1.001
r(C<->G){all}   0.165707    0.019357    0.000056    0.453417    0.128977    108.87    136.82    1.000
r(C<->T){all}   0.170025    0.021562    0.000094    0.463068    0.129575    188.42    200.28    1.009
r(G<->T){all}   0.167658    0.020013    0.000016    0.439750    0.129626    157.40    212.51    1.000
pi(A){all}      0.171605    0.000813    0.120855    0.233208    0.170406   1250.37   1308.89    1.000
pi(C){all}      0.302566    0.001215    0.236268    0.370567    0.301735   1239.91   1245.60    1.000
pi(G){all}      0.354708    0.001339    0.283707    0.424079    0.353825   1053.91   1083.99    1.000
pi(T){all}      0.171121    0.000788    0.117881    0.225774    0.169970   1090.29   1164.32    1.000
alpha{1,2}      0.419989    0.227413    0.000430    1.428350    0.251080   1150.20   1199.10    1.000
alpha{3}        0.459637    0.240464    0.000153    1.395052    0.308159   1052.52   1276.76    1.000
pinvar{all}     0.989927    0.000145    0.967280    0.999996    0.993776   1217.32   1284.08    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-215.399246
Model 2: PositiveSelection	-215.399242
Model 0: one-ratio	-215.399245
Model 7: beta	-215.399246
Model 8: beta&w>1	-215.399215


Model 0 vs 1	1.9999999949504854E-6

Model 2 vs 1	8.00000003664536E-6

Model 8 vs 7	6.20000000139953E-5
>C1
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C2
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C3
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C4
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C5
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C6
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=57 

C1              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C2              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C3              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C4              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C5              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C6              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
                **************************************************

C1              LIDLDRR
C2              LIDLDRR
C3              LIDLDRR
C4              LIDLDRR
C5              LIDLDRR
C6              LIDLDRR
                *******




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   57 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   57 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1710]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [1710]--->[1710]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.437 Mb, Max= 30.568 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C2              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C3              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C4              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C5              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
C6              MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
                **************************************************

C1              LIDLDRR
C2              LIDLDRR
C3              LIDLDRR
C4              LIDLDRR
C5              LIDLDRR
C6              LIDLDRR
                *******




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
C2              ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
C3              ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
C4              ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
C5              ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
C6              ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
                **************************************************

C1              CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
C2              CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
C3              CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
C4              CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
C5              CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
C6              CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
                **************************************************

C1              GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
C2              GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
C3              GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
C4              GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
C5              GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
C6              GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
                **************************************************

C1              CTTATCGACCTTGACCGGCGT
C2              CTTATCGACCTTGACCGGCGT
C3              CTTATCGACCTTGACCGGCGT
C4              CTTATCGACCTTGACCGGCGT
C5              CTTATCGACCTTGACCGGCGT
C6              CTTATCGACCTTGACCGGCGT
                *********************



>C1
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C2
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C3
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C4
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C5
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C6
ATGGCTACACCTAAGCGCAGGATGTCGCGCGCGAACACCCGCAGCCGGCG
CGCGCAGTGGAAGGCTGCTCGGACCGAGCTTGTCGGTGTGACGGTGGCGG
GTCAGCGGCACAAGGTGCCTCGCAGGCTACTCAAGGCGGCACGTCTTGGT
CTTATCGACCTTGACCGGCGT
>C1
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C2
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C3
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C4
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C5
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR
>C6
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLG
LIDLDRR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 171 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579791626
      Setting output file names to "/data/11res/rpmF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1923730328
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0256297858
      Seed = 885538468
      Swapseed = 1579791626
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -382.706175 -- -24.965149
         Chain 2 -- -382.706139 -- -24.965149
         Chain 3 -- -382.706197 -- -24.965149
         Chain 4 -- -382.706197 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -382.706175 -- -24.965149
         Chain 2 -- -382.706197 -- -24.965149
         Chain 3 -- -382.706175 -- -24.965149
         Chain 4 -- -382.706197 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-382.706] (-382.706) (-382.706) (-382.706) * [-382.706] (-382.706) (-382.706) (-382.706) 
        500 -- (-241.036) (-244.387) [-236.981] (-247.470) * (-234.109) [-240.678] (-238.949) (-239.012) -- 0:00:00
       1000 -- (-237.667) [-244.514] (-235.807) (-240.257) * (-239.284) (-235.507) (-243.147) [-244.354] -- 0:00:00
       1500 -- (-240.752) (-239.400) [-238.446] (-239.523) * (-243.433) [-234.432] (-235.032) (-250.431) -- 0:00:00
       2000 -- [-239.868] (-248.677) (-238.641) (-240.654) * (-243.917) (-237.392) [-235.576] (-256.615) -- 0:00:00
       2500 -- (-232.288) [-232.186] (-245.388) (-232.690) * [-239.107] (-239.130) (-236.981) (-255.128) -- 0:00:00
       3000 -- [-235.217] (-248.599) (-232.553) (-239.706) * (-245.641) (-234.975) [-235.701] (-249.450) -- 0:00:00
       3500 -- (-237.788) [-235.407] (-251.123) (-248.909) * (-238.931) (-242.349) [-237.728] (-237.620) -- 0:00:00
       4000 -- [-241.525] (-241.220) (-236.885) (-248.264) * [-234.398] (-239.556) (-233.924) (-238.799) -- 0:00:00
       4500 -- (-233.787) (-243.249) [-241.402] (-247.388) * (-238.807) (-234.743) [-235.556] (-242.241) -- 0:00:00
       5000 -- (-238.380) (-237.253) [-244.688] (-241.771) * (-238.048) [-234.407] (-242.009) (-237.660) -- 0:00:00

      Average standard deviation of split frequencies: 0.098209

       5500 -- [-237.793] (-238.797) (-245.279) (-238.293) * [-233.574] (-241.891) (-234.802) (-239.009) -- 0:00:00
       6000 -- (-242.148) (-237.143) (-257.450) [-228.887] * [-240.477] (-248.009) (-237.680) (-234.113) -- 0:00:00
       6500 -- (-239.448) (-239.165) (-249.748) [-228.470] * (-239.397) (-245.026) (-246.594) [-237.288] -- 0:00:00
       7000 -- (-236.155) [-236.793] (-244.319) (-231.217) * [-239.054] (-239.330) (-240.794) (-241.214) -- 0:00:00
       7500 -- [-238.054] (-242.532) (-241.985) (-228.385) * (-242.777) (-230.480) (-235.514) [-240.968] -- 0:00:00
       8000 -- (-238.830) (-243.208) (-241.996) [-229.895] * (-241.758) [-230.427] (-240.488) (-246.967) -- 0:00:00
       8500 -- (-237.374) (-244.148) [-245.969] (-230.997) * (-240.683) [-230.001] (-239.524) (-243.511) -- 0:00:00
       9000 -- (-244.107) [-238.100] (-237.567) (-229.722) * [-238.939] (-228.815) (-236.658) (-245.697) -- 0:00:00
       9500 -- (-239.611) [-234.765] (-229.014) (-229.027) * [-234.418] (-229.442) (-241.087) (-259.566) -- 0:00:00
      10000 -- (-245.762) (-237.401) (-228.658) [-229.231] * [-247.065] (-229.448) (-243.240) (-246.995) -- 0:01:39

      Average standard deviation of split frequencies: 0.090598

      10500 -- (-245.863) (-245.162) (-228.213) [-228.790] * (-242.569) [-229.841] (-243.285) (-239.958) -- 0:01:34
      11000 -- (-246.596) (-241.314) [-228.602] (-229.258) * (-241.023) [-228.457] (-236.209) (-241.182) -- 0:01:29
      11500 -- (-243.666) (-241.568) [-231.186] (-230.982) * (-241.098) (-228.895) [-239.578] (-235.864) -- 0:01:25
      12000 -- [-231.085] (-251.671) (-232.951) (-228.307) * (-242.175) [-228.630] (-243.914) (-228.376) -- 0:01:22
      12500 -- (-231.539) (-236.207) (-231.591) [-229.298] * [-242.741] (-228.749) (-252.765) (-228.599) -- 0:01:19
      13000 -- (-229.112) [-235.088] (-233.583) (-229.951) * (-239.568) [-229.629] (-253.583) (-230.992) -- 0:01:15
      13500 -- [-229.106] (-235.841) (-228.984) (-228.681) * [-239.232] (-229.099) (-246.736) (-232.011) -- 0:01:13
      14000 -- [-232.619] (-240.451) (-228.435) (-229.484) * [-236.666] (-228.472) (-243.107) (-228.410) -- 0:01:10
      14500 -- (-228.624) (-257.159) [-231.738] (-229.854) * (-239.082) (-228.547) (-239.610) [-231.294] -- 0:01:07
      15000 -- (-234.087) (-236.648) (-231.293) [-229.214] * (-240.700) [-233.259] (-235.425) (-229.060) -- 0:01:05

      Average standard deviation of split frequencies: 0.075294

      15500 -- (-230.554) (-231.363) [-228.708] (-231.208) * (-239.558) (-228.261) (-232.919) [-228.774] -- 0:01:03
      16000 -- (-228.437) (-232.222) [-228.354] (-231.268) * (-239.169) (-232.275) (-229.594) [-228.323] -- 0:01:01
      16500 -- (-234.800) (-228.048) (-229.371) [-229.878] * (-242.652) (-230.105) [-234.231] (-229.400) -- 0:00:59
      17000 -- [-229.006] (-228.980) (-236.467) (-230.972) * (-243.097) (-229.991) [-228.561] (-231.804) -- 0:00:57
      17500 -- [-229.673] (-228.772) (-235.788) (-228.874) * (-235.818) (-229.418) [-230.635] (-230.004) -- 0:00:56
      18000 -- (-229.656) (-232.125) [-230.841] (-229.254) * [-238.259] (-233.853) (-231.195) (-228.809) -- 0:00:54
      18500 -- (-228.821) (-228.063) [-232.646] (-228.646) * [-238.956] (-233.936) (-229.375) (-231.692) -- 0:00:53
      19000 -- (-230.944) [-228.670] (-228.348) (-230.751) * [-237.855] (-231.277) (-229.362) (-230.681) -- 0:00:51
      19500 -- (-230.766) (-230.258) (-228.359) [-230.623] * (-243.055) (-232.389) [-229.389] (-231.449) -- 0:00:50
      20000 -- (-229.201) (-232.679) [-230.007] (-228.850) * (-245.023) (-232.198) [-229.470] (-228.997) -- 0:00:49

      Average standard deviation of split frequencies: 0.062094

      20500 -- (-231.922) (-232.672) [-228.669] (-229.550) * [-243.328] (-228.829) (-229.232) (-229.979) -- 0:00:47
      21000 -- (-229.840) (-229.138) (-229.650) [-229.574] * [-238.705] (-230.157) (-229.713) (-228.343) -- 0:00:46
      21500 -- (-229.394) [-230.080] (-232.004) (-228.803) * (-235.747) [-230.710] (-232.527) (-229.815) -- 0:00:45
      22000 -- [-228.521] (-230.881) (-230.819) (-228.428) * (-250.989) (-230.687) [-230.845] (-228.785) -- 0:00:44
      22500 -- (-230.764) (-232.722) [-229.385] (-230.222) * (-249.463) [-230.326] (-229.472) (-229.799) -- 0:00:43
      23000 -- (-236.863) [-228.960] (-230.107) (-229.115) * (-250.178) (-229.773) [-229.685] (-233.471) -- 0:00:42
      23500 -- (-230.837) (-231.640) [-228.505] (-228.577) * (-251.202) (-229.360) (-228.506) [-232.440] -- 0:00:41
      24000 -- (-228.792) (-230.048) (-229.645) [-230.254] * (-246.318) (-230.172) (-230.478) [-230.486] -- 0:00:40
      24500 -- (-229.503) [-230.346] (-230.472) (-230.605) * (-232.843) (-232.002) [-229.304] (-230.444) -- 0:00:39
      25000 -- (-229.775) [-230.076] (-235.193) (-231.414) * (-232.748) (-232.348) [-233.570] (-228.467) -- 0:00:39

      Average standard deviation of split frequencies: 0.058710

      25500 -- (-232.651) [-229.955] (-232.186) (-231.501) * (-230.542) [-228.216] (-232.039) (-229.902) -- 0:00:38
      26000 -- (-231.516) (-233.657) [-230.888] (-234.134) * (-229.767) [-230.981] (-228.747) (-229.064) -- 0:00:37
      26500 -- (-228.465) (-232.286) [-229.321] (-234.541) * [-230.730] (-232.074) (-231.217) (-228.008) -- 0:00:36
      27000 -- (-229.100) [-228.450] (-231.276) (-232.403) * (-232.631) (-228.947) (-228.462) [-229.983] -- 0:01:12
      27500 -- (-229.983) (-229.187) [-228.748] (-231.153) * (-230.007) (-229.823) [-228.446] (-230.015) -- 0:01:10
      28000 -- [-229.314] (-233.008) (-229.035) (-231.713) * (-231.468) (-229.645) (-229.515) [-230.045] -- 0:01:09
      28500 -- [-232.065] (-230.700) (-234.475) (-229.636) * [-229.198] (-230.825) (-229.222) (-228.060) -- 0:01:08
      29000 -- (-231.615) (-230.048) (-235.666) [-229.507] * (-230.690) (-230.724) (-232.486) [-232.363] -- 0:01:06
      29500 -- (-231.180) (-229.027) (-229.080) [-232.292] * (-229.567) (-228.656) [-229.831] (-232.055) -- 0:01:05
      30000 -- [-230.491] (-230.756) (-237.899) (-228.090) * (-229.592) [-228.225] (-229.313) (-231.898) -- 0:01:04

      Average standard deviation of split frequencies: 0.043188

      30500 -- (-230.642) (-231.412) (-236.467) [-230.056] * (-230.385) [-229.137] (-229.558) (-230.101) -- 0:01:03
      31000 -- [-230.812] (-232.203) (-229.417) (-233.512) * (-231.537) (-231.920) [-230.197] (-234.057) -- 0:01:02
      31500 -- [-229.491] (-229.068) (-228.739) (-230.227) * (-232.295) [-228.119] (-231.302) (-229.113) -- 0:01:01
      32000 -- (-230.046) (-228.846) [-228.687] (-230.510) * [-233.355] (-230.018) (-229.489) (-229.854) -- 0:01:00
      32500 -- (-229.618) (-230.532) [-228.956] (-228.937) * (-229.580) (-230.097) [-228.926] (-231.412) -- 0:00:59
      33000 -- (-230.361) [-231.440] (-229.265) (-228.916) * [-229.664] (-229.168) (-231.010) (-230.055) -- 0:00:58
      33500 -- (-229.334) [-230.797] (-234.170) (-229.756) * (-228.646) (-228.776) [-229.164] (-233.969) -- 0:00:57
      34000 -- (-230.187) [-229.405] (-230.797) (-228.331) * (-230.169) (-232.664) (-231.618) [-230.375] -- 0:00:56
      34500 -- (-230.100) (-229.649) (-228.969) [-230.838] * (-232.941) (-229.985) (-229.488) [-233.867] -- 0:00:55
      35000 -- (-228.910) (-229.821) [-228.634] (-229.231) * (-233.279) (-230.091) (-229.984) [-231.220] -- 0:00:55

      Average standard deviation of split frequencies: 0.032736

      35500 -- (-233.180) [-229.351] (-231.049) (-229.940) * (-229.434) [-229.481] (-228.956) (-229.851) -- 0:00:54
      36000 -- (-232.787) [-229.684] (-230.545) (-229.198) * (-231.432) (-229.189) [-228.648] (-229.207) -- 0:00:53
      36500 -- (-228.363) (-231.502) [-228.562] (-230.761) * (-234.573) (-229.700) (-228.937) [-229.754] -- 0:00:52
      37000 -- (-230.970) [-230.529] (-229.694) (-228.624) * (-230.453) (-229.890) (-228.076) [-230.774] -- 0:00:52
      37500 -- (-228.567) (-229.981) [-228.752] (-229.608) * [-230.388] (-229.693) (-231.189) (-232.739) -- 0:00:51
      38000 -- (-228.821) (-230.828) (-228.218) [-229.710] * (-228.306) (-229.737) (-228.762) [-229.570] -- 0:00:50
      38500 -- (-230.086) (-235.849) (-230.341) [-228.558] * (-229.004) (-229.074) [-229.854] (-230.192) -- 0:00:49
      39000 -- [-229.422] (-229.157) (-238.528) (-228.874) * (-231.469) [-229.072] (-230.567) (-230.645) -- 0:00:49
      39500 -- (-228.734) [-229.843] (-230.757) (-230.868) * [-230.390] (-233.372) (-229.436) (-232.111) -- 0:00:48
      40000 -- [-230.606] (-228.634) (-230.537) (-234.877) * (-229.697) (-232.949) (-228.691) [-228.618] -- 0:00:48

      Average standard deviation of split frequencies: 0.027957

      40500 -- (-231.851) [-229.660] (-228.880) (-229.265) * (-235.726) (-229.855) (-229.141) [-229.504] -- 0:00:47
      41000 -- [-229.836] (-229.996) (-229.592) (-229.887) * (-229.088) (-229.977) [-230.860] (-231.218) -- 0:00:46
      41500 -- [-230.150] (-229.027) (-232.712) (-229.310) * [-230.010] (-232.053) (-230.331) (-232.509) -- 0:00:46
      42000 -- (-229.583) (-230.848) (-228.072) [-230.623] * [-229.097] (-231.777) (-229.689) (-233.953) -- 0:00:45
      42500 -- [-235.676] (-230.772) (-231.705) (-229.351) * (-229.445) (-231.142) [-228.439] (-228.103) -- 0:00:45
      43000 -- (-231.460) (-228.780) (-231.978) [-230.583] * (-233.076) [-233.243] (-232.488) (-231.852) -- 0:00:44
      43500 -- [-232.621] (-230.713) (-231.519) (-230.072) * (-229.394) (-231.568) (-228.290) [-230.358] -- 0:00:43
      44000 -- [-229.452] (-230.183) (-228.972) (-229.444) * (-230.848) (-230.458) (-228.555) [-230.521] -- 0:01:05
      44500 -- (-230.147) (-228.281) (-229.932) [-231.873] * (-231.014) (-229.857) [-230.033] (-232.448) -- 0:01:04
      45000 -- (-238.855) [-228.353] (-234.931) (-228.231) * (-230.243) [-227.955] (-232.223) (-229.214) -- 0:01:03

      Average standard deviation of split frequencies: 0.026840

      45500 -- (-240.337) (-228.799) (-232.613) [-229.893] * (-231.599) [-229.413] (-230.350) (-233.138) -- 0:01:02
      46000 -- (-231.495) [-230.016] (-231.026) (-229.002) * [-235.326] (-228.640) (-233.316) (-233.450) -- 0:01:02
      46500 -- (-230.155) (-231.638) [-228.886] (-231.252) * (-235.913) (-231.017) [-229.234] (-229.466) -- 0:01:01
      47000 -- [-230.259] (-231.288) (-229.199) (-231.980) * (-235.545) [-229.196] (-234.291) (-228.587) -- 0:01:00
      47500 -- (-236.335) [-230.437] (-230.349) (-229.259) * (-232.918) (-228.755) (-234.643) [-230.763] -- 0:01:00
      48000 -- (-231.779) [-229.351] (-230.618) (-233.491) * [-230.577] (-229.435) (-228.808) (-230.777) -- 0:00:59
      48500 -- (-232.060) [-231.806] (-231.073) (-230.665) * [-228.430] (-229.050) (-230.133) (-229.846) -- 0:00:58
      49000 -- [-229.859] (-228.598) (-230.465) (-230.381) * [-229.424] (-229.938) (-235.926) (-230.237) -- 0:00:58
      49500 -- (-229.139) [-229.045] (-228.406) (-228.540) * (-228.467) (-228.548) (-230.101) [-232.196] -- 0:00:57
      50000 -- (-229.195) (-229.672) (-228.347) [-231.086] * [-228.829] (-228.460) (-229.590) (-232.648) -- 0:00:57

      Average standard deviation of split frequencies: 0.025121

      50500 -- (-229.097) (-230.641) (-228.144) [-231.102] * (-230.290) (-231.272) (-230.733) [-232.895] -- 0:00:56
      51000 -- (-229.349) (-229.666) (-229.573) [-229.467] * (-229.409) (-232.646) [-228.446] (-231.694) -- 0:00:55
      51500 -- (-228.780) [-231.513] (-229.645) (-230.247) * (-228.828) (-230.946) [-229.498] (-228.158) -- 0:00:55
      52000 -- (-232.777) (-228.798) [-229.088] (-229.626) * (-229.464) [-235.766] (-234.188) (-229.705) -- 0:00:54
      52500 -- (-229.124) (-229.993) (-228.154) [-228.919] * (-229.114) (-232.622) (-231.643) [-228.302] -- 0:00:54
      53000 -- (-231.465) (-233.473) (-228.840) [-229.657] * [-231.403] (-228.840) (-229.098) (-229.827) -- 0:00:53
      53500 -- (-232.298) (-232.279) (-228.523) [-228.925] * (-231.590) [-228.088] (-228.684) (-231.334) -- 0:00:53
      54000 -- (-229.584) (-230.679) (-231.681) [-230.070] * (-233.786) [-231.757] (-231.837) (-230.964) -- 0:00:52
      54500 -- [-229.490] (-228.356) (-229.633) (-230.557) * (-232.449) (-229.629) (-228.503) [-234.430] -- 0:00:52
      55000 -- (-230.149) [-228.969] (-230.110) (-229.770) * (-234.090) [-229.371] (-229.427) (-236.133) -- 0:00:51

      Average standard deviation of split frequencies: 0.027258

      55500 -- [-228.891] (-229.890) (-229.340) (-229.696) * [-230.542] (-231.241) (-229.962) (-238.686) -- 0:00:51
      56000 -- (-231.210) (-231.337) [-230.183] (-232.002) * (-238.097) [-231.615] (-227.905) (-232.518) -- 0:00:50
      56500 -- (-238.237) [-232.293] (-233.813) (-231.814) * (-232.676) (-232.412) [-228.709] (-231.121) -- 0:00:50
      57000 -- (-234.451) [-233.254] (-230.413) (-231.460) * (-233.361) [-230.607] (-232.384) (-230.786) -- 0:00:49
      57500 -- (-228.712) (-232.753) [-229.312] (-236.058) * [-229.742] (-230.662) (-228.921) (-231.846) -- 0:00:49
      58000 -- (-229.197) (-229.773) (-229.358) [-232.043] * (-228.301) (-229.503) [-230.411] (-228.139) -- 0:00:48
      58500 -- [-229.895] (-230.024) (-229.930) (-229.561) * (-230.373) (-231.375) [-228.889] (-227.705) -- 0:00:48
      59000 -- (-230.614) (-232.708) (-230.933) [-228.271] * (-234.160) [-229.292] (-231.159) (-228.911) -- 0:00:47
      59500 -- (-229.485) (-231.357) [-230.618] (-236.228) * (-228.903) (-228.748) [-230.621] (-231.195) -- 0:00:47
      60000 -- [-228.521] (-231.517) (-232.505) (-231.365) * [-232.114] (-229.898) (-229.851) (-229.819) -- 0:00:47

      Average standard deviation of split frequencies: 0.025642

      60500 -- (-228.306) [-231.951] (-234.478) (-230.817) * (-231.782) (-228.384) [-228.459] (-231.436) -- 0:00:46
      61000 -- (-232.176) [-230.206] (-231.819) (-230.647) * (-230.199) (-231.523) (-228.550) [-231.792] -- 0:00:46
      61500 -- (-232.394) (-229.133) (-229.434) [-231.118] * (-231.486) (-231.281) (-229.610) [-230.837] -- 0:01:01
      62000 -- [-231.016] (-229.257) (-229.709) (-228.333) * (-229.047) [-228.557] (-229.467) (-232.863) -- 0:01:00
      62500 -- (-228.652) (-230.152) (-229.279) [-233.928] * [-228.308] (-228.673) (-232.246) (-228.776) -- 0:01:00
      63000 -- [-231.086] (-229.028) (-228.708) (-231.649) * (-228.913) (-228.292) [-231.343] (-230.968) -- 0:00:59
      63500 -- (-229.232) (-231.886) [-229.147] (-229.097) * (-231.620) [-228.837] (-233.777) (-232.753) -- 0:00:58
      64000 -- [-229.467] (-231.843) (-230.573) (-232.182) * (-233.066) (-229.034) [-230.051] (-230.919) -- 0:00:58
      64500 -- [-229.860] (-232.199) (-228.729) (-230.416) * [-229.209] (-229.715) (-230.073) (-232.099) -- 0:00:58
      65000 -- (-234.049) (-231.274) [-231.983] (-228.094) * [-229.767] (-231.765) (-228.726) (-229.885) -- 0:00:57

      Average standard deviation of split frequencies: 0.025849

      65500 -- (-230.577) (-231.550) [-232.071] (-229.537) * (-228.662) (-228.772) (-231.230) [-228.873] -- 0:00:57
      66000 -- (-231.106) (-231.293) (-234.035) [-227.896] * (-230.180) (-229.353) [-229.271] (-228.490) -- 0:00:56
      66500 -- (-231.913) (-229.075) (-230.122) [-228.740] * (-229.295) (-229.480) (-232.646) [-229.228] -- 0:00:56
      67000 -- (-228.550) (-230.072) (-230.169) [-228.858] * (-229.056) (-230.301) [-229.838] (-228.481) -- 0:00:55
      67500 -- (-227.858) [-230.486] (-234.294) (-229.029) * (-230.144) (-229.315) [-230.915] (-227.981) -- 0:00:55
      68000 -- (-229.841) (-230.742) [-229.461] (-229.598) * (-229.568) [-229.260] (-231.959) (-229.081) -- 0:00:54
      68500 -- (-228.837) (-232.186) [-231.817] (-233.579) * [-228.543] (-228.513) (-229.616) (-233.165) -- 0:00:54
      69000 -- (-235.839) [-233.021] (-229.003) (-232.958) * (-236.725) (-229.087) [-228.500] (-231.908) -- 0:00:53
      69500 -- (-232.254) [-229.918] (-232.203) (-230.179) * (-240.618) (-230.038) (-229.243) [-228.439] -- 0:00:53
      70000 -- [-229.752] (-231.380) (-236.580) (-231.947) * (-233.872) (-232.002) (-229.699) [-228.523] -- 0:00:53

      Average standard deviation of split frequencies: 0.028907

      70500 -- (-228.766) [-229.927] (-228.773) (-233.870) * (-231.986) (-230.027) [-231.295] (-229.282) -- 0:00:52
      71000 -- (-228.105) [-229.293] (-231.539) (-231.403) * [-230.450] (-229.540) (-231.608) (-229.716) -- 0:00:52
      71500 -- (-232.018) (-230.740) [-230.568] (-231.483) * (-229.777) (-231.459) (-228.937) [-230.552] -- 0:00:51
      72000 -- (-231.306) [-228.591] (-230.049) (-231.584) * (-230.782) [-230.855] (-231.925) (-231.329) -- 0:00:51
      72500 -- (-229.224) (-227.892) [-228.269] (-229.882) * [-228.049] (-229.990) (-230.618) (-228.958) -- 0:00:51
      73000 -- (-231.606) (-234.560) [-229.884] (-229.607) * (-230.004) [-228.227] (-230.693) (-229.324) -- 0:00:50
      73500 -- [-229.005] (-231.644) (-227.993) (-231.398) * [-229.298] (-229.943) (-232.139) (-229.937) -- 0:00:50
      74000 -- (-232.376) (-229.479) [-228.543] (-234.699) * (-229.190) [-231.525] (-235.260) (-231.306) -- 0:00:50
      74500 -- (-228.034) (-232.550) [-231.452] (-228.699) * (-231.832) (-232.561) (-230.140) [-231.773] -- 0:00:49
      75000 -- [-231.771] (-229.852) (-230.943) (-228.202) * (-230.304) (-231.656) (-229.725) [-230.943] -- 0:00:49

      Average standard deviation of split frequencies: 0.026051

      75500 -- (-230.311) [-229.006] (-230.239) (-232.502) * [-228.439] (-230.225) (-229.648) (-229.413) -- 0:00:48
      76000 -- [-229.068] (-230.163) (-228.769) (-231.396) * (-230.210) (-232.394) (-230.106) [-231.527] -- 0:00:48
      76500 -- (-229.936) [-228.634] (-230.519) (-232.928) * [-230.615] (-230.615) (-231.623) (-230.804) -- 0:00:48
      77000 -- (-232.270) [-231.841] (-227.968) (-231.195) * (-231.592) [-229.849] (-232.529) (-231.225) -- 0:00:47
      77500 -- (-231.187) [-229.670] (-228.651) (-232.336) * (-228.769) (-228.387) (-228.790) [-228.712] -- 0:00:47
      78000 -- (-232.957) (-231.658) [-229.649] (-231.723) * [-229.809] (-228.260) (-229.292) (-229.351) -- 0:00:47
      78500 -- (-233.263) (-230.737) (-232.287) [-229.599] * (-228.069) (-231.099) (-228.463) [-231.904] -- 0:00:58
      79000 -- (-233.216) (-229.396) [-229.472] (-231.580) * (-232.693) (-230.175) [-228.425] (-229.157) -- 0:00:58
      79500 -- (-231.504) (-229.876) (-230.500) [-229.285] * (-231.104) (-232.404) [-230.047] (-230.602) -- 0:00:57
      80000 -- (-230.082) [-230.774] (-229.428) (-230.333) * [-229.799] (-229.904) (-227.993) (-229.441) -- 0:00:57

      Average standard deviation of split frequencies: 0.026297

      80500 -- [-230.119] (-229.829) (-229.071) (-230.639) * (-229.428) (-228.819) (-229.150) [-231.980] -- 0:00:57
      81000 -- (-230.581) (-228.743) (-228.905) [-230.528] * (-231.633) [-231.129] (-230.310) (-229.438) -- 0:00:56
      81500 -- (-229.152) (-228.723) [-228.313] (-232.828) * (-230.823) (-229.525) (-230.237) [-232.406] -- 0:00:56
      82000 -- (-228.364) (-229.071) (-230.988) [-228.276] * (-231.138) (-233.138) (-229.593) [-233.287] -- 0:00:55
      82500 -- (-229.373) (-230.146) [-229.219] (-228.460) * (-232.026) (-230.441) (-229.036) [-232.134] -- 0:00:55
      83000 -- (-228.794) [-228.908] (-227.869) (-229.066) * [-230.148] (-230.326) (-228.975) (-229.790) -- 0:00:55
      83500 -- [-229.234] (-230.981) (-228.802) (-232.272) * (-228.875) (-230.747) (-229.373) [-228.891] -- 0:00:54
      84000 -- (-229.027) [-229.995] (-231.036) (-231.588) * (-229.672) [-228.475] (-231.779) (-231.047) -- 0:00:54
      84500 -- (-230.836) (-228.224) (-232.002) [-229.587] * (-229.066) [-229.161] (-229.465) (-228.911) -- 0:00:54
      85000 -- [-229.006] (-229.293) (-235.362) (-232.494) * (-229.572) [-228.549] (-234.883) (-228.750) -- 0:00:53

      Average standard deviation of split frequencies: 0.025319

      85500 -- (-238.950) [-230.150] (-232.464) (-232.605) * (-228.759) (-229.996) (-233.240) [-229.058] -- 0:00:53
      86000 -- (-233.337) [-230.537] (-229.303) (-232.134) * (-229.596) (-229.121) [-229.493] (-230.853) -- 0:00:53
      86500 -- [-229.642] (-232.278) (-231.049) (-233.067) * [-229.412] (-228.889) (-232.410) (-232.428) -- 0:00:52
      87000 -- (-230.254) (-231.322) [-230.916] (-236.192) * (-229.687) (-228.601) (-228.525) [-229.887] -- 0:00:52
      87500 -- (-229.720) (-230.130) (-227.937) [-230.513] * [-229.883] (-230.055) (-230.151) (-232.638) -- 0:00:52
      88000 -- (-229.045) (-228.759) (-232.244) [-229.232] * (-229.220) (-228.523) [-231.712] (-230.276) -- 0:00:51
      88500 -- (-228.389) [-232.087] (-231.561) (-233.422) * (-228.329) (-229.245) [-230.653] (-229.890) -- 0:00:51
      89000 -- [-232.084] (-230.950) (-228.519) (-230.002) * (-229.237) (-229.684) (-230.982) [-229.220] -- 0:00:51
      89500 -- (-232.518) [-234.146] (-228.690) (-231.181) * (-229.448) (-231.135) (-231.076) [-229.141] -- 0:00:50
      90000 -- [-228.627] (-228.929) (-231.631) (-228.418) * (-230.942) [-229.921] (-232.741) (-228.963) -- 0:00:50

      Average standard deviation of split frequencies: 0.030723

      90500 -- (-228.568) (-231.395) (-228.362) [-228.258] * (-229.077) [-227.811] (-231.521) (-231.969) -- 0:00:50
      91000 -- [-228.244] (-233.377) (-230.987) (-229.193) * (-230.262) [-230.517] (-228.542) (-234.062) -- 0:00:49
      91500 -- (-228.875) (-231.053) [-230.508] (-232.323) * (-229.898) [-230.081] (-230.136) (-232.947) -- 0:00:49
      92000 -- [-236.653] (-229.955) (-228.321) (-229.996) * (-237.514) (-230.616) (-228.625) [-228.811] -- 0:00:49
      92500 -- [-229.786] (-228.215) (-231.398) (-229.666) * (-228.234) (-233.699) [-229.868] (-228.604) -- 0:00:49
      93000 -- (-228.627) [-231.034] (-229.063) (-231.166) * (-228.430) (-231.552) [-231.810] (-230.739) -- 0:00:48
      93500 -- (-229.381) (-228.698) [-229.566] (-229.935) * (-229.755) (-229.029) (-234.178) [-232.265] -- 0:00:48
      94000 -- (-230.579) (-227.775) (-231.409) [-233.404] * [-229.804] (-230.210) (-228.733) (-230.982) -- 0:00:48
      94500 -- [-228.913] (-229.023) (-230.088) (-229.043) * (-229.697) [-230.751] (-231.882) (-230.089) -- 0:00:47
      95000 -- (-228.457) [-231.254] (-229.791) (-235.661) * (-229.804) (-231.273) [-228.874] (-229.793) -- 0:00:47

      Average standard deviation of split frequencies: 0.029229

      95500 -- (-232.018) [-233.332] (-229.130) (-230.566) * (-228.313) [-228.390] (-229.968) (-230.788) -- 0:00:56
      96000 -- [-228.125] (-229.576) (-228.858) (-230.198) * (-229.572) [-235.477] (-234.101) (-231.052) -- 0:00:56
      96500 -- (-228.531) (-230.290) [-229.154] (-230.985) * (-229.812) [-230.969] (-231.436) (-230.699) -- 0:00:56
      97000 -- (-229.601) [-231.134] (-233.469) (-229.980) * [-231.963] (-231.173) (-229.449) (-230.608) -- 0:00:55
      97500 -- (-234.339) [-229.764] (-231.647) (-231.384) * (-231.709) (-229.236) (-228.559) [-230.240] -- 0:00:55
      98000 -- (-231.770) [-229.588] (-231.604) (-230.167) * [-229.479] (-231.856) (-230.027) (-230.723) -- 0:00:55
      98500 -- (-229.147) (-235.752) (-229.614) [-228.489] * [-230.557] (-230.842) (-229.566) (-229.054) -- 0:00:54
      99000 -- (-228.892) (-234.457) [-229.043] (-228.148) * (-229.860) [-230.374] (-230.626) (-228.734) -- 0:00:54
      99500 -- [-230.224] (-230.771) (-229.021) (-235.745) * (-230.911) (-229.030) [-229.125] (-229.350) -- 0:00:54
      100000 -- [-235.465] (-231.490) (-229.781) (-232.041) * (-232.840) (-228.407) [-230.527] (-229.480) -- 0:00:54

      Average standard deviation of split frequencies: 0.028097

      100500 -- (-230.054) [-231.077] (-233.752) (-231.038) * (-230.825) [-228.655] (-229.231) (-230.111) -- 0:00:53
      101000 -- (-228.933) (-230.995) (-233.543) [-228.753] * (-228.804) (-229.826) (-231.703) [-229.241] -- 0:00:53
      101500 -- (-231.018) [-233.700] (-228.697) (-231.688) * (-233.660) [-227.804] (-230.150) (-230.958) -- 0:00:53
      102000 -- (-236.548) [-230.624] (-228.456) (-236.094) * (-232.213) (-230.014) (-228.282) [-230.065] -- 0:00:52
      102500 -- (-229.295) (-228.560) [-231.612] (-235.001) * (-236.042) [-229.612] (-232.325) (-229.591) -- 0:00:52
      103000 -- (-229.460) (-231.113) [-229.992] (-231.665) * [-231.269] (-229.388) (-233.474) (-231.746) -- 0:00:52
      103500 -- (-229.228) [-230.009] (-229.944) (-234.662) * (-232.077) [-231.625] (-234.702) (-231.501) -- 0:00:51
      104000 -- (-229.898) (-230.021) (-229.271) [-230.516] * (-230.520) (-229.813) [-230.801] (-230.586) -- 0:00:51
      104500 -- [-229.317] (-231.700) (-228.842) (-230.295) * (-229.010) (-233.201) [-231.901] (-230.310) -- 0:00:51
      105000 -- (-230.793) [-228.755] (-228.190) (-230.265) * (-231.788) (-230.074) (-231.883) [-229.004] -- 0:00:51

      Average standard deviation of split frequencies: 0.027290

      105500 -- (-228.204) (-230.644) (-229.815) [-231.480] * (-229.476) [-231.326] (-231.221) (-229.015) -- 0:00:50
      106000 -- (-229.013) (-232.121) [-228.280] (-229.272) * (-230.388) (-235.476) (-233.050) [-228.994] -- 0:00:50
      106500 -- (-231.705) (-230.816) [-229.162] (-229.005) * [-228.899] (-230.332) (-231.320) (-228.596) -- 0:00:50
      107000 -- [-228.115] (-228.351) (-230.344) (-228.306) * (-231.800) [-229.222] (-231.184) (-229.243) -- 0:00:50
      107500 -- (-233.379) (-228.655) (-230.898) [-228.512] * [-230.340] (-230.900) (-230.699) (-229.555) -- 0:00:49
      108000 -- (-238.419) (-230.782) [-230.409] (-228.627) * (-231.014) [-229.427] (-230.929) (-230.267) -- 0:00:49
      108500 -- (-231.160) (-232.517) (-230.356) [-228.957] * (-233.096) [-228.913] (-233.208) (-230.434) -- 0:00:49
      109000 -- (-232.038) [-230.547] (-230.458) (-228.955) * (-232.449) (-228.318) [-229.505] (-232.880) -- 0:00:49
      109500 -- (-229.195) (-231.715) (-229.166) [-233.103] * [-227.958] (-228.909) (-230.727) (-230.647) -- 0:00:48
      110000 -- (-229.561) (-230.332) (-228.470) [-232.553] * (-229.310) (-231.342) [-229.646] (-229.140) -- 0:00:48

      Average standard deviation of split frequencies: 0.026720

      110500 -- [-230.593] (-230.566) (-230.164) (-228.438) * (-231.676) [-230.007] (-229.371) (-235.042) -- 0:00:48
      111000 -- (-230.632) (-231.089) (-228.953) [-228.738] * (-229.946) (-229.804) (-231.484) [-233.053] -- 0:00:48
      111500 -- (-230.748) (-232.198) [-229.508] (-228.253) * (-230.311) (-229.610) [-229.086] (-229.211) -- 0:00:47
      112000 -- (-232.620) (-232.118) [-230.426] (-230.651) * (-233.195) (-232.407) (-230.251) [-228.088] -- 0:00:47
      112500 -- (-235.080) (-228.785) [-229.964] (-228.666) * (-232.701) [-229.416] (-229.931) (-230.950) -- 0:00:55
      113000 -- [-234.063] (-230.744) (-228.134) (-227.936) * [-229.074] (-229.354) (-228.966) (-231.151) -- 0:00:54
      113500 -- [-228.909] (-229.008) (-232.680) (-230.371) * (-229.256) [-229.044] (-232.244) (-234.771) -- 0:00:54
      114000 -- (-230.667) (-230.507) (-228.899) [-231.643] * [-228.857] (-230.397) (-229.838) (-232.613) -- 0:00:54
      114500 -- (-230.893) (-229.548) (-234.335) [-230.146] * (-229.754) (-231.872) [-230.583] (-232.581) -- 0:00:54
      115000 -- (-231.785) (-231.073) (-230.251) [-230.468] * [-228.928] (-232.072) (-230.990) (-230.658) -- 0:00:53

      Average standard deviation of split frequencies: 0.028019

      115500 -- (-229.464) [-229.932] (-237.060) (-229.230) * (-229.407) (-227.975) (-231.660) [-229.532] -- 0:00:53
      116000 -- (-229.919) (-235.734) [-230.721] (-231.097) * (-230.263) [-230.445] (-228.199) (-229.099) -- 0:00:53
      116500 -- [-228.612] (-230.163) (-228.650) (-228.859) * (-231.819) (-230.763) (-230.510) [-229.209] -- 0:00:53
      117000 -- [-232.283] (-228.633) (-229.355) (-229.846) * (-230.797) (-232.026) [-233.379] (-230.642) -- 0:00:52
      117500 -- [-235.115] (-228.841) (-231.799) (-229.008) * (-233.033) (-233.207) [-230.513] (-231.217) -- 0:00:52
      118000 -- (-233.661) (-229.346) (-229.064) [-229.266] * (-232.167) (-233.524) (-228.913) [-230.414] -- 0:00:52
      118500 -- (-228.687) (-232.457) [-230.536] (-230.294) * (-230.113) (-236.041) [-231.598] (-229.925) -- 0:00:52
      119000 -- (-230.559) (-231.783) (-229.709) [-230.697] * (-232.789) (-233.352) [-230.452] (-228.614) -- 0:00:51
      119500 -- (-229.367) (-232.248) [-228.256] (-231.622) * (-231.751) (-234.334) (-230.630) [-228.786] -- 0:00:51
      120000 -- (-228.830) (-232.850) [-228.243] (-231.248) * (-228.782) (-234.127) [-228.562] (-229.147) -- 0:00:51

      Average standard deviation of split frequencies: 0.029300

      120500 -- (-228.933) (-234.512) [-229.755] (-229.260) * (-229.935) [-232.217] (-231.123) (-230.295) -- 0:00:51
      121000 -- (-230.922) [-230.825] (-229.773) (-230.937) * (-229.060) (-230.345) [-231.601] (-234.204) -- 0:00:50
      121500 -- (-229.972) (-229.098) (-228.997) [-229.510] * (-229.456) (-230.032) [-229.890] (-231.520) -- 0:00:50
      122000 -- (-229.102) (-229.420) (-229.821) [-230.251] * (-231.151) (-231.234) [-230.657] (-231.420) -- 0:00:50
      122500 -- (-229.206) (-231.843) [-228.692] (-230.929) * (-232.284) (-232.157) [-233.237] (-229.188) -- 0:00:50
      123000 -- (-229.624) [-231.398] (-229.924) (-231.449) * (-230.968) [-231.124] (-231.365) (-229.044) -- 0:00:49
      123500 -- (-231.882) [-232.228] (-229.798) (-233.209) * (-231.682) (-232.019) [-234.384] (-230.450) -- 0:00:49
      124000 -- (-230.796) [-232.609] (-232.041) (-230.735) * [-228.470] (-230.292) (-235.494) (-229.911) -- 0:00:49
      124500 -- [-230.044] (-229.818) (-230.223) (-229.505) * [-233.611] (-229.183) (-230.186) (-233.795) -- 0:00:49
      125000 -- (-232.940) [-228.488] (-232.963) (-232.130) * (-229.710) (-229.873) (-230.786) [-229.133] -- 0:00:49

      Average standard deviation of split frequencies: 0.024614

      125500 -- (-230.907) (-231.613) (-231.452) [-230.874] * (-229.292) (-231.481) (-229.332) [-229.303] -- 0:00:48
      126000 -- [-231.796] (-230.732) (-228.733) (-231.963) * [-230.396] (-230.690) (-233.884) (-231.373) -- 0:00:48
      126500 -- (-229.832) (-234.826) [-231.275] (-231.386) * [-231.253] (-236.896) (-231.848) (-231.197) -- 0:00:48
      127000 -- [-229.406] (-230.881) (-229.239) (-229.216) * [-230.694] (-232.820) (-229.067) (-230.216) -- 0:00:48
      127500 -- (-228.740) (-229.526) (-230.206) [-229.061] * (-230.836) (-231.646) (-228.341) [-228.770] -- 0:00:47
      128000 -- (-230.582) [-234.018] (-233.284) (-229.437) * (-227.811) (-232.465) (-228.300) [-229.704] -- 0:00:47
      128500 -- (-231.201) (-228.503) (-228.183) [-232.330] * (-230.362) [-229.232] (-231.181) (-231.895) -- 0:00:47
      129000 -- (-229.141) (-230.419) (-228.602) [-230.539] * (-230.151) [-228.376] (-235.747) (-230.243) -- 0:00:47
      129500 -- (-230.880) [-229.965] (-232.001) (-229.335) * (-231.900) (-231.377) (-229.227) [-230.453] -- 0:00:53
      130000 -- [-228.226] (-228.651) (-231.059) (-230.946) * (-229.157) (-233.559) (-228.504) [-230.726] -- 0:00:53

      Average standard deviation of split frequencies: 0.022216

      130500 -- [-230.817] (-235.504) (-228.367) (-231.515) * (-231.239) (-230.649) [-229.600] (-231.855) -- 0:00:53
      131000 -- (-229.130) (-229.703) [-229.515] (-230.841) * (-228.652) (-228.895) [-228.928] (-231.485) -- 0:00:53
      131500 -- [-228.619] (-231.776) (-230.039) (-231.643) * [-228.504] (-231.064) (-229.031) (-230.234) -- 0:00:52
      132000 -- (-229.917) (-230.202) [-228.580] (-229.440) * (-228.149) (-229.285) [-228.632] (-231.131) -- 0:00:52
      132500 -- (-229.210) (-229.668) (-231.597) [-229.846] * [-229.587] (-232.978) (-228.968) (-229.201) -- 0:00:52
      133000 -- (-232.448) (-228.235) [-228.434] (-230.010) * (-228.251) (-230.936) [-228.018] (-230.917) -- 0:00:52
      133500 -- (-232.904) (-230.821) [-230.119] (-230.003) * (-228.896) (-230.163) [-228.939] (-229.218) -- 0:00:51
      134000 -- (-232.217) (-230.050) [-229.872] (-230.045) * (-231.131) (-237.154) [-229.215] (-229.775) -- 0:00:51
      134500 -- [-229.051] (-229.899) (-227.925) (-229.870) * [-229.108] (-231.266) (-230.467) (-230.488) -- 0:00:51
      135000 -- (-228.661) (-230.705) [-230.036] (-230.953) * (-230.724) [-231.037] (-231.949) (-230.337) -- 0:00:51

      Average standard deviation of split frequencies: 0.019885

      135500 -- (-229.606) (-228.768) (-236.237) [-230.684] * (-231.203) (-234.157) (-229.705) [-229.090] -- 0:00:51
      136000 -- (-229.139) (-229.065) (-231.942) [-230.012] * [-228.924] (-230.632) (-230.314) (-228.921) -- 0:00:50
      136500 -- (-228.582) (-229.004) [-231.054] (-229.088) * (-233.151) (-229.609) [-229.734] (-228.172) -- 0:00:50
      137000 -- [-231.977] (-228.712) (-230.606) (-231.463) * (-229.041) (-231.621) [-232.563] (-229.307) -- 0:00:50
      137500 -- (-230.856) (-229.129) [-229.251] (-234.080) * (-233.635) (-229.021) (-230.383) [-229.946] -- 0:00:50
      138000 -- (-233.682) (-230.888) (-230.133) [-229.661] * (-234.864) [-230.145] (-233.639) (-229.769) -- 0:00:49
      138500 -- (-230.048) [-230.752] (-228.206) (-229.896) * (-228.718) (-228.738) [-229.328] (-233.105) -- 0:00:49
      139000 -- [-229.410] (-232.412) (-232.031) (-230.123) * (-229.864) (-228.567) (-229.631) [-228.860] -- 0:00:49
      139500 -- [-230.725] (-231.396) (-231.500) (-233.757) * (-231.067) (-228.592) [-229.192] (-228.066) -- 0:00:49
      140000 -- (-232.009) (-229.129) (-230.870) [-229.422] * (-230.413) [-230.396] (-228.279) (-228.793) -- 0:00:49

      Average standard deviation of split frequencies: 0.016403

      140500 -- [-229.071] (-228.437) (-230.272) (-229.957) * (-228.479) (-228.397) (-230.869) [-230.100] -- 0:00:48
      141000 -- (-229.294) [-231.762] (-229.318) (-229.968) * (-228.261) (-231.840) [-229.689] (-228.164) -- 0:00:48
      141500 -- [-228.284] (-233.353) (-228.219) (-231.394) * [-231.530] (-230.426) (-233.169) (-229.582) -- 0:00:48
      142000 -- [-229.580] (-229.792) (-229.060) (-235.755) * (-233.789) (-229.139) [-230.312] (-229.460) -- 0:00:48
      142500 -- (-228.010) (-232.334) [-228.813] (-233.233) * (-233.263) [-230.411] (-232.300) (-228.576) -- 0:00:48
      143000 -- [-230.059] (-230.769) (-229.491) (-230.614) * (-229.955) [-228.443] (-230.917) (-229.574) -- 0:00:47
      143500 -- [-230.810] (-230.595) (-229.461) (-229.900) * (-230.554) (-228.736) [-231.138] (-230.686) -- 0:00:47
      144000 -- (-229.750) (-230.628) (-229.820) [-229.579] * (-228.247) [-229.118] (-229.428) (-232.752) -- 0:00:47
      144500 -- (-229.243) [-230.868] (-233.522) (-228.607) * (-229.451) [-228.243] (-231.147) (-231.836) -- 0:00:47
      145000 -- [-229.217] (-232.028) (-233.981) (-228.386) * [-229.664] (-228.618) (-233.736) (-231.754) -- 0:00:47

      Average standard deviation of split frequencies: 0.016654

      145500 -- (-229.145) (-232.778) (-232.014) [-229.465] * (-230.673) [-230.743] (-228.922) (-228.701) -- 0:00:46
      146000 -- (-235.240) (-233.560) (-229.494) [-228.631] * (-229.378) [-229.190] (-229.805) (-232.259) -- 0:00:46
      146500 -- (-229.369) (-230.000) (-229.332) [-230.478] * (-229.361) (-230.769) (-233.957) [-230.012] -- 0:00:52
      147000 -- (-231.985) (-230.228) (-232.465) [-230.198] * [-228.966] (-230.139) (-233.787) (-228.212) -- 0:00:52
      147500 -- (-233.079) (-233.011) [-233.779] (-231.764) * (-228.461) (-232.280) [-230.572] (-231.917) -- 0:00:52
      148000 -- (-230.891) [-231.389] (-231.887) (-232.379) * (-229.698) (-227.871) [-229.428] (-235.467) -- 0:00:51
      148500 -- (-230.438) (-228.782) (-231.066) [-231.093] * (-229.958) (-230.031) [-230.385] (-232.904) -- 0:00:51
      149000 -- [-231.658] (-229.534) (-228.893) (-229.051) * [-231.953] (-230.358) (-229.007) (-230.756) -- 0:00:51
      149500 -- (-232.805) [-228.949] (-230.554) (-229.054) * (-231.140) [-229.693] (-228.502) (-230.856) -- 0:00:51
      150000 -- [-232.238] (-229.869) (-229.263) (-232.279) * (-237.784) (-231.057) [-229.281] (-229.691) -- 0:00:51

      Average standard deviation of split frequencies: 0.016513

      150500 -- [-229.821] (-229.450) (-229.852) (-231.978) * (-229.580) [-229.339] (-235.166) (-230.291) -- 0:00:50
      151000 -- (-229.567) (-230.080) [-228.828] (-234.332) * (-233.774) (-229.126) (-228.217) [-233.728] -- 0:00:50
      151500 -- (-229.347) [-230.596] (-238.245) (-229.997) * (-229.651) (-229.673) (-232.871) [-230.665] -- 0:00:50
      152000 -- (-228.629) (-229.493) [-230.187] (-230.855) * (-229.336) [-229.710] (-229.755) (-230.864) -- 0:00:50
      152500 -- (-231.896) (-235.895) (-229.814) [-230.466] * (-228.696) [-229.869] (-229.955) (-231.556) -- 0:00:50
      153000 -- [-229.416] (-232.304) (-229.770) (-228.378) * (-228.558) [-228.915] (-230.051) (-230.685) -- 0:00:49
      153500 -- (-232.509) [-232.393] (-229.893) (-228.617) * (-228.973) (-231.426) [-229.174] (-233.653) -- 0:00:49
      154000 -- (-232.469) (-229.856) [-231.704] (-230.292) * [-228.552] (-231.468) (-228.826) (-235.303) -- 0:00:49
      154500 -- (-229.633) (-229.179) [-228.832] (-233.324) * (-229.914) (-230.721) (-233.231) [-231.578] -- 0:00:49
      155000 -- [-231.837] (-231.110) (-231.786) (-230.087) * (-229.730) (-228.823) [-230.067] (-230.026) -- 0:00:49

      Average standard deviation of split frequencies: 0.014043

      155500 -- (-232.474) (-228.243) [-230.152] (-228.577) * (-231.093) (-230.669) [-230.436] (-230.157) -- 0:00:48
      156000 -- (-236.573) [-228.053] (-230.504) (-230.043) * [-229.152] (-229.214) (-230.346) (-232.603) -- 0:00:48
      156500 -- (-230.258) (-229.682) [-229.357] (-231.300) * (-231.793) (-230.063) [-234.943] (-231.766) -- 0:00:48
      157000 -- [-229.388] (-231.795) (-228.617) (-231.838) * (-234.120) [-230.873] (-235.987) (-229.613) -- 0:00:48
      157500 -- (-231.719) (-231.355) [-230.915] (-232.611) * (-230.817) (-228.939) (-235.597) [-228.240] -- 0:00:48
      158000 -- (-229.361) (-229.724) (-229.697) [-229.536] * (-229.837) (-234.490) (-230.618) [-228.356] -- 0:00:47
      158500 -- (-231.950) (-232.140) [-228.745] (-228.764) * [-232.811] (-231.551) (-228.449) (-233.183) -- 0:00:47
      159000 -- (-229.584) [-228.662] (-233.143) (-230.425) * (-229.305) (-231.476) (-228.628) [-230.089] -- 0:00:47
      159500 -- (-232.068) (-234.874) [-229.883] (-230.007) * (-229.893) (-232.052) [-228.482] (-230.331) -- 0:00:47
      160000 -- (-229.052) [-229.317] (-229.260) (-229.701) * (-228.622) [-228.931] (-228.829) (-229.897) -- 0:00:47

      Average standard deviation of split frequencies: 0.011564

      160500 -- [-230.396] (-230.398) (-230.153) (-229.257) * (-234.009) [-229.227] (-230.512) (-230.092) -- 0:00:47
      161000 -- (-229.185) [-230.685] (-231.237) (-230.879) * [-229.824] (-233.173) (-231.090) (-230.021) -- 0:00:46
      161500 -- (-228.810) (-231.920) (-230.666) [-228.958] * [-231.921] (-229.998) (-229.950) (-232.746) -- 0:00:46
      162000 -- (-232.032) [-228.200] (-234.610) (-229.141) * (-232.703) [-228.466] (-229.889) (-233.156) -- 0:00:46
      162500 -- (-234.772) [-229.248] (-230.480) (-230.358) * (-230.684) [-229.539] (-230.748) (-229.647) -- 0:00:46
      163000 -- (-233.147) (-228.528) (-234.395) [-232.428] * (-231.865) (-233.259) [-228.618] (-229.472) -- 0:00:46
      163500 -- (-233.386) (-231.149) (-232.259) [-228.508] * [-229.938] (-229.310) (-228.179) (-234.227) -- 0:00:51
      164000 -- (-238.727) (-228.570) (-234.686) [-228.089] * (-229.356) (-228.727) (-227.798) [-229.335] -- 0:00:50
      164500 -- (-231.100) [-232.759] (-229.018) (-229.257) * [-229.365] (-231.973) (-228.569) (-231.249) -- 0:00:50
      165000 -- (-230.366) (-231.928) [-228.306] (-232.499) * [-229.079] (-232.371) (-233.551) (-231.473) -- 0:00:50

      Average standard deviation of split frequencies: 0.012027

      165500 -- (-229.699) (-233.012) (-231.776) [-234.456] * [-228.923] (-229.254) (-230.510) (-228.470) -- 0:00:50
      166000 -- (-231.597) [-232.727] (-231.726) (-231.334) * (-229.912) (-229.411) (-232.133) [-228.716] -- 0:00:50
      166500 -- (-230.255) (-227.947) (-229.199) [-229.901] * (-230.992) (-233.426) [-228.648] (-228.866) -- 0:00:50
      167000 -- (-228.841) [-228.689] (-231.203) (-231.369) * (-231.075) (-231.157) [-231.639] (-228.363) -- 0:00:49
      167500 -- [-233.018] (-229.634) (-232.086) (-232.578) * (-228.940) (-229.259) (-230.623) [-232.584] -- 0:00:49
      168000 -- [-233.251] (-231.134) (-231.118) (-233.257) * (-231.093) (-234.703) [-238.079] (-232.586) -- 0:00:49
      168500 -- [-228.895] (-230.928) (-228.890) (-229.531) * (-229.116) (-230.992) (-236.638) [-235.883] -- 0:00:49
      169000 -- [-230.736] (-231.363) (-230.006) (-229.204) * [-228.112] (-230.361) (-234.339) (-231.690) -- 0:00:49
      169500 -- (-235.982) (-230.656) (-237.286) [-229.878] * (-229.351) (-230.010) [-228.770] (-229.151) -- 0:00:48
      170000 -- (-237.533) (-228.771) [-228.918] (-229.929) * (-232.471) (-228.633) [-229.900] (-231.008) -- 0:00:48

      Average standard deviation of split frequencies: 0.011374

      170500 -- (-233.642) (-229.499) [-231.416] (-229.854) * [-230.851] (-230.033) (-233.751) (-232.143) -- 0:00:48
      171000 -- (-231.011) [-231.935] (-232.055) (-228.538) * (-229.300) (-231.076) (-230.209) [-231.180] -- 0:00:48
      171500 -- (-232.571) (-231.242) [-230.950] (-229.531) * (-229.133) [-230.963] (-229.266) (-231.978) -- 0:00:48
      172000 -- [-230.282] (-228.389) (-231.570) (-235.008) * [-229.497] (-235.003) (-232.929) (-230.737) -- 0:00:48
      172500 -- [-229.502] (-229.525) (-234.092) (-236.515) * (-229.836) (-232.848) [-229.564] (-228.173) -- 0:00:47
      173000 -- (-233.757) [-228.188] (-235.253) (-230.500) * (-231.095) [-231.128] (-232.289) (-230.354) -- 0:00:47
      173500 -- (-229.868) (-228.536) (-236.756) [-234.467] * (-228.337) [-228.391] (-230.281) (-230.595) -- 0:00:47
      174000 -- (-230.739) [-229.360] (-229.186) (-230.615) * (-233.407) (-230.646) [-232.386] (-229.638) -- 0:00:47
      174500 -- (-233.379) (-228.825) [-229.179] (-232.952) * (-231.697) (-229.769) (-230.688) [-228.235] -- 0:00:47
      175000 -- (-231.568) (-229.802) (-228.968) [-228.732] * (-228.503) (-228.415) (-230.880) [-229.206] -- 0:00:47

      Average standard deviation of split frequencies: 0.012447

      175500 -- (-229.013) (-231.071) (-229.120) [-231.026] * (-232.660) (-228.824) [-230.422] (-230.622) -- 0:00:46
      176000 -- (-229.430) (-230.976) (-231.339) [-230.567] * (-231.163) (-231.742) [-231.400] (-231.619) -- 0:00:46
      176500 -- (-231.489) (-232.243) (-229.714) [-230.324] * (-236.818) (-228.515) (-229.534) [-231.640] -- 0:00:46
      177000 -- (-230.659) [-228.829] (-228.727) (-232.928) * [-230.848] (-230.196) (-228.327) (-229.350) -- 0:00:46
      177500 -- (-232.933) (-229.293) (-229.355) [-229.012] * (-231.583) (-230.546) [-230.506] (-229.849) -- 0:00:46
      178000 -- (-231.601) [-228.839] (-229.051) (-230.179) * (-234.655) (-232.109) (-232.903) [-229.230] -- 0:00:46
      178500 -- (-228.526) [-230.618] (-229.860) (-229.412) * [-228.618] (-228.136) (-230.821) (-231.165) -- 0:00:46
      179000 -- (-231.105) [-229.909] (-234.665) (-232.660) * (-231.655) (-229.129) [-231.208] (-229.589) -- 0:00:45
      179500 -- (-230.975) [-228.589] (-228.555) (-237.792) * (-230.212) (-231.042) [-232.507] (-228.679) -- 0:00:45
      180000 -- [-230.033] (-229.538) (-229.467) (-231.995) * (-237.196) (-229.231) [-229.746] (-228.984) -- 0:00:45

      Average standard deviation of split frequencies: 0.014735

      180500 -- (-228.225) (-228.799) [-230.744] (-233.241) * [-228.794] (-230.230) (-229.983) (-229.421) -- 0:00:49
      181000 -- (-227.782) [-228.526] (-231.584) (-232.525) * (-229.384) (-231.299) [-228.735] (-235.629) -- 0:00:49
      181500 -- (-229.302) (-233.154) [-233.828] (-233.164) * (-228.916) (-229.973) [-230.602] (-232.023) -- 0:00:49
      182000 -- (-230.827) (-229.217) (-228.457) [-229.282] * (-230.454) (-228.530) (-229.946) [-229.778] -- 0:00:49
      182500 -- (-228.841) (-233.771) [-231.465] (-229.761) * (-230.815) (-228.949) (-230.842) [-232.245] -- 0:00:49
      183000 -- [-228.669] (-229.783) (-229.499) (-231.855) * (-229.393) (-229.208) [-231.990] (-230.022) -- 0:00:49
      183500 -- (-229.823) (-229.523) [-227.982] (-230.450) * (-233.845) [-232.672] (-233.637) (-229.406) -- 0:00:48
      184000 -- (-229.434) [-228.515] (-230.641) (-229.467) * (-228.522) (-230.687) (-236.512) [-228.653] -- 0:00:48
      184500 -- [-231.599] (-233.402) (-229.975) (-232.146) * [-230.275] (-232.585) (-229.919) (-229.369) -- 0:00:48
      185000 -- [-230.013] (-230.610) (-228.452) (-228.479) * (-230.670) (-231.403) [-230.272] (-230.325) -- 0:00:48

      Average standard deviation of split frequencies: 0.016007

      185500 -- (-231.073) (-228.443) (-230.285) [-229.695] * [-228.689] (-230.035) (-228.444) (-228.623) -- 0:00:48
      186000 -- (-228.495) (-231.905) (-231.691) [-230.594] * (-231.480) [-232.349] (-229.623) (-232.614) -- 0:00:48
      186500 -- [-228.855] (-229.218) (-232.010) (-229.548) * [-228.154] (-229.906) (-230.719) (-229.329) -- 0:00:47
      187000 -- (-228.418) (-228.175) (-230.055) [-228.962] * (-229.109) [-231.343] (-230.463) (-236.425) -- 0:00:47
      187500 -- [-230.121] (-228.431) (-230.938) (-231.172) * [-229.941] (-230.058) (-230.977) (-232.310) -- 0:00:47
      188000 -- (-230.925) [-232.624] (-233.759) (-231.703) * (-230.945) (-231.286) [-228.109] (-228.725) -- 0:00:47
      188500 -- (-232.385) (-229.136) [-231.857] (-229.810) * (-230.563) (-230.464) (-229.049) [-228.629] -- 0:00:47
      189000 -- (-228.394) (-231.095) (-230.228) [-230.543] * [-228.688] (-229.762) (-230.235) (-231.082) -- 0:00:47
      189500 -- (-229.000) (-228.433) (-233.123) [-230.144] * (-228.598) [-228.775] (-229.482) (-228.615) -- 0:00:47
      190000 -- [-228.555] (-229.455) (-232.028) (-230.219) * [-229.142] (-233.759) (-236.224) (-228.262) -- 0:00:46

      Average standard deviation of split frequencies: 0.016526

      190500 -- (-228.275) (-230.502) [-228.597] (-234.278) * (-231.788) (-235.990) [-231.496] (-229.115) -- 0:00:46
      191000 -- (-232.765) (-231.969) [-230.611] (-229.267) * (-228.888) [-230.686] (-231.028) (-235.262) -- 0:00:46
      191500 -- (-232.470) (-230.135) [-234.865] (-228.903) * (-230.258) (-232.686) (-229.209) [-230.647] -- 0:00:46
      192000 -- [-232.964] (-231.329) (-232.754) (-229.153) * (-228.625) (-231.304) [-230.823] (-232.973) -- 0:00:46
      192500 -- (-231.425) (-230.913) [-233.086] (-235.480) * (-232.496) [-230.077] (-230.898) (-238.788) -- 0:00:46
      193000 -- (-233.366) (-228.588) (-229.735) [-230.145] * (-232.103) (-227.899) (-230.571) [-235.005] -- 0:00:45
      193500 -- [-230.256] (-230.585) (-231.916) (-232.696) * (-230.866) (-230.620) [-229.790] (-230.136) -- 0:00:45
      194000 -- (-233.024) (-228.979) (-230.201) [-231.745] * (-230.067) (-229.494) (-231.304) [-229.112] -- 0:00:45
      194500 -- [-230.293] (-231.154) (-233.196) (-234.516) * (-232.342) (-229.187) (-228.194) [-231.000] -- 0:00:45
      195000 -- (-230.748) [-228.967] (-232.485) (-231.800) * (-228.991) (-229.640) (-231.263) [-229.693] -- 0:00:45

      Average standard deviation of split frequencies: 0.015513

      195500 -- (-231.031) [-228.431] (-230.975) (-230.268) * (-230.884) (-230.002) [-229.623] (-230.508) -- 0:00:45
      196000 -- [-232.166] (-229.281) (-230.905) (-229.288) * (-234.815) (-230.980) (-228.686) [-234.413] -- 0:00:45
      196500 -- [-230.360] (-229.222) (-228.781) (-229.686) * [-232.745] (-230.932) (-236.133) (-231.063) -- 0:00:44
      197000 -- (-232.114) (-232.104) (-229.935) [-229.279] * [-233.109] (-228.305) (-234.154) (-232.167) -- 0:00:44
      197500 -- [-229.340] (-231.247) (-229.399) (-232.612) * (-231.053) (-229.212) (-234.628) [-229.094] -- 0:00:48
      198000 -- (-232.354) [-230.039] (-229.488) (-231.648) * (-232.653) (-233.803) (-230.820) [-231.999] -- 0:00:48
      198500 -- (-231.190) (-229.445) [-231.775] (-228.596) * (-231.639) (-229.787) (-230.446) [-230.516] -- 0:00:48
      199000 -- (-231.153) [-230.401] (-229.164) (-231.656) * (-230.629) (-229.691) (-230.585) [-229.935] -- 0:00:48
      199500 -- [-230.060] (-232.030) (-230.623) (-229.806) * (-229.480) (-235.684) [-229.639] (-229.599) -- 0:00:48
      200000 -- (-228.945) (-228.245) (-228.923) [-228.302] * (-229.113) (-229.490) (-230.617) [-229.049] -- 0:00:48

      Average standard deviation of split frequencies: 0.012921

      200500 -- [-230.833] (-230.226) (-228.097) (-229.486) * (-229.580) (-230.570) (-229.030) [-229.421] -- 0:00:47
      201000 -- [-231.816] (-229.610) (-228.596) (-230.425) * [-229.233] (-229.068) (-229.441) (-229.065) -- 0:00:47
      201500 -- (-230.826) (-232.425) (-228.848) [-231.590] * [-230.595] (-232.312) (-232.257) (-230.823) -- 0:00:47
      202000 -- [-228.735] (-229.295) (-228.627) (-231.472) * (-228.699) (-232.290) [-232.619] (-232.545) -- 0:00:47
      202500 -- (-230.200) (-229.067) (-230.413) [-231.000] * (-229.318) (-231.012) [-230.352] (-230.584) -- 0:00:47
      203000 -- [-233.573] (-229.673) (-232.826) (-231.748) * [-228.613] (-229.350) (-229.416) (-229.409) -- 0:00:47
      203500 -- (-230.659) (-230.218) [-229.911] (-228.735) * (-230.174) (-228.559) [-229.760] (-228.090) -- 0:00:46
      204000 -- (-231.726) [-231.881] (-232.776) (-229.099) * (-229.901) [-229.231] (-232.789) (-230.583) -- 0:00:46
      204500 -- (-228.919) (-228.091) [-235.150] (-230.780) * [-228.632] (-228.952) (-228.802) (-228.527) -- 0:00:46
      205000 -- (-229.270) (-228.922) [-231.062] (-228.509) * (-230.580) [-229.004] (-230.739) (-230.480) -- 0:00:46

      Average standard deviation of split frequencies: 0.013476

      205500 -- (-229.772) (-228.580) [-230.427] (-229.063) * (-234.368) [-229.264] (-229.009) (-232.251) -- 0:00:46
      206000 -- (-232.915) (-229.458) (-230.592) [-229.741] * [-232.591] (-229.108) (-228.574) (-235.972) -- 0:00:46
      206500 -- (-232.363) (-230.152) (-229.542) [-228.087] * [-230.176] (-230.597) (-232.282) (-230.380) -- 0:00:46
      207000 -- (-228.832) [-231.473] (-232.906) (-228.179) * [-228.309] (-229.387) (-231.486) (-232.139) -- 0:00:45
      207500 -- (-232.330) (-236.131) [-229.036] (-228.908) * [-228.800] (-231.111) (-231.424) (-230.289) -- 0:00:45
      208000 -- (-229.322) [-230.148] (-231.340) (-229.817) * [-230.535] (-229.547) (-229.865) (-228.901) -- 0:00:45
      208500 -- (-228.952) (-231.228) [-232.551] (-229.514) * [-229.421] (-229.678) (-228.889) (-228.530) -- 0:00:45
      209000 -- [-229.967] (-229.502) (-232.820) (-230.675) * (-230.930) (-230.120) (-230.778) [-230.442] -- 0:00:45
      209500 -- (-230.211) (-228.531) (-233.072) [-229.028] * (-228.129) [-230.175] (-228.149) (-231.496) -- 0:00:45
      210000 -- (-230.142) (-230.465) (-229.853) [-230.616] * (-232.497) (-233.092) [-229.432] (-229.462) -- 0:00:45

      Average standard deviation of split frequencies: 0.014742

      210500 -- (-229.144) (-230.384) [-231.750] (-229.236) * (-230.464) (-232.754) (-232.371) [-228.890] -- 0:00:45
      211000 -- (-229.506) (-230.020) [-231.718] (-230.535) * (-230.301) [-228.111] (-233.652) (-228.572) -- 0:00:44
      211500 -- (-229.878) (-229.394) [-228.880] (-229.941) * (-232.002) [-228.973] (-229.204) (-231.070) -- 0:00:44
      212000 -- (-233.352) (-231.679) [-231.878] (-231.678) * [-232.920] (-232.582) (-230.235) (-233.115) -- 0:00:44
      212500 -- (-230.428) (-232.989) (-228.632) [-228.827] * (-229.172) (-231.180) (-230.288) [-231.645] -- 0:00:44
      213000 -- (-229.121) (-229.618) [-228.331] (-229.115) * [-230.501] (-228.979) (-228.464) (-230.311) -- 0:00:44
      213500 -- (-232.774) (-230.013) (-228.775) [-228.185] * (-232.256) (-228.127) [-228.366] (-228.689) -- 0:00:44
      214000 -- [-230.140] (-231.365) (-229.397) (-228.365) * (-228.656) [-231.415] (-234.891) (-232.465) -- 0:00:44
      214500 -- [-229.071] (-230.537) (-229.576) (-228.200) * (-230.100) (-230.522) (-231.169) [-232.217] -- 0:00:47
      215000 -- (-229.393) (-229.111) (-228.073) [-229.250] * [-229.702] (-230.282) (-232.341) (-231.885) -- 0:00:47

      Average standard deviation of split frequencies: 0.015405

      215500 -- (-232.259) [-232.797] (-233.292) (-229.859) * [-228.593] (-235.569) (-229.460) (-228.188) -- 0:00:47
      216000 -- (-234.025) (-235.196) (-231.076) [-231.440] * [-229.764] (-234.607) (-231.093) (-231.176) -- 0:00:47
      216500 -- [-233.246] (-234.201) (-230.961) (-229.926) * (-229.384) (-234.260) [-228.598] (-228.198) -- 0:00:47
      217000 -- (-229.015) [-230.883] (-233.637) (-231.637) * (-229.643) (-234.133) (-230.506) [-229.882] -- 0:00:46
      217500 -- (-231.001) [-229.458] (-232.290) (-229.102) * (-230.824) [-232.904] (-230.008) (-228.806) -- 0:00:46
      218000 -- (-229.145) (-229.523) (-228.416) [-229.364] * (-230.072) (-231.991) [-230.053] (-231.409) -- 0:00:46
      218500 -- (-228.005) (-229.403) (-228.331) [-230.564] * (-231.406) [-230.502] (-229.374) (-234.065) -- 0:00:46
      219000 -- (-228.970) (-230.897) [-230.689] (-230.259) * (-232.633) (-235.414) (-230.360) [-230.563] -- 0:00:46
      219500 -- [-229.866] (-234.013) (-230.996) (-230.424) * [-232.739] (-227.893) (-230.498) (-229.065) -- 0:00:46
      220000 -- (-230.839) (-231.399) (-231.937) [-230.480] * (-230.585) (-229.142) [-229.877] (-228.941) -- 0:00:46

      Average standard deviation of split frequencies: 0.014717

      220500 -- [-228.742] (-231.683) (-229.079) (-230.211) * (-230.380) (-227.976) [-229.566] (-231.318) -- 0:00:45
      221000 -- (-232.765) (-230.461) (-232.722) [-229.645] * (-229.974) (-229.051) (-228.296) [-232.098] -- 0:00:45
      221500 -- (-231.520) (-229.421) (-233.167) [-231.368] * [-235.604] (-229.803) (-229.114) (-230.537) -- 0:00:45
      222000 -- (-230.844) (-231.403) [-229.886] (-230.925) * [-231.879] (-234.117) (-228.667) (-228.499) -- 0:00:45
      222500 -- (-229.596) [-230.733] (-229.504) (-229.457) * (-236.941) (-233.728) [-233.381] (-233.052) -- 0:00:45
      223000 -- [-231.835] (-229.905) (-229.557) (-233.022) * (-231.914) [-230.009] (-229.422) (-230.447) -- 0:00:45
      223500 -- (-229.646) (-230.841) (-229.563) [-231.528] * (-231.039) (-229.872) (-230.844) [-230.822] -- 0:00:45
      224000 -- (-229.574) (-229.904) [-231.543] (-229.385) * [-229.446] (-229.414) (-230.414) (-230.144) -- 0:00:45
      224500 -- (-228.436) [-229.224] (-229.569) (-230.117) * [-233.182] (-229.055) (-233.817) (-233.618) -- 0:00:44
      225000 -- (-229.118) (-231.013) [-231.583] (-228.218) * (-228.694) (-229.327) (-234.530) [-230.505] -- 0:00:44

      Average standard deviation of split frequencies: 0.014485

      225500 -- (-229.247) (-229.075) (-232.236) [-230.316] * (-229.139) [-228.624] (-229.872) (-229.733) -- 0:00:44
      226000 -- (-230.396) (-228.447) (-232.797) [-228.431] * (-230.102) [-231.414] (-231.004) (-230.342) -- 0:00:44
      226500 -- [-232.115] (-229.393) (-230.645) (-231.248) * (-229.314) [-231.245] (-229.577) (-228.538) -- 0:00:44
      227000 -- (-229.182) (-234.862) (-228.192) [-234.267] * (-233.621) (-231.590) (-231.367) [-229.504] -- 0:00:44
      227500 -- (-229.082) (-236.674) [-229.707] (-235.524) * (-228.422) (-231.159) [-233.413] (-230.518) -- 0:00:44
      228000 -- (-233.268) [-229.626] (-230.024) (-230.488) * (-231.904) (-234.158) [-232.481] (-229.440) -- 0:00:44
      228500 -- (-230.565) (-234.442) [-229.689] (-228.893) * (-233.300) (-229.776) (-230.057) [-230.513] -- 0:00:43
      229000 -- [-229.004] (-230.450) (-230.825) (-230.133) * (-232.292) (-229.882) (-228.675) [-229.013] -- 0:00:43
      229500 -- (-232.242) (-230.772) (-229.193) [-228.702] * (-230.451) (-228.998) (-228.135) [-228.333] -- 0:00:43
      230000 -- (-229.481) (-228.414) [-230.601] (-231.513) * (-230.396) (-230.401) (-228.919) [-229.091] -- 0:00:43

      Average standard deviation of split frequencies: 0.014646

      230500 -- (-232.590) (-228.526) (-229.036) [-232.214] * (-229.997) (-229.141) (-230.519) [-229.505] -- 0:00:43
      231000 -- (-229.271) [-230.766] (-230.097) (-233.672) * (-228.879) (-230.185) [-229.949] (-228.808) -- 0:00:43
      231500 -- (-230.582) (-229.620) (-231.929) [-228.785] * (-230.458) (-230.168) (-230.021) [-228.406] -- 0:00:46
      232000 -- (-228.428) (-231.237) [-230.025] (-231.858) * (-228.779) (-229.648) [-232.351] (-231.363) -- 0:00:46
      232500 -- (-229.532) (-232.746) [-229.031] (-230.169) * (-232.967) (-229.482) [-232.012] (-233.397) -- 0:00:46
      233000 -- (-232.583) (-230.799) (-230.106) [-229.253] * (-230.050) (-232.409) [-228.151] (-231.221) -- 0:00:46
      233500 -- (-233.344) [-232.176] (-231.663) (-231.099) * [-229.507] (-229.414) (-229.760) (-231.821) -- 0:00:45
      234000 -- [-228.593] (-228.630) (-232.358) (-233.635) * (-230.624) [-230.516] (-229.732) (-229.349) -- 0:00:45
      234500 -- (-229.802) (-230.310) [-230.068] (-231.405) * (-230.701) [-228.104] (-231.590) (-230.286) -- 0:00:45
      235000 -- (-229.095) (-229.656) (-232.777) [-229.017] * (-232.056) (-232.061) [-232.800] (-238.680) -- 0:00:45

      Average standard deviation of split frequencies: 0.014204

      235500 -- [-231.156] (-230.596) (-233.498) (-234.532) * (-230.142) (-232.848) [-227.870] (-231.584) -- 0:00:45
      236000 -- (-230.916) (-230.122) [-230.097] (-231.915) * (-234.940) (-228.918) (-228.778) [-228.019] -- 0:00:45
      236500 -- (-231.587) (-231.357) [-229.528] (-230.615) * (-235.271) [-230.324] (-232.072) (-231.924) -- 0:00:45
      237000 -- [-231.644] (-232.406) (-231.009) (-228.281) * (-232.377) [-229.208] (-228.670) (-231.028) -- 0:00:45
      237500 -- (-232.758) (-230.414) (-231.287) [-228.490] * (-228.408) [-229.447] (-232.164) (-228.755) -- 0:00:44
      238000 -- (-229.955) (-229.666) (-228.486) [-229.381] * [-231.265] (-231.566) (-228.323) (-232.144) -- 0:00:44
      238500 -- (-231.695) (-230.215) [-229.855] (-229.764) * (-230.930) (-232.522) (-229.992) [-230.862] -- 0:00:44
      239000 -- (-228.821) (-235.998) (-228.864) [-228.572] * (-236.261) [-229.221] (-229.268) (-230.508) -- 0:00:44
      239500 -- (-228.916) (-231.178) [-229.922] (-229.483) * (-234.301) [-229.759] (-232.501) (-231.311) -- 0:00:44
      240000 -- (-229.985) [-230.834] (-235.619) (-228.787) * (-231.025) (-228.803) (-230.566) [-228.137] -- 0:00:44

      Average standard deviation of split frequencies: 0.013402

      240500 -- (-229.895) (-230.480) (-233.438) [-228.479] * (-228.612) (-228.773) [-230.718] (-230.376) -- 0:00:44
      241000 -- (-230.949) (-230.629) [-230.398] (-228.363) * [-229.056] (-228.267) (-230.669) (-230.642) -- 0:00:44
      241500 -- (-230.631) (-228.816) (-230.275) [-228.961] * [-230.066] (-230.137) (-230.552) (-229.224) -- 0:00:43
      242000 -- [-229.057] (-229.211) (-229.760) (-230.538) * (-232.751) (-231.086) (-232.770) [-229.477] -- 0:00:43
      242500 -- [-229.688] (-228.450) (-230.407) (-227.906) * (-231.962) [-229.598] (-228.685) (-228.884) -- 0:00:43
      243000 -- (-229.897) (-232.689) (-232.608) [-229.780] * [-229.230] (-232.072) (-231.337) (-229.657) -- 0:00:43
      243500 -- [-229.748] (-230.559) (-231.005) (-229.815) * (-230.367) [-229.407] (-229.835) (-229.990) -- 0:00:43
      244000 -- [-229.082] (-228.208) (-229.328) (-229.533) * (-230.863) [-229.190] (-228.899) (-231.721) -- 0:00:43
      244500 -- [-229.297] (-230.874) (-228.561) (-231.004) * (-229.890) (-231.236) [-230.334] (-239.680) -- 0:00:43
      245000 -- (-233.410) [-229.744] (-231.014) (-229.471) * (-228.412) (-232.517) (-229.238) [-230.490] -- 0:00:43

      Average standard deviation of split frequencies: 0.013111

      245500 -- (-232.644) (-228.477) (-229.500) [-229.525] * [-228.993] (-231.912) (-229.965) (-232.956) -- 0:00:43
      246000 -- (-232.308) (-230.850) (-232.196) [-229.604] * (-228.258) [-231.297] (-229.799) (-229.327) -- 0:00:42
      246500 -- (-236.056) [-231.962] (-235.750) (-233.624) * [-230.180] (-228.860) (-235.381) (-229.762) -- 0:00:42
      247000 -- [-229.660] (-231.135) (-234.207) (-231.938) * (-229.724) (-230.560) [-229.309] (-231.757) -- 0:00:42
      247500 -- (-232.531) (-233.324) (-230.775) [-232.051] * (-230.144) [-230.426] (-230.564) (-229.400) -- 0:00:42
      248000 -- (-229.210) (-230.652) (-229.332) [-229.562] * (-231.275) (-233.240) [-229.870] (-230.335) -- 0:00:42
      248500 -- (-230.042) (-227.930) [-232.250] (-228.689) * (-230.826) [-229.397] (-230.217) (-231.614) -- 0:00:45
      249000 -- (-228.487) [-229.408] (-231.483) (-231.270) * (-229.459) (-231.711) (-231.960) [-230.034] -- 0:00:45
      249500 -- (-228.335) [-229.443] (-230.645) (-231.170) * (-231.630) (-230.742) (-232.583) [-229.341] -- 0:00:45
      250000 -- (-230.235) (-229.934) [-229.523] (-231.129) * (-229.736) [-229.900] (-232.459) (-229.437) -- 0:00:45

      Average standard deviation of split frequencies: 0.013857

      250500 -- (-230.480) [-230.113] (-231.758) (-230.797) * (-231.523) [-229.146] (-231.356) (-229.914) -- 0:00:44
      251000 -- [-229.077] (-229.260) (-230.183) (-231.320) * (-229.324) [-229.909] (-229.762) (-233.426) -- 0:00:44
      251500 -- [-229.119] (-231.022) (-230.481) (-229.462) * (-232.079) (-229.829) (-229.069) [-231.655] -- 0:00:44
      252000 -- [-228.812] (-229.415) (-233.012) (-231.600) * [-231.437] (-230.988) (-235.374) (-228.481) -- 0:00:44
      252500 -- (-230.991) [-230.100] (-228.423) (-228.544) * (-231.334) [-229.836] (-228.770) (-229.332) -- 0:00:44
      253000 -- (-228.476) [-230.778] (-230.319) (-228.154) * [-232.894] (-229.168) (-229.417) (-232.475) -- 0:00:44
      253500 -- (-230.414) (-230.944) (-231.032) [-228.761] * (-230.322) [-229.031] (-229.881) (-232.489) -- 0:00:44
      254000 -- (-231.215) (-229.694) (-229.327) [-228.986] * (-236.522) [-228.265] (-231.760) (-233.520) -- 0:00:44
      254500 -- (-231.611) (-229.793) (-229.706) [-228.331] * (-229.871) (-229.089) [-232.365] (-231.370) -- 0:00:43
      255000 -- (-232.093) (-229.440) (-230.354) [-229.137] * (-230.733) (-228.214) (-231.068) [-228.775] -- 0:00:43

      Average standard deviation of split frequencies: 0.011727

      255500 -- (-235.768) (-228.757) (-229.226) [-233.509] * (-228.990) (-231.176) [-228.238] (-231.601) -- 0:00:43
      256000 -- [-231.768] (-229.005) (-229.941) (-229.504) * [-229.722] (-230.309) (-231.732) (-235.017) -- 0:00:43
      256500 -- (-230.259) (-228.501) (-229.352) [-231.179] * [-230.498] (-228.613) (-229.107) (-228.312) -- 0:00:43
      257000 -- (-229.976) [-228.830] (-229.021) (-230.369) * (-230.995) [-229.302] (-230.370) (-228.498) -- 0:00:43
      257500 -- [-230.392] (-233.520) (-227.902) (-231.512) * (-230.371) (-231.542) (-231.546) [-229.121] -- 0:00:43
      258000 -- (-232.452) (-232.296) (-232.000) [-236.510] * (-231.319) [-230.883] (-229.163) (-231.567) -- 0:00:43
      258500 -- (-231.254) (-229.806) [-231.157] (-237.612) * (-230.362) [-229.937] (-234.355) (-230.084) -- 0:00:43
      259000 -- (-233.316) (-229.628) (-230.591) [-236.735] * (-229.214) (-228.447) (-234.730) [-229.353] -- 0:00:42
      259500 -- [-229.447] (-229.596) (-232.664) (-234.781) * [-230.835] (-229.454) (-235.043) (-228.474) -- 0:00:42
      260000 -- [-228.290] (-233.697) (-230.972) (-233.656) * [-230.164] (-229.125) (-232.177) (-228.916) -- 0:00:42

      Average standard deviation of split frequencies: 0.012659

      260500 -- [-228.255] (-232.654) (-236.286) (-229.943) * [-229.240] (-231.464) (-230.950) (-229.211) -- 0:00:42
      261000 -- (-228.388) (-229.319) (-230.208) [-230.122] * (-229.187) (-231.943) [-229.762] (-230.285) -- 0:00:42
      261500 -- (-229.467) (-229.879) [-229.453] (-233.162) * [-229.466] (-231.338) (-229.756) (-230.046) -- 0:00:42
      262000 -- (-228.469) [-229.321] (-229.041) (-233.510) * (-231.144) (-231.549) [-228.951] (-229.600) -- 0:00:42
      262500 -- (-229.477) [-230.188] (-232.034) (-230.737) * (-228.857) (-229.024) [-229.344] (-230.722) -- 0:00:42
      263000 -- (-234.023) [-234.884] (-229.974) (-229.868) * (-228.296) [-229.620] (-235.194) (-229.782) -- 0:00:42
      263500 -- (-230.271) (-231.388) [-230.166] (-230.032) * (-229.585) (-231.729) (-231.599) [-230.251] -- 0:00:41
      264000 -- (-230.162) (-232.926) (-230.266) [-228.941] * (-229.306) (-230.067) [-230.907] (-231.379) -- 0:00:41
      264500 -- [-228.978] (-230.897) (-230.346) (-228.907) * [-228.601] (-230.849) (-228.265) (-231.378) -- 0:00:41
      265000 -- (-227.930) (-229.910) [-229.958] (-230.085) * (-232.026) (-233.714) [-229.790] (-233.599) -- 0:00:41

      Average standard deviation of split frequencies: 0.013152

      265500 -- (-228.809) (-231.188) (-229.772) [-230.331] * [-234.315] (-231.736) (-230.438) (-232.138) -- 0:00:44
      266000 -- (-230.058) (-228.896) (-230.566) [-228.255] * (-231.726) [-230.003] (-232.554) (-229.585) -- 0:00:44
      266500 -- [-230.283] (-231.144) (-228.501) (-229.291) * (-230.170) (-231.118) (-233.219) [-231.190] -- 0:00:44
      267000 -- (-229.410) [-231.237] (-232.792) (-230.290) * [-228.213] (-229.754) (-228.788) (-228.320) -- 0:00:43
      267500 -- [-232.003] (-230.529) (-228.726) (-228.754) * (-229.764) (-232.642) (-232.169) [-228.537] -- 0:00:43
      268000 -- (-229.455) (-232.708) [-228.654] (-232.143) * [-229.068] (-230.294) (-230.071) (-229.498) -- 0:00:43
      268500 -- (-231.115) (-228.472) [-229.037] (-229.650) * (-234.886) [-229.959] (-229.276) (-229.790) -- 0:00:43
      269000 -- (-230.010) (-229.992) (-228.402) [-230.822] * (-228.394) (-231.804) (-228.512) [-229.437] -- 0:00:43
      269500 -- (-228.923) (-234.043) [-228.680] (-232.560) * (-228.163) [-231.897] (-230.208) (-229.469) -- 0:00:43
      270000 -- (-232.405) [-232.112] (-228.915) (-228.669) * (-230.011) (-229.551) (-232.044) [-230.133] -- 0:00:43

      Average standard deviation of split frequencies: 0.012558

      270500 -- (-229.927) (-232.840) [-230.321] (-229.093) * [-230.607] (-230.322) (-227.844) (-231.598) -- 0:00:43
      271000 -- (-235.215) (-231.895) [-229.643] (-229.231) * (-236.044) [-230.775] (-229.886) (-234.241) -- 0:00:43
      271500 -- (-229.349) (-230.380) [-230.483] (-230.382) * (-234.840) [-231.374] (-228.283) (-231.295) -- 0:00:42
      272000 -- (-229.461) [-233.538] (-229.911) (-229.100) * (-228.418) [-230.701] (-232.324) (-229.099) -- 0:00:42
      272500 -- (-228.809) (-229.305) [-234.618] (-230.100) * (-231.335) (-233.332) [-230.047] (-235.903) -- 0:00:42
      273000 -- (-228.722) (-232.525) (-232.998) [-228.676] * (-228.686) [-231.661] (-235.474) (-229.848) -- 0:00:42
      273500 -- [-230.247] (-229.561) (-232.292) (-229.788) * (-231.545) (-231.803) (-227.984) [-229.277] -- 0:00:42
      274000 -- (-233.330) [-228.106] (-228.038) (-229.498) * [-230.030] (-230.091) (-229.731) (-229.910) -- 0:00:42
      274500 -- [-228.631] (-230.248) (-231.326) (-231.559) * (-229.595) (-232.050) (-230.696) [-230.048] -- 0:00:42
      275000 -- (-231.942) (-232.551) [-229.042] (-230.256) * (-228.894) [-231.437] (-233.196) (-230.966) -- 0:00:42

      Average standard deviation of split frequencies: 0.013125

      275500 -- [-229.473] (-231.428) (-233.614) (-229.449) * (-229.966) (-232.015) [-232.107] (-229.974) -- 0:00:42
      276000 -- [-232.533] (-228.936) (-229.682) (-231.687) * [-230.844] (-230.778) (-231.636) (-229.212) -- 0:00:41
      276500 -- (-229.743) (-229.301) [-229.914] (-229.226) * [-230.585] (-229.562) (-233.517) (-228.830) -- 0:00:41
      277000 -- (-229.459) (-231.607) (-228.024) [-229.690] * (-232.083) (-229.779) (-232.786) [-229.832] -- 0:00:41
      277500 -- (-230.129) [-233.058] (-229.080) (-230.093) * (-230.274) (-231.224) [-230.129] (-229.144) -- 0:00:41
      278000 -- (-230.475) [-229.366] (-229.287) (-229.856) * (-229.616) [-228.920] (-229.003) (-228.872) -- 0:00:41
      278500 -- (-230.020) (-232.609) [-230.174] (-230.006) * (-234.876) [-229.260] (-230.503) (-235.149) -- 0:00:41
      279000 -- (-229.572) (-235.493) [-231.767] (-232.617) * (-228.502) [-228.581] (-228.505) (-228.231) -- 0:00:41
      279500 -- [-232.705] (-234.832) (-233.075) (-232.062) * (-231.029) (-229.051) [-228.655] (-231.814) -- 0:00:41
      280000 -- (-234.661) (-231.635) (-229.385) [-230.271] * (-231.309) (-228.874) (-231.806) [-232.763] -- 0:00:41

      Average standard deviation of split frequencies: 0.012818

      280500 -- [-229.216] (-234.203) (-229.897) (-229.924) * (-230.710) (-231.429) (-232.612) [-230.470] -- 0:00:41
      281000 -- [-233.056] (-228.970) (-228.877) (-230.263) * [-229.949] (-232.234) (-228.988) (-232.295) -- 0:00:40
      281500 -- (-231.329) (-230.446) (-229.909) [-229.584] * (-230.511) (-229.930) [-231.038] (-231.133) -- 0:00:40
      282000 -- [-228.943] (-227.947) (-232.501) (-232.064) * (-231.237) [-230.767] (-236.833) (-228.418) -- 0:00:40
      282500 -- (-228.570) (-230.272) [-230.210] (-229.181) * (-231.349) (-229.412) (-230.218) [-230.087] -- 0:00:43
      283000 -- (-228.160) (-232.379) (-233.317) [-229.211] * (-229.722) [-229.173] (-229.453) (-232.580) -- 0:00:43
      283500 -- [-228.597] (-228.061) (-230.358) (-230.653) * (-231.733) (-228.984) [-229.793] (-228.852) -- 0:00:42
      284000 -- (-234.556) (-230.477) (-231.485) [-230.523] * (-228.628) (-230.643) (-228.635) [-229.922] -- 0:00:42
      284500 -- [-229.508] (-232.022) (-231.702) (-231.797) * (-231.170) [-230.324] (-228.183) (-229.747) -- 0:00:42
      285000 -- (-232.269) (-232.180) (-232.212) [-229.351] * (-236.412) [-231.600] (-231.158) (-229.125) -- 0:00:42

      Average standard deviation of split frequencies: 0.012666

      285500 -- [-227.928] (-233.364) (-229.429) (-233.102) * (-236.181) (-228.594) (-229.683) [-228.583] -- 0:00:42
      286000 -- (-228.965) (-231.583) [-229.345] (-229.963) * [-236.102] (-229.803) (-230.838) (-229.426) -- 0:00:42
      286500 -- [-229.719] (-228.828) (-233.784) (-233.692) * [-228.345] (-229.472) (-230.645) (-229.828) -- 0:00:42
      287000 -- (-231.045) [-229.768] (-228.677) (-234.550) * (-228.698) (-230.948) (-230.100) [-229.909] -- 0:00:42
      287500 -- (-229.730) (-231.375) (-230.711) [-228.576] * [-231.218] (-228.493) (-230.439) (-230.413) -- 0:00:42
      288000 -- (-231.633) (-232.661) (-231.387) [-228.896] * (-231.349) [-229.995] (-232.998) (-228.135) -- 0:00:42
      288500 -- [-229.556] (-232.547) (-229.528) (-229.352) * [-229.368] (-229.818) (-236.221) (-232.108) -- 0:00:41
      289000 -- (-228.255) [-230.360] (-231.195) (-229.004) * (-232.758) (-229.777) [-229.512] (-233.282) -- 0:00:41
      289500 -- [-231.807] (-229.196) (-233.304) (-227.928) * (-230.179) [-228.386] (-228.176) (-229.000) -- 0:00:41
      290000 -- [-229.848] (-228.431) (-229.513) (-229.324) * (-232.552) [-232.288] (-228.252) (-230.324) -- 0:00:41

      Average standard deviation of split frequencies: 0.013605

      290500 -- (-228.281) (-232.433) (-231.130) [-228.944] * (-230.471) (-228.813) [-228.492] (-229.841) -- 0:00:41
      291000 -- (-229.595) (-231.928) (-232.393) [-229.690] * (-233.491) [-230.342] (-228.909) (-229.076) -- 0:00:41
      291500 -- (-230.584) (-229.070) (-232.572) [-230.269] * (-230.082) (-235.885) [-230.358] (-230.230) -- 0:00:41
      292000 -- (-232.712) [-230.110] (-230.335) (-229.211) * (-231.108) [-233.062] (-231.904) (-233.654) -- 0:00:41
      292500 -- (-229.209) [-228.614] (-229.009) (-230.457) * (-230.982) (-229.184) [-228.986] (-229.608) -- 0:00:41
      293000 -- (-229.784) [-230.230] (-230.360) (-230.089) * (-231.886) [-228.343] (-228.174) (-229.646) -- 0:00:41
      293500 -- (-229.013) (-230.145) [-231.139] (-232.205) * [-228.168] (-230.615) (-228.250) (-232.665) -- 0:00:40
      294000 -- (-228.213) (-230.285) (-229.925) [-229.481] * [-228.647] (-228.296) (-230.695) (-229.247) -- 0:00:40
      294500 -- (-233.381) (-232.329) [-229.968] (-230.033) * (-229.028) [-228.833] (-229.961) (-229.816) -- 0:00:40
      295000 -- [-230.683] (-228.228) (-227.864) (-231.951) * (-228.675) [-229.190] (-232.485) (-230.696) -- 0:00:40

      Average standard deviation of split frequencies: 0.013006

      295500 -- (-230.714) [-228.676] (-228.338) (-232.331) * (-228.569) (-229.981) (-228.324) [-233.790] -- 0:00:40
      296000 -- (-231.209) [-229.763] (-231.348) (-234.064) * (-231.210) [-234.778] (-229.313) (-229.621) -- 0:00:40
      296500 -- (-232.332) [-228.967] (-230.010) (-237.438) * (-231.711) [-229.461] (-228.845) (-233.111) -- 0:00:40
      297000 -- [-229.374] (-230.754) (-232.625) (-230.238) * (-231.471) [-229.333] (-228.680) (-229.900) -- 0:00:40
      297500 -- (-229.256) (-233.702) [-228.359] (-231.877) * [-230.228] (-227.932) (-229.048) (-228.898) -- 0:00:40
      298000 -- (-228.788) [-234.610] (-230.148) (-231.081) * (-230.095) (-239.915) (-228.588) [-230.600] -- 0:00:40
      298500 -- [-229.071] (-230.010) (-233.918) (-231.502) * [-229.098] (-231.731) (-228.299) (-228.590) -- 0:00:39
      299000 -- (-230.787) (-230.901) (-234.200) [-228.939] * (-230.497) [-231.321] (-233.714) (-231.850) -- 0:00:39
      299500 -- (-230.404) (-229.217) [-236.965] (-231.698) * (-231.785) [-234.229] (-231.964) (-229.849) -- 0:00:42
      300000 -- [-228.533] (-228.326) (-229.448) (-231.334) * [-227.980] (-230.556) (-232.461) (-231.040) -- 0:00:42

      Average standard deviation of split frequencies: 0.012020

      300500 -- (-228.339) (-229.052) (-230.513) [-228.904] * (-229.580) [-230.286] (-230.322) (-229.881) -- 0:00:41
      301000 -- (-230.140) [-228.658] (-231.220) (-229.635) * (-228.316) (-229.706) (-234.414) [-229.392] -- 0:00:41
      301500 -- (-229.051) (-233.701) (-231.000) [-229.975] * (-228.379) (-229.146) (-230.663) [-231.467] -- 0:00:41
      302000 -- (-229.182) [-234.211] (-229.309) (-232.856) * (-230.478) (-229.185) (-231.942) [-228.357] -- 0:00:41
      302500 -- (-228.770) (-234.120) (-229.348) [-229.117] * (-232.546) [-233.093] (-231.385) (-229.653) -- 0:00:41
      303000 -- (-228.642) (-232.608) [-233.082] (-228.522) * [-228.206] (-233.542) (-228.552) (-230.215) -- 0:00:41
      303500 -- (-228.648) (-230.840) (-229.081) [-230.449] * (-229.340) (-230.482) (-228.844) [-230.495] -- 0:00:41
      304000 -- [-229.101] (-233.394) (-228.519) (-230.321) * [-229.310] (-230.753) (-233.170) (-230.273) -- 0:00:41
      304500 -- (-231.322) (-233.794) [-230.446] (-229.174) * (-229.496) (-229.799) (-229.886) [-229.137] -- 0:00:41
      305000 -- (-229.201) (-231.042) [-229.792] (-230.275) * [-230.208] (-231.283) (-229.796) (-232.855) -- 0:00:41

      Average standard deviation of split frequencies: 0.012410

      305500 -- [-231.822] (-230.507) (-229.908) (-229.436) * (-229.461) [-230.361] (-230.097) (-229.093) -- 0:00:40
      306000 -- (-229.635) [-229.138] (-228.052) (-231.126) * (-231.172) (-232.002) (-230.349) [-231.365] -- 0:00:40
      306500 -- (-229.330) [-228.818] (-231.953) (-228.902) * [-229.659] (-231.800) (-230.455) (-229.916) -- 0:00:40
      307000 -- [-229.935] (-229.317) (-228.240) (-231.075) * (-228.920) [-231.080] (-233.915) (-231.939) -- 0:00:40
      307500 -- (-231.453) (-232.131) [-231.503] (-228.562) * [-228.652] (-232.534) (-233.649) (-229.678) -- 0:00:40
      308000 -- [-232.135] (-233.933) (-230.942) (-229.287) * [-231.550] (-234.300) (-230.964) (-230.807) -- 0:00:40
      308500 -- (-233.275) [-229.161] (-228.710) (-228.775) * (-232.531) [-229.633] (-228.550) (-228.026) -- 0:00:40
      309000 -- (-234.571) (-233.152) [-230.488] (-228.059) * (-228.134) (-229.223) [-229.443] (-228.997) -- 0:00:40
      309500 -- (-228.897) (-233.893) (-232.015) [-233.870] * [-232.616] (-229.919) (-231.252) (-229.332) -- 0:00:40
      310000 -- (-229.514) (-234.045) (-228.674) [-231.540] * (-231.070) (-230.873) (-229.720) [-228.971] -- 0:00:40

      Average standard deviation of split frequencies: 0.012561

      310500 -- (-232.069) (-234.999) (-233.314) [-231.548] * [-234.208] (-229.533) (-232.343) (-230.759) -- 0:00:39
      311000 -- (-229.063) [-230.091] (-232.798) (-231.888) * [-235.374] (-231.232) (-237.302) (-230.420) -- 0:00:39
      311500 -- (-230.072) (-229.389) (-230.306) [-228.973] * [-231.401] (-228.715) (-229.864) (-233.711) -- 0:00:39
      312000 -- [-234.615] (-229.525) (-232.949) (-231.458) * (-231.171) (-229.103) [-229.724] (-228.982) -- 0:00:39
      312500 -- [-230.056] (-230.245) (-229.470) (-232.660) * (-231.099) (-228.790) [-232.273] (-229.363) -- 0:00:39
      313000 -- [-231.267] (-230.099) (-230.453) (-231.820) * [-229.413] (-229.411) (-230.122) (-228.771) -- 0:00:39
      313500 -- (-231.862) [-229.101] (-231.937) (-228.488) * (-231.265) (-229.941) [-230.324] (-233.765) -- 0:00:39
      314000 -- (-230.308) (-229.590) [-232.969] (-232.855) * (-229.674) (-232.252) [-230.239] (-229.185) -- 0:00:39
      314500 -- (-230.205) (-229.223) (-231.511) [-229.836] * (-230.493) (-232.569) [-229.745] (-229.484) -- 0:00:39
      315000 -- (-232.834) (-232.188) [-229.764] (-229.637) * (-234.763) (-230.785) (-233.102) [-230.170] -- 0:00:39

      Average standard deviation of split frequencies: 0.011603

      315500 -- (-230.391) (-231.242) [-228.556] (-230.655) * [-231.060] (-230.856) (-229.016) (-230.443) -- 0:00:39
      316000 -- (-229.737) (-230.990) [-228.474] (-232.433) * (-229.299) (-230.207) (-229.056) [-230.982] -- 0:00:38
      316500 -- (-229.468) [-230.981] (-229.401) (-230.048) * [-234.961] (-227.922) (-236.718) (-229.521) -- 0:00:41
      317000 -- [-230.006] (-229.611) (-231.274) (-233.961) * (-229.196) (-229.020) (-231.863) [-229.427] -- 0:00:40
      317500 -- [-228.272] (-230.432) (-231.205) (-237.586) * (-230.468) [-231.760] (-230.543) (-229.473) -- 0:00:40
      318000 -- (-229.996) (-229.787) (-229.901) [-229.431] * (-229.849) (-233.272) (-229.129) [-229.577] -- 0:00:40
      318500 -- (-230.066) (-231.176) [-229.315] (-232.394) * (-228.425) (-233.249) (-230.539) [-229.328] -- 0:00:40
      319000 -- (-230.343) [-230.449] (-230.153) (-232.720) * (-229.954) (-232.455) (-233.181) [-229.654] -- 0:00:40
      319500 -- (-229.171) [-229.071] (-230.052) (-230.128) * (-231.602) (-231.107) (-228.660) [-232.941] -- 0:00:40
      320000 -- (-230.854) (-233.345) [-230.280] (-228.461) * (-232.970) (-234.185) [-228.882] (-230.895) -- 0:00:40

      Average standard deviation of split frequencies: 0.011842

      320500 -- [-231.394] (-231.379) (-232.838) (-228.615) * (-230.513) [-235.059] (-230.321) (-230.873) -- 0:00:40
      321000 -- [-229.010] (-229.995) (-234.386) (-232.150) * (-230.500) (-231.345) (-229.547) [-230.826] -- 0:00:40
      321500 -- (-230.257) (-229.659) (-229.808) [-231.545] * (-232.701) [-229.362] (-232.586) (-229.417) -- 0:00:40
      322000 -- (-231.992) [-230.571] (-228.413) (-231.541) * [-228.578] (-229.602) (-229.151) (-230.519) -- 0:00:40
      322500 -- (-229.288) [-229.536] (-229.379) (-231.758) * (-229.469) (-233.232) (-230.561) [-233.499] -- 0:00:39
      323000 -- (-229.198) (-229.332) [-231.248] (-229.540) * (-230.256) [-229.488] (-228.619) (-232.800) -- 0:00:39
      323500 -- (-229.517) (-229.022) (-232.002) [-228.560] * [-230.836] (-229.144) (-229.833) (-230.526) -- 0:00:39
      324000 -- [-231.920] (-230.384) (-231.917) (-228.344) * (-228.708) (-229.618) (-229.622) [-230.103] -- 0:00:39
      324500 -- [-230.203] (-231.944) (-230.426) (-228.999) * (-231.853) (-232.156) (-228.172) [-229.692] -- 0:00:39
      325000 -- (-230.184) [-230.209] (-229.670) (-228.613) * [-232.286] (-229.840) (-228.564) (-231.323) -- 0:00:39

      Average standard deviation of split frequencies: 0.011086

      325500 -- [-231.604] (-231.913) (-230.406) (-228.806) * [-230.858] (-232.551) (-229.346) (-230.378) -- 0:00:39
      326000 -- [-232.168] (-228.389) (-229.074) (-230.920) * (-229.008) [-229.156] (-231.218) (-228.887) -- 0:00:39
      326500 -- (-232.140) (-229.286) [-231.104] (-230.050) * (-230.555) [-229.647] (-229.233) (-228.108) -- 0:00:39
      327000 -- (-233.881) (-229.364) (-229.449) [-228.812] * [-228.883] (-229.541) (-228.226) (-229.311) -- 0:00:39
      327500 -- (-230.017) (-229.500) [-230.859] (-228.299) * (-231.192) [-231.868] (-228.198) (-231.350) -- 0:00:39
      328000 -- (-232.313) [-230.491] (-230.006) (-229.851) * [-229.229] (-230.166) (-228.836) (-237.231) -- 0:00:38
      328500 -- (-231.628) (-229.126) [-229.906] (-231.056) * [-228.650] (-230.383) (-229.986) (-229.896) -- 0:00:38
      329000 -- (-228.793) (-231.096) [-230.061] (-231.223) * (-230.205) [-229.687] (-229.652) (-230.960) -- 0:00:38
      329500 -- (-229.770) (-229.201) [-232.448] (-230.756) * (-229.476) (-232.977) (-230.378) [-228.715] -- 0:00:40
      330000 -- [-228.725] (-229.740) (-229.070) (-234.245) * (-230.426) (-232.064) (-232.034) [-228.645] -- 0:00:40

      Average standard deviation of split frequencies: 0.010851

      330500 -- (-234.884) (-230.447) [-232.440] (-234.563) * (-230.534) [-230.720] (-228.761) (-231.518) -- 0:00:40
      331000 -- (-229.242) (-232.254) (-231.976) [-228.545] * (-234.515) (-230.720) [-230.653] (-228.543) -- 0:00:40
      331500 -- (-229.369) [-229.655] (-231.877) (-230.732) * (-230.680) [-228.896] (-230.519) (-232.799) -- 0:00:40
      332000 -- (-229.247) (-232.253) (-229.145) [-229.595] * (-234.149) (-230.636) (-230.623) [-233.722] -- 0:00:40
      332500 -- (-230.843) (-229.165) (-229.937) [-228.197] * (-228.064) [-231.362] (-228.130) (-230.877) -- 0:00:40
      333000 -- [-231.987] (-230.155) (-228.971) (-234.254) * [-229.071] (-227.831) (-229.571) (-232.620) -- 0:00:40
      333500 -- [-231.016] (-228.554) (-230.433) (-231.845) * (-229.848) [-230.138] (-230.681) (-228.923) -- 0:00:39
      334000 -- [-230.683] (-229.742) (-228.061) (-230.287) * (-229.451) (-228.416) (-228.738) [-229.297] -- 0:00:39
      334500 -- (-231.817) [-230.556] (-229.366) (-229.534) * (-231.278) (-229.776) [-230.600] (-229.671) -- 0:00:39
      335000 -- [-230.416] (-230.627) (-230.238) (-229.955) * (-235.538) (-229.679) [-229.990] (-230.884) -- 0:00:39

      Average standard deviation of split frequencies: 0.010316

      335500 -- (-228.321) (-233.341) (-230.383) [-230.817] * (-232.556) [-228.043] (-230.791) (-233.541) -- 0:00:39
      336000 -- (-228.928) (-231.998) [-228.842] (-229.174) * [-229.881] (-230.539) (-229.243) (-232.292) -- 0:00:39
      336500 -- (-232.018) (-231.530) (-228.605) [-228.549] * (-231.796) [-228.620] (-229.201) (-229.389) -- 0:00:39
      337000 -- (-231.744) [-228.423] (-229.037) (-229.958) * (-232.489) [-228.814] (-231.847) (-234.567) -- 0:00:39
      337500 -- (-228.074) (-229.641) [-232.200] (-230.038) * (-232.991) (-232.439) [-232.953] (-230.454) -- 0:00:39
      338000 -- (-230.933) (-231.220) (-231.988) [-229.906] * (-230.490) [-229.009] (-231.762) (-230.905) -- 0:00:39
      338500 -- [-229.088] (-233.998) (-228.643) (-232.100) * [-228.860] (-230.908) (-231.682) (-230.269) -- 0:00:39
      339000 -- (-230.354) (-236.170) [-230.594] (-229.477) * [-230.433] (-230.477) (-229.316) (-229.598) -- 0:00:38
      339500 -- [-230.638] (-229.229) (-235.864) (-232.611) * (-238.585) (-231.270) (-232.389) [-232.693] -- 0:00:38
      340000 -- [-230.810] (-237.173) (-230.690) (-233.442) * (-229.975) (-230.209) (-228.700) [-229.802] -- 0:00:38

      Average standard deviation of split frequencies: 0.009768

      340500 -- (-227.992) [-231.073] (-228.942) (-230.290) * (-230.607) [-228.319] (-232.003) (-230.499) -- 0:00:38
      341000 -- [-228.499] (-229.799) (-229.209) (-232.205) * [-230.565] (-230.050) (-229.973) (-231.736) -- 0:00:38
      341500 -- (-228.566) (-228.754) (-229.680) [-230.305] * [-228.573] (-230.745) (-230.605) (-230.453) -- 0:00:38
      342000 -- (-230.365) (-228.480) [-230.209] (-228.552) * (-234.142) (-228.628) (-233.937) [-230.049] -- 0:00:38
      342500 -- [-235.923] (-231.796) (-228.192) (-228.377) * (-230.333) (-231.837) [-230.027] (-230.916) -- 0:00:40
      343000 -- [-228.339] (-231.269) (-231.516) (-228.977) * [-230.633] (-230.504) (-228.648) (-228.748) -- 0:00:40
      343500 -- (-232.069) (-228.753) (-228.435) [-230.113] * (-233.380) (-230.377) (-228.736) [-229.428] -- 0:00:40
      344000 -- (-235.343) (-228.065) (-228.472) [-229.682] * (-232.949) [-230.221] (-230.315) (-228.883) -- 0:00:40
      344500 -- (-236.256) (-228.892) [-229.078] (-232.706) * [-232.684] (-232.667) (-229.271) (-230.674) -- 0:00:39
      345000 -- (-230.091) (-231.669) [-228.734] (-228.416) * (-237.219) (-229.554) (-230.309) [-230.022] -- 0:00:39

      Average standard deviation of split frequencies: 0.008976

      345500 -- (-229.560) (-230.492) (-229.672) [-230.068] * (-236.721) [-230.383] (-232.776) (-234.479) -- 0:00:39
      346000 -- [-229.685] (-230.948) (-231.489) (-229.387) * [-233.368] (-230.380) (-228.932) (-228.232) -- 0:00:39
      346500 -- (-236.755) [-230.040] (-228.891) (-233.334) * (-234.241) (-229.966) (-232.192) [-228.398] -- 0:00:39
      347000 -- (-228.290) [-229.222] (-230.235) (-235.332) * (-230.241) (-229.532) (-231.610) [-230.366] -- 0:00:39
      347500 -- (-230.372) [-229.230] (-230.038) (-234.546) * (-229.722) (-230.365) [-229.845] (-228.880) -- 0:00:39
      348000 -- [-229.561] (-229.428) (-229.579) (-233.466) * (-230.004) [-230.636] (-232.172) (-229.104) -- 0:00:39
      348500 -- (-229.648) (-228.866) (-230.453) [-231.124] * (-231.105) (-228.910) [-229.223] (-232.806) -- 0:00:39
      349000 -- (-230.443) (-229.380) [-230.450] (-228.069) * [-230.791] (-229.073) (-230.492) (-236.509) -- 0:00:39
      349500 -- (-229.201) [-232.654] (-230.291) (-231.155) * (-231.992) [-228.665] (-234.899) (-237.665) -- 0:00:39
      350000 -- [-228.172] (-232.341) (-228.251) (-233.024) * (-228.848) (-228.851) (-230.074) [-228.887] -- 0:00:39

      Average standard deviation of split frequencies: 0.009331

      350500 -- [-229.746] (-237.066) (-228.514) (-229.403) * (-229.546) (-229.023) (-229.838) [-229.431] -- 0:00:38
      351000 -- (-229.309) (-229.780) [-230.240] (-229.686) * [-228.130] (-231.948) (-229.106) (-229.780) -- 0:00:38
      351500 -- (-229.996) (-231.693) [-229.095] (-231.792) * (-230.643) [-229.480] (-229.796) (-228.257) -- 0:00:38
      352000 -- (-232.322) (-235.165) [-231.061] (-230.116) * [-229.043] (-233.583) (-228.025) (-230.899) -- 0:00:38
      352500 -- (-229.369) [-229.038] (-229.989) (-232.675) * (-230.108) [-229.823] (-230.586) (-230.034) -- 0:00:38
      353000 -- (-234.064) (-230.093) (-229.185) [-228.786] * (-229.698) [-232.200] (-230.745) (-228.672) -- 0:00:38
      353500 -- (-232.020) [-228.601] (-228.859) (-235.388) * (-230.935) [-230.789] (-230.113) (-234.843) -- 0:00:38
      354000 -- (-234.890) (-230.380) [-228.732] (-231.741) * [-232.811] (-229.879) (-231.924) (-235.025) -- 0:00:38
      354500 -- [-230.524] (-229.138) (-228.315) (-229.097) * (-231.354) (-232.335) (-228.677) [-230.303] -- 0:00:38
      355000 -- (-229.955) (-229.064) (-228.846) [-229.960] * [-228.905] (-231.881) (-229.348) (-229.654) -- 0:00:38

      Average standard deviation of split frequencies: 0.008568

      355500 -- (-229.206) [-228.449] (-228.026) (-231.508) * (-228.635) [-229.568] (-230.860) (-231.724) -- 0:00:38
      356000 -- (-231.352) [-231.322] (-228.956) (-228.540) * [-228.608] (-228.207) (-230.127) (-230.996) -- 0:00:37
      356500 -- (-229.292) (-230.163) [-228.552] (-233.205) * [-229.982] (-229.095) (-229.588) (-228.789) -- 0:00:37
      357000 -- (-232.504) (-228.113) [-228.552] (-230.570) * [-233.737] (-234.559) (-233.528) (-231.114) -- 0:00:39
      357500 -- (-229.108) [-231.467] (-229.034) (-231.274) * [-230.792] (-233.164) (-232.310) (-232.835) -- 0:00:39
      358000 -- (-228.028) [-230.760] (-229.467) (-228.054) * (-228.306) (-236.574) (-231.846) [-229.132] -- 0:00:39
      358500 -- (-229.485) (-230.343) [-228.345] (-233.803) * (-228.293) (-230.284) (-229.159) [-230.015] -- 0:00:39
      359000 -- [-230.987] (-229.838) (-229.299) (-229.431) * (-229.099) (-228.025) (-230.476) [-229.841] -- 0:00:39
      359500 -- (-229.015) (-229.314) [-229.422] (-228.863) * [-231.753] (-230.816) (-229.285) (-231.685) -- 0:00:39
      360000 -- (-228.185) (-232.016) [-229.055] (-230.019) * [-233.700] (-229.406) (-232.935) (-229.242) -- 0:00:39

      Average standard deviation of split frequencies: 0.009068

      360500 -- (-229.957) (-229.119) [-229.866] (-228.330) * [-228.230] (-228.603) (-231.837) (-236.548) -- 0:00:39
      361000 -- (-230.819) (-229.377) [-229.650] (-229.253) * (-229.292) (-229.955) [-230.760] (-237.606) -- 0:00:38
      361500 -- (-229.540) (-228.210) [-231.585] (-229.211) * [-230.881] (-229.004) (-229.315) (-232.116) -- 0:00:38
      362000 -- (-234.524) (-228.302) (-232.429) [-229.390] * [-228.852] (-230.346) (-231.834) (-231.737) -- 0:00:38
      362500 -- (-232.007) [-230.149] (-229.452) (-230.960) * [-231.591] (-229.030) (-233.882) (-229.425) -- 0:00:38
      363000 -- [-229.190] (-230.221) (-229.068) (-231.096) * (-231.379) [-228.407] (-233.277) (-229.526) -- 0:00:38
      363500 -- (-228.945) (-233.317) (-228.628) [-232.437] * (-228.889) [-230.069] (-232.823) (-230.409) -- 0:00:38
      364000 -- (-229.380) (-228.676) (-230.476) [-231.597] * (-233.231) (-235.594) [-229.304] (-231.641) -- 0:00:38
      364500 -- [-229.488] (-230.973) (-231.958) (-228.567) * (-234.340) [-230.430] (-228.957) (-235.113) -- 0:00:38
      365000 -- (-227.958) (-230.259) (-233.596) [-230.379] * (-231.164) [-231.107] (-231.600) (-236.008) -- 0:00:38

      Average standard deviation of split frequencies: 0.009177

      365500 -- (-231.028) [-229.186] (-235.441) (-230.291) * (-229.149) (-228.495) (-228.615) [-231.545] -- 0:00:38
      366000 -- (-230.642) (-230.521) [-230.605] (-230.631) * (-229.273) (-229.886) (-232.803) [-229.619] -- 0:00:38
      366500 -- (-232.191) (-227.854) [-230.160] (-229.489) * (-228.359) (-233.504) (-230.163) [-230.303] -- 0:00:38
      367000 -- (-231.012) (-228.617) [-232.251] (-233.556) * [-228.463] (-232.859) (-231.605) (-229.442) -- 0:00:37
      367500 -- (-231.576) (-230.142) [-230.655] (-229.648) * (-229.792) (-229.328) [-229.563] (-230.074) -- 0:00:37
      368000 -- (-229.441) [-229.631] (-231.878) (-233.229) * (-229.078) (-229.620) [-228.989] (-233.078) -- 0:00:37
      368500 -- [-228.547] (-230.276) (-230.433) (-230.249) * (-229.701) (-233.198) (-228.487) [-230.453] -- 0:00:37
      369000 -- (-230.875) [-233.844] (-230.839) (-229.875) * [-231.204] (-232.718) (-230.376) (-229.350) -- 0:00:37
      369500 -- (-230.160) [-228.551] (-229.607) (-230.262) * (-230.645) (-229.554) (-229.263) [-229.754] -- 0:00:37
      370000 -- (-231.800) (-228.826) [-234.326] (-228.114) * (-229.377) (-231.303) [-232.423] (-228.946) -- 0:00:37

      Average standard deviation of split frequencies: 0.009127

      370500 -- (-230.092) (-232.527) (-229.312) [-230.187] * [-231.000] (-231.834) (-233.672) (-229.514) -- 0:00:37
      371000 -- (-237.838) [-230.453] (-229.094) (-231.086) * (-232.676) (-232.227) (-232.551) [-229.528] -- 0:00:37
      371500 -- (-233.799) [-228.805] (-228.738) (-230.925) * [-229.761] (-230.107) (-235.768) (-228.415) -- 0:00:38
      372000 -- (-232.005) (-229.799) [-229.042] (-234.812) * [-228.915] (-232.832) (-232.568) (-229.676) -- 0:00:38
      372500 -- (-230.214) [-228.707] (-230.283) (-236.102) * [-229.276] (-232.822) (-234.606) (-231.862) -- 0:00:38
      373000 -- (-229.613) (-230.475) (-228.941) [-229.753] * (-229.663) (-234.482) [-230.293] (-232.193) -- 0:00:38
      373500 -- (-228.528) [-230.519] (-230.623) (-229.054) * (-232.138) (-232.277) (-230.163) [-230.037] -- 0:00:38
      374000 -- (-229.817) [-230.241] (-232.481) (-227.975) * (-231.446) (-231.493) (-229.644) [-229.655] -- 0:00:38
      374500 -- (-229.505) (-229.535) (-229.817) [-228.811] * (-228.700) (-233.797) (-231.535) [-229.597] -- 0:00:38
      375000 -- (-230.264) (-233.489) (-230.541) [-231.588] * [-230.896] (-231.212) (-231.320) (-232.439) -- 0:00:38

      Average standard deviation of split frequencies: 0.008855

      375500 -- (-228.884) (-229.377) [-231.711] (-230.345) * [-230.589] (-228.625) (-230.446) (-232.239) -- 0:00:38
      376000 -- (-233.912) (-231.457) [-230.736] (-232.412) * (-228.132) [-229.691] (-233.111) (-228.675) -- 0:00:38
      376500 -- [-230.947] (-235.233) (-230.026) (-230.881) * (-229.197) (-229.620) [-230.598] (-228.841) -- 0:00:38
      377000 -- (-229.246) [-233.696] (-229.804) (-228.505) * (-228.082) (-230.305) (-234.533) [-228.424] -- 0:00:38
      377500 -- (-230.838) [-229.110] (-229.737) (-230.261) * (-228.411) (-229.369) (-231.123) [-228.742] -- 0:00:37
      378000 -- (-234.425) [-231.280] (-228.689) (-230.584) * (-228.762) (-232.701) [-228.527] (-228.408) -- 0:00:37
      378500 -- (-233.045) (-229.134) (-229.948) [-228.791] * (-230.109) [-231.153] (-229.376) (-229.250) -- 0:00:37
      379000 -- (-231.958) (-231.840) (-235.117) [-231.837] * (-232.733) (-231.856) (-229.318) [-228.787] -- 0:00:37
      379500 -- (-233.901) (-235.599) (-232.160) [-234.654] * (-229.706) [-231.371] (-228.978) (-230.497) -- 0:00:37
      380000 -- (-230.085) (-233.810) [-229.348] (-230.814) * (-230.760) [-230.069] (-229.854) (-233.288) -- 0:00:37

      Average standard deviation of split frequencies: 0.008338

      380500 -- (-232.383) [-231.995] (-228.172) (-229.056) * [-232.160] (-230.616) (-228.432) (-231.273) -- 0:00:37
      381000 -- (-229.273) [-228.005] (-230.487) (-233.178) * (-230.515) [-230.923] (-232.153) (-231.028) -- 0:00:37
      381500 -- (-229.280) [-230.136] (-229.171) (-233.871) * (-227.899) [-230.279] (-232.025) (-232.165) -- 0:00:37
      382000 -- (-229.065) (-228.647) [-228.586] (-232.301) * [-228.260] (-233.498) (-232.046) (-228.839) -- 0:00:37
      382500 -- (-229.355) [-228.593] (-228.576) (-230.602) * (-233.913) (-229.294) (-231.361) [-228.194] -- 0:00:37
      383000 -- (-229.245) (-228.231) (-228.023) [-228.386] * (-235.418) (-228.135) [-233.655] (-234.128) -- 0:00:37
      383500 -- [-228.578] (-232.250) (-228.913) (-228.550) * (-228.019) (-237.424) [-230.322] (-234.951) -- 0:00:36
      384000 -- (-230.571) [-231.493] (-229.324) (-234.047) * [-228.298] (-232.674) (-232.562) (-230.652) -- 0:00:36
      384500 -- (-229.351) (-232.088) [-229.282] (-234.206) * (-229.176) (-231.127) (-228.722) [-229.049] -- 0:00:36
      385000 -- (-230.929) (-232.325) (-230.614) [-233.120] * [-229.645] (-229.449) (-230.157) (-230.738) -- 0:00:36

      Average standard deviation of split frequencies: 0.008386

      385500 -- (-228.020) [-231.819] (-228.189) (-231.895) * (-230.044) [-229.123] (-229.621) (-228.726) -- 0:00:36
      386000 -- (-229.128) [-231.197] (-229.131) (-230.349) * (-228.322) (-230.202) [-230.909] (-228.526) -- 0:00:38
      386500 -- [-229.888] (-230.948) (-229.055) (-229.454) * (-229.387) (-233.063) [-230.069] (-229.247) -- 0:00:38
      387000 -- [-229.507] (-229.969) (-228.835) (-230.500) * (-227.818) (-230.791) (-229.434) [-231.024] -- 0:00:38
      387500 -- (-232.193) (-228.602) [-230.648] (-228.813) * (-231.273) (-231.528) [-232.055] (-230.251) -- 0:00:37
      388000 -- (-229.871) (-232.016) (-232.584) [-229.304] * (-229.015) [-231.945] (-228.984) (-229.007) -- 0:00:37
      388500 -- [-229.025] (-228.867) (-230.799) (-229.443) * (-232.132) (-228.847) [-229.839] (-230.867) -- 0:00:37
      389000 -- (-228.412) [-228.991] (-228.843) (-229.535) * [-228.276] (-229.622) (-233.780) (-234.396) -- 0:00:37
      389500 -- (-229.813) [-229.021] (-232.899) (-228.060) * (-229.321) (-230.474) [-229.265] (-229.508) -- 0:00:37
      390000 -- (-232.224) (-228.790) (-230.616) [-229.524] * (-234.505) [-230.293] (-230.565) (-230.227) -- 0:00:37

      Average standard deviation of split frequencies: 0.007391

      390500 -- (-230.713) [-228.726] (-231.711) (-230.688) * (-235.366) (-228.659) [-228.913] (-229.448) -- 0:00:37
      391000 -- (-229.684) [-230.435] (-229.830) (-235.318) * (-233.749) (-230.795) (-228.889) [-228.961] -- 0:00:37
      391500 -- (-232.605) [-228.065] (-228.860) (-229.137) * (-232.728) [-229.318] (-229.791) (-228.633) -- 0:00:37
      392000 -- (-230.189) (-229.687) (-230.124) [-231.191] * (-228.458) [-230.737] (-228.978) (-228.451) -- 0:00:37
      392500 -- [-230.950] (-229.581) (-236.856) (-230.787) * [-230.110] (-232.205) (-229.766) (-230.044) -- 0:00:37
      393000 -- (-230.741) (-229.825) (-229.302) [-232.117] * (-231.285) (-228.602) [-231.565] (-233.070) -- 0:00:37
      393500 -- (-231.424) (-230.093) [-231.000] (-230.875) * (-232.478) (-231.500) (-230.669) [-227.929] -- 0:00:36
      394000 -- (-230.587) (-228.919) [-229.697] (-229.004) * (-232.286) (-229.499) [-229.645] (-231.363) -- 0:00:36
      394500 -- [-229.035] (-228.518) (-230.521) (-232.634) * [-228.871] (-233.276) (-230.101) (-230.780) -- 0:00:36
      395000 -- (-229.092) (-232.873) [-228.700] (-228.246) * [-230.249] (-229.265) (-233.313) (-229.529) -- 0:00:36

      Average standard deviation of split frequencies: 0.006825

      395500 -- [-229.790] (-230.165) (-228.349) (-229.698) * (-232.068) [-233.970] (-229.360) (-228.565) -- 0:00:36
      396000 -- (-231.955) (-230.140) (-228.153) [-230.949] * (-231.668) (-232.160) [-231.305] (-228.851) -- 0:00:36
      396500 -- [-229.123] (-228.870) (-230.848) (-232.801) * [-233.139] (-228.580) (-232.770) (-229.493) -- 0:00:36
      397000 -- (-228.774) (-228.456) (-228.947) [-228.563] * (-229.577) (-229.984) (-238.362) [-233.138] -- 0:00:36
      397500 -- (-228.585) (-232.299) [-230.196] (-230.848) * (-229.547) (-231.303) (-231.626) [-231.745] -- 0:00:36
      398000 -- (-228.868) (-228.929) [-229.889] (-229.187) * (-228.220) [-229.006] (-231.193) (-228.882) -- 0:00:36
      398500 -- (-230.631) (-229.220) (-228.698) [-232.171] * (-228.848) (-229.148) [-230.129] (-228.924) -- 0:00:36
      399000 -- (-231.249) (-229.084) [-233.163] (-229.504) * [-228.354] (-228.507) (-233.114) (-236.689) -- 0:00:36
      399500 -- [-228.614] (-230.325) (-230.910) (-232.993) * [-228.232] (-228.296) (-231.800) (-233.661) -- 0:00:36
      400000 -- (-228.690) (-230.081) [-230.572] (-227.986) * (-229.876) (-227.954) (-231.399) [-230.266] -- 0:00:37

      Average standard deviation of split frequencies: 0.007059

      400500 -- (-227.899) (-233.334) [-228.451] (-230.492) * (-230.367) [-229.622] (-230.233) (-229.361) -- 0:00:37
      401000 -- [-229.891] (-228.875) (-229.031) (-230.344) * (-233.050) (-230.723) [-232.120] (-230.357) -- 0:00:37
      401500 -- (-231.983) (-234.337) (-231.426) [-229.488] * (-228.978) (-230.400) (-228.789) [-229.602] -- 0:00:37
      402000 -- (-230.244) (-229.187) (-229.583) [-229.396] * (-229.206) (-230.013) [-229.689] (-228.317) -- 0:00:37
      402500 -- [-230.003] (-231.850) (-228.512) (-228.536) * (-228.968) (-231.387) [-229.856] (-230.851) -- 0:00:37
      403000 -- (-231.692) (-228.900) (-228.615) [-230.121] * (-231.661) (-231.186) (-229.289) [-232.558] -- 0:00:37
      403500 -- [-233.320] (-231.689) (-231.741) (-231.067) * (-235.010) (-230.277) (-228.845) [-234.247] -- 0:00:36
      404000 -- (-233.891) [-228.715] (-231.316) (-232.707) * (-230.541) (-231.655) (-228.547) [-232.206] -- 0:00:36
      404500 -- (-230.220) [-230.439] (-230.466) (-229.774) * (-230.485) (-233.473) (-230.928) [-229.749] -- 0:00:36
      405000 -- (-233.070) (-228.970) [-229.060] (-228.931) * (-230.636) (-231.547) (-237.064) [-230.362] -- 0:00:36

      Average standard deviation of split frequencies: 0.007039

      405500 -- [-229.613] (-230.803) (-229.696) (-228.034) * (-231.820) [-231.362] (-231.949) (-232.766) -- 0:00:36
      406000 -- (-229.690) (-230.010) [-228.310] (-231.124) * (-233.206) (-228.872) [-228.519] (-228.845) -- 0:00:36
      406500 -- (-230.791) (-231.890) (-231.956) [-229.603] * [-229.370] (-229.240) (-229.177) (-229.446) -- 0:00:36
      407000 -- (-231.714) (-230.986) [-229.703] (-228.485) * (-230.509) (-230.656) [-230.704] (-228.971) -- 0:00:36
      407500 -- (-232.154) [-229.992] (-229.111) (-234.531) * [-228.601] (-230.377) (-229.609) (-229.781) -- 0:00:36
      408000 -- (-231.325) (-230.236) [-228.936] (-228.652) * (-228.272) (-232.238) (-230.929) [-232.482] -- 0:00:36
      408500 -- (-229.040) (-229.702) (-230.920) [-230.300] * (-230.780) (-230.365) (-230.132) [-230.961] -- 0:00:36
      409000 -- [-229.134] (-237.566) (-229.743) (-229.511) * (-232.272) [-227.930] (-234.080) (-228.998) -- 0:00:36
      409500 -- (-228.465) (-229.220) [-229.093] (-230.937) * (-232.777) [-229.574] (-232.106) (-228.973) -- 0:00:36
      410000 -- (-228.350) (-232.678) (-229.743) [-230.651] * [-231.628] (-229.186) (-229.252) (-230.416) -- 0:00:35

      Average standard deviation of split frequencies: 0.007174

      410500 -- (-231.551) (-232.510) [-229.861] (-233.681) * (-233.729) (-232.225) (-229.301) [-230.277] -- 0:00:35
      411000 -- (-230.181) (-235.844) (-228.290) [-229.678] * (-231.109) (-230.375) [-229.850] (-232.477) -- 0:00:35
      411500 -- (-234.644) (-229.071) (-230.163) [-232.230] * (-229.701) [-228.580] (-229.059) (-228.965) -- 0:00:35
      412000 -- (-230.221) (-230.388) (-229.550) [-233.506] * (-228.569) [-230.045] (-230.141) (-230.823) -- 0:00:35
      412500 -- (-230.249) (-233.776) (-230.040) [-229.808] * (-231.290) (-229.925) (-229.154) [-228.877] -- 0:00:35
      413000 -- [-230.957] (-232.495) (-230.831) (-228.579) * (-230.940) (-230.358) (-228.787) [-230.756] -- 0:00:35
      413500 -- (-228.418) (-230.852) [-228.893] (-231.145) * [-228.544] (-232.999) (-229.169) (-230.547) -- 0:00:35
      414000 -- (-229.041) (-233.215) (-229.123) [-231.143] * (-229.105) (-231.735) [-229.977] (-229.057) -- 0:00:35
      414500 -- (-229.101) (-232.366) [-228.992] (-230.374) * [-229.539] (-230.493) (-228.357) (-231.108) -- 0:00:35
      415000 -- (-229.424) (-230.494) (-228.129) [-229.640] * (-230.926) (-233.094) [-228.186] (-229.647) -- 0:00:35

      Average standard deviation of split frequencies: 0.007224

      415500 -- [-228.499] (-230.027) (-232.057) (-229.537) * (-231.210) (-228.983) [-228.717] (-231.381) -- 0:00:36
      416000 -- (-231.363) (-230.415) (-240.449) [-231.693] * (-229.504) (-230.022) (-230.188) [-233.038] -- 0:00:36
      416500 -- (-234.207) [-231.406] (-230.732) (-231.083) * [-231.056] (-229.814) (-230.550) (-236.930) -- 0:00:36
      417000 -- (-229.362) (-231.620) [-231.081] (-230.576) * (-228.653) [-229.864] (-230.948) (-231.803) -- 0:00:36
      417500 -- [-228.022] (-228.994) (-229.400) (-232.161) * (-229.760) [-229.153] (-228.297) (-232.212) -- 0:00:36
      418000 -- (-231.016) [-231.896] (-229.908) (-231.465) * (-228.553) [-232.559] (-228.527) (-230.711) -- 0:00:36
      418500 -- [-231.571] (-229.519) (-230.219) (-229.887) * [-228.244] (-231.296) (-233.509) (-229.950) -- 0:00:36
      419000 -- (-228.246) [-228.460] (-228.657) (-228.993) * (-231.369) (-232.918) [-228.966] (-231.588) -- 0:00:36
      419500 -- [-231.256] (-228.413) (-232.100) (-228.032) * (-231.735) [-231.572] (-229.201) (-231.855) -- 0:00:35
      420000 -- (-229.020) (-230.442) [-230.731] (-230.932) * [-231.292] (-230.588) (-228.757) (-230.693) -- 0:00:35

      Average standard deviation of split frequencies: 0.007914

      420500 -- [-230.332] (-228.594) (-230.053) (-232.662) * (-229.299) (-228.459) [-229.928] (-229.612) -- 0:00:35
      421000 -- (-232.459) (-228.474) (-233.344) [-228.059] * (-230.903) (-233.423) (-228.155) [-229.343] -- 0:00:35
      421500 -- [-235.008] (-228.883) (-232.360) (-229.127) * [-231.207] (-229.853) (-228.796) (-229.192) -- 0:00:35
      422000 -- (-236.377) [-232.030] (-233.785) (-230.437) * (-229.918) [-233.561] (-228.902) (-229.727) -- 0:00:35
      422500 -- (-228.936) (-231.297) (-230.893) [-230.939] * (-231.238) (-228.023) (-231.022) [-228.992] -- 0:00:35
      423000 -- (-230.020) [-233.117] (-229.648) (-230.328) * (-232.114) [-227.880] (-230.154) (-235.679) -- 0:00:35
      423500 -- (-229.121) (-232.171) [-227.894] (-228.609) * [-228.094] (-228.307) (-229.370) (-230.019) -- 0:00:35
      424000 -- [-230.952] (-234.141) (-232.955) (-229.886) * (-228.190) (-228.792) [-228.829] (-229.965) -- 0:00:35
      424500 -- [-230.832] (-229.465) (-230.713) (-229.554) * (-229.941) (-229.554) [-228.723] (-231.944) -- 0:00:35
      425000 -- (-228.711) (-230.871) (-231.568) [-229.321] * [-229.647] (-230.628) (-231.127) (-232.932) -- 0:00:35

      Average standard deviation of split frequencies: 0.008161

      425500 -- [-229.455] (-233.004) (-230.814) (-232.264) * (-228.373) (-228.944) (-230.668) [-231.235] -- 0:00:35
      426000 -- (-230.852) (-231.388) [-230.712] (-229.480) * (-228.713) (-235.857) (-229.961) [-229.142] -- 0:00:35
      426500 -- (-230.997) [-230.103] (-230.422) (-233.140) * [-230.990] (-229.205) (-229.342) (-231.036) -- 0:00:34
      427000 -- [-230.064] (-230.418) (-228.573) (-232.193) * (-229.336) (-230.681) (-231.748) [-230.283] -- 0:00:34
      427500 -- (-232.600) (-231.434) [-229.974] (-230.498) * (-228.736) (-228.593) (-230.251) [-228.466] -- 0:00:34
      428000 -- (-229.639) (-231.559) [-230.902] (-231.707) * [-232.314] (-228.944) (-228.668) (-228.773) -- 0:00:34
      428500 -- [-228.855] (-228.829) (-229.629) (-230.186) * (-230.846) (-234.357) [-229.652] (-229.411) -- 0:00:34
      429000 -- (-228.687) (-230.168) [-229.938] (-229.339) * (-229.681) (-233.215) [-229.230] (-231.200) -- 0:00:34
      429500 -- [-229.909] (-229.081) (-233.006) (-229.687) * (-229.163) [-230.711] (-229.777) (-234.192) -- 0:00:34
      430000 -- (-229.629) (-231.765) (-231.102) [-228.242] * (-229.323) (-229.278) [-229.135] (-229.571) -- 0:00:34

      Average standard deviation of split frequencies: 0.007867

      430500 -- (-234.128) (-232.045) (-233.465) [-228.831] * (-228.732) (-229.241) [-228.648] (-230.099) -- 0:00:34
      431000 -- (-230.930) [-230.257] (-230.936) (-232.556) * (-229.719) (-228.556) [-230.185] (-229.398) -- 0:00:34
      431500 -- [-229.374] (-230.277) (-229.699) (-230.380) * (-228.829) [-229.309] (-228.401) (-229.868) -- 0:00:34
      432000 -- (-229.124) (-230.578) (-229.286) [-228.693] * (-230.060) (-229.461) (-231.031) [-229.303] -- 0:00:35
      432500 -- (-231.921) (-230.267) [-230.193] (-228.579) * [-229.102] (-229.836) (-229.065) (-232.676) -- 0:00:35
      433000 -- (-229.651) [-229.964] (-228.745) (-229.449) * (-230.561) (-230.218) [-229.612] (-231.360) -- 0:00:35
      433500 -- (-231.012) [-232.479] (-230.974) (-232.424) * (-230.946) (-227.895) [-231.966] (-235.460) -- 0:00:35
      434000 -- (-230.234) (-231.839) (-228.294) [-229.363] * (-240.108) (-229.294) [-234.585] (-232.541) -- 0:00:35
      434500 -- [-229.233] (-228.387) (-229.608) (-231.216) * [-229.647] (-228.777) (-228.712) (-230.938) -- 0:00:35
      435000 -- (-229.029) (-228.545) [-231.112] (-230.176) * (-228.934) (-231.863) (-228.423) [-230.710] -- 0:00:35

      Average standard deviation of split frequencies: 0.007636

      435500 -- (-229.464) [-229.001] (-230.752) (-229.815) * (-231.060) (-232.726) [-230.307] (-229.807) -- 0:00:34
      436000 -- (-228.975) [-233.363] (-231.583) (-229.474) * (-230.545) (-229.818) (-228.569) [-231.359] -- 0:00:34
      436500 -- (-229.484) (-232.369) (-230.019) [-234.633] * (-231.768) (-230.047) (-228.955) [-228.927] -- 0:00:34
      437000 -- (-230.035) (-230.805) [-230.188] (-229.319) * (-231.151) (-232.674) (-228.372) [-231.055] -- 0:00:34
      437500 -- (-228.660) (-230.286) (-228.020) [-230.093] * (-230.316) (-232.036) [-228.488] (-231.847) -- 0:00:34
      438000 -- (-230.292) (-229.874) [-231.247] (-229.344) * (-230.245) (-231.940) [-229.089] (-229.795) -- 0:00:34
      438500 -- (-229.015) (-230.152) (-229.435) [-228.491] * (-228.270) (-229.470) [-231.080] (-231.653) -- 0:00:34
      439000 -- (-231.647) (-232.185) [-232.601] (-230.362) * (-229.983) (-232.841) [-229.846] (-230.128) -- 0:00:34
      439500 -- (-231.566) [-228.945] (-229.528) (-231.741) * [-230.953] (-231.491) (-229.532) (-233.796) -- 0:00:34
      440000 -- (-232.087) (-230.506) (-231.354) [-229.856] * (-231.698) (-232.607) [-229.383] (-228.962) -- 0:00:34

      Average standard deviation of split frequencies: 0.007488

      440500 -- (-236.039) [-230.981] (-233.204) (-230.078) * (-229.701) [-230.504] (-230.121) (-228.546) -- 0:00:34
      441000 -- (-231.975) [-229.066] (-231.265) (-228.399) * (-232.798) (-238.030) [-230.368] (-230.122) -- 0:00:34
      441500 -- (-230.279) [-229.584] (-228.450) (-229.077) * (-228.555) (-231.865) [-228.690] (-231.737) -- 0:00:34
      442000 -- (-228.696) (-231.556) (-232.335) [-230.799] * [-229.053] (-231.765) (-229.732) (-228.407) -- 0:00:34
      442500 -- (-228.155) (-230.128) (-230.992) [-230.264] * (-229.947) (-229.450) (-231.256) [-228.515] -- 0:00:34
      443000 -- (-227.889) (-231.941) (-229.989) [-228.458] * [-228.596] (-228.336) (-230.174) (-231.416) -- 0:00:33
      443500 -- (-229.031) (-232.890) (-229.600) [-229.051] * (-228.978) (-228.885) (-231.941) [-232.375] -- 0:00:33
      444000 -- [-230.501] (-229.790) (-229.873) (-229.395) * (-232.613) (-228.890) [-230.132] (-232.610) -- 0:00:33
      444500 -- [-230.181] (-228.688) (-228.914) (-228.961) * (-231.774) (-230.332) [-229.966] (-228.980) -- 0:00:33
      445000 -- [-229.767] (-230.540) (-232.424) (-228.337) * (-229.936) (-229.392) [-230.865] (-229.659) -- 0:00:33

      Average standard deviation of split frequencies: 0.007647

      445500 -- [-231.391] (-230.090) (-228.742) (-228.201) * (-232.866) (-228.921) [-229.408] (-228.809) -- 0:00:33
      446000 -- (-232.690) (-233.970) [-228.650] (-229.909) * [-230.428] (-228.444) (-231.479) (-232.580) -- 0:00:33
      446500 -- (-229.298) [-231.711] (-236.175) (-229.116) * [-229.548] (-230.212) (-232.073) (-229.453) -- 0:00:33
      447000 -- [-231.318] (-229.416) (-236.263) (-230.580) * (-232.958) (-231.123) [-228.535] (-228.223) -- 0:00:33
      447500 -- [-232.473] (-231.397) (-230.198) (-229.358) * (-228.110) (-231.823) (-229.560) [-229.857] -- 0:00:33
      448000 -- [-230.444] (-232.904) (-229.570) (-229.447) * [-228.899] (-230.274) (-230.436) (-229.865) -- 0:00:33
      448500 -- (-232.441) (-231.423) (-230.905) [-229.232] * (-232.256) (-229.837) [-229.345] (-229.823) -- 0:00:33
      449000 -- (-228.471) (-231.357) (-228.159) [-234.172] * (-232.652) (-230.272) [-228.811] (-228.418) -- 0:00:34
      449500 -- [-228.716] (-230.651) (-234.235) (-229.024) * (-232.057) (-229.188) (-232.062) [-230.088] -- 0:00:34
      450000 -- (-228.057) (-231.087) [-230.728] (-228.441) * (-229.269) (-228.931) (-229.880) [-229.946] -- 0:00:34

      Average standard deviation of split frequencies: 0.007876

      450500 -- (-232.372) (-229.628) (-231.355) [-233.199] * (-230.176) (-233.613) (-229.073) [-232.232] -- 0:00:34
      451000 -- (-229.638) (-228.520) (-229.500) [-229.436] * (-230.266) (-229.732) (-231.785) [-231.975] -- 0:00:34
      451500 -- [-230.428] (-237.509) (-228.585) (-230.406) * (-228.898) (-228.861) (-235.372) [-229.494] -- 0:00:34
      452000 -- (-232.900) [-234.900] (-229.102) (-235.028) * (-231.660) (-229.427) (-231.629) [-233.039] -- 0:00:33
      452500 -- (-231.257) (-233.064) [-230.467] (-230.862) * (-229.836) [-228.382] (-232.724) (-231.963) -- 0:00:33
      453000 -- (-230.399) [-228.943] (-233.209) (-233.766) * (-232.629) (-230.517) (-229.876) [-228.974] -- 0:00:33
      453500 -- (-231.784) (-229.693) (-236.682) [-229.109] * (-230.816) (-229.719) [-229.828] (-230.507) -- 0:00:33
      454000 -- (-230.897) (-228.819) [-233.839] (-230.567) * (-232.173) (-236.186) [-228.318] (-231.234) -- 0:00:33
      454500 -- (-229.773) [-231.543] (-229.774) (-231.324) * (-234.718) [-232.365] (-231.141) (-228.373) -- 0:00:33
      455000 -- (-229.634) [-228.930] (-229.060) (-230.631) * (-230.439) [-230.331] (-231.486) (-230.994) -- 0:00:33

      Average standard deviation of split frequencies: 0.008270

      455500 -- (-230.368) (-228.907) [-228.335] (-232.483) * (-234.146) [-228.490] (-232.766) (-230.162) -- 0:00:33
      456000 -- (-230.890) (-229.286) [-229.596] (-230.322) * (-229.915) (-228.113) (-228.056) [-233.513] -- 0:00:33
      456500 -- (-228.808) (-233.278) [-230.523] (-231.548) * [-230.881] (-230.036) (-231.215) (-233.346) -- 0:00:33
      457000 -- [-231.597] (-231.593) (-233.229) (-229.749) * (-231.349) [-229.078] (-228.859) (-234.023) -- 0:00:33
      457500 -- (-230.226) [-233.300] (-234.972) (-230.996) * (-231.784) (-228.950) (-230.450) [-230.850] -- 0:00:33
      458000 -- (-228.923) [-230.805] (-229.932) (-231.748) * (-231.745) (-233.299) [-228.473] (-229.383) -- 0:00:33
      458500 -- (-229.723) (-229.214) [-228.875] (-230.488) * [-228.160] (-228.938) (-231.416) (-228.993) -- 0:00:33
      459000 -- (-228.705) (-230.222) (-230.250) [-231.585] * (-229.622) (-232.901) (-230.887) [-230.124] -- 0:00:33
      459500 -- (-230.423) (-230.259) (-232.578) [-234.943] * (-229.207) [-228.122] (-232.610) (-234.353) -- 0:00:32
      460000 -- (-232.662) (-236.249) (-231.819) [-230.668] * (-230.724) (-228.657) [-229.689] (-233.973) -- 0:00:32

      Average standard deviation of split frequencies: 0.008126

      460500 -- (-230.512) (-233.369) [-231.828] (-231.708) * (-230.616) (-230.767) [-228.618] (-229.355) -- 0:00:32
      461000 -- (-231.752) [-228.256] (-229.885) (-229.712) * (-231.598) (-229.547) (-230.491) [-229.152] -- 0:00:32
      461500 -- (-228.655) (-233.501) [-230.812] (-231.238) * (-228.861) [-230.060] (-233.168) (-229.773) -- 0:00:32
      462000 -- (-231.232) [-233.483] (-229.156) (-229.598) * (-230.793) (-230.270) (-231.760) [-228.593] -- 0:00:32
      462500 -- (-233.743) [-231.489] (-228.655) (-228.324) * (-228.405) [-229.965] (-229.203) (-228.864) -- 0:00:32
      463000 -- (-230.159) [-228.372] (-232.074) (-228.534) * (-230.818) [-234.574] (-231.069) (-230.673) -- 0:00:32
      463500 -- (-229.052) (-228.929) (-229.832) [-228.485] * [-230.030] (-234.045) (-231.004) (-230.155) -- 0:00:32
      464000 -- (-234.201) (-229.511) (-230.338) [-229.223] * (-231.654) (-234.421) (-230.335) [-229.418] -- 0:00:32
      464500 -- (-231.045) (-229.973) [-231.038] (-229.652) * (-229.143) (-230.519) (-231.194) [-229.886] -- 0:00:32
      465000 -- (-232.145) (-231.069) (-229.301) [-231.419] * (-231.453) (-231.248) [-228.796] (-229.797) -- 0:00:32

      Average standard deviation of split frequencies: 0.007438

      465500 -- (-237.257) [-229.474] (-231.231) (-229.570) * (-234.160) [-230.148] (-230.764) (-228.937) -- 0:00:33
      466000 -- (-230.273) [-229.439] (-231.377) (-229.251) * (-235.694) (-230.772) [-237.508] (-232.404) -- 0:00:33
      466500 -- (-231.167) (-231.487) [-230.158] (-229.733) * (-235.076) (-234.229) [-229.166] (-229.465) -- 0:00:33
      467000 -- (-233.460) [-234.070] (-230.655) (-228.881) * (-228.518) (-228.939) (-231.193) [-230.858] -- 0:00:33
      467500 -- [-230.575] (-236.416) (-229.405) (-230.357) * (-228.767) (-229.169) (-230.515) [-228.958] -- 0:00:33
      468000 -- (-230.874) [-232.484] (-233.618) (-230.683) * (-230.476) (-229.242) (-237.627) [-230.310] -- 0:00:32
      468500 -- (-237.231) (-229.469) (-229.435) [-231.443] * [-232.476] (-232.426) (-229.910) (-229.485) -- 0:00:32
      469000 -- (-232.382) [-231.133] (-229.004) (-232.374) * (-231.878) (-232.865) (-228.177) [-229.706] -- 0:00:32
      469500 -- [-231.107] (-231.799) (-231.791) (-228.759) * [-233.348] (-228.149) (-231.238) (-235.498) -- 0:00:32
      470000 -- (-228.878) (-233.000) (-233.038) [-228.924] * (-232.343) (-230.511) [-229.380] (-230.787) -- 0:00:32

      Average standard deviation of split frequencies: 0.007541

      470500 -- [-228.898] (-231.618) (-232.080) (-232.880) * (-232.673) (-229.039) (-228.488) [-229.804] -- 0:00:32
      471000 -- (-229.661) (-233.842) (-228.240) [-228.811] * (-233.461) (-228.374) [-230.654] (-231.096) -- 0:00:32
      471500 -- (-230.416) (-233.679) [-230.402] (-229.012) * (-228.799) (-228.761) [-228.751] (-229.233) -- 0:00:32
      472000 -- [-229.108] (-233.057) (-231.726) (-229.610) * (-234.031) (-228.123) [-229.599] (-230.742) -- 0:00:32
      472500 -- (-232.227) (-229.620) (-230.168) [-229.417] * (-234.315) (-228.947) (-229.099) [-229.799] -- 0:00:32
      473000 -- (-228.443) (-230.849) (-230.172) [-231.449] * (-232.012) (-232.647) (-230.279) [-229.641] -- 0:00:32
      473500 -- [-229.254] (-230.349) (-232.010) (-230.312) * (-232.094) (-230.134) (-232.629) [-230.010] -- 0:00:32
      474000 -- (-228.047) [-232.243] (-230.144) (-233.345) * [-229.433] (-231.171) (-234.437) (-229.031) -- 0:00:32
      474500 -- (-230.017) (-230.381) [-228.874] (-233.804) * (-229.824) [-228.859] (-231.336) (-230.489) -- 0:00:32
      475000 -- (-228.102) (-228.042) (-229.180) [-228.289] * [-228.625] (-231.241) (-230.835) (-228.405) -- 0:00:32

      Average standard deviation of split frequencies: 0.007165

      475500 -- [-228.672] (-229.194) (-229.325) (-231.271) * [-229.258] (-229.638) (-229.284) (-229.756) -- 0:00:31
      476000 -- (-229.751) [-230.921] (-234.372) (-230.496) * [-228.830] (-237.033) (-228.439) (-228.912) -- 0:00:31
      476500 -- (-230.055) (-232.646) [-233.654] (-233.707) * [-230.787] (-233.559) (-228.928) (-232.120) -- 0:00:31
      477000 -- (-231.495) [-232.386] (-229.896) (-230.900) * (-231.108) [-229.354] (-231.206) (-233.130) -- 0:00:31
      477500 -- (-232.253) (-229.292) [-230.582] (-233.362) * (-232.275) (-229.769) (-232.148) [-230.599] -- 0:00:31
      478000 -- (-230.077) (-232.065) [-228.849] (-231.856) * (-229.516) [-227.723] (-228.003) (-230.440) -- 0:00:31
      478500 -- [-229.098] (-231.744) (-229.343) (-229.816) * (-231.664) [-231.526] (-232.672) (-233.780) -- 0:00:31
      479000 -- (-229.517) [-229.305] (-230.542) (-228.890) * (-233.868) (-230.519) [-232.779] (-230.594) -- 0:00:31
      479500 -- (-228.591) [-229.594] (-230.309) (-229.005) * [-228.798] (-229.244) (-231.204) (-232.718) -- 0:00:31
      480000 -- (-229.937) (-228.905) [-232.652] (-230.481) * (-229.267) [-232.794] (-231.576) (-233.800) -- 0:00:31

      Average standard deviation of split frequencies: 0.007955

      480500 -- (-231.466) (-230.328) [-229.209] (-230.463) * (-231.964) (-228.377) (-233.828) [-230.813] -- 0:00:31
      481000 -- (-230.420) (-233.265) (-228.922) [-232.210] * (-231.226) (-229.188) [-231.540] (-229.584) -- 0:00:31
      481500 -- [-229.687] (-231.495) (-228.141) (-230.424) * (-229.838) (-235.359) (-229.952) [-230.028] -- 0:00:31
      482000 -- (-234.371) (-231.287) [-228.304] (-231.094) * [-229.496] (-230.048) (-229.345) (-230.367) -- 0:00:32
      482500 -- [-235.900] (-230.754) (-228.924) (-229.332) * (-228.645) (-231.923) [-229.037] (-230.841) -- 0:00:32
      483000 -- (-230.638) [-234.596] (-229.416) (-232.102) * (-229.491) (-235.677) [-230.813] (-231.416) -- 0:00:32
      483500 -- (-229.666) [-233.564] (-232.459) (-230.094) * (-233.674) (-230.526) (-231.724) [-231.048] -- 0:00:32
      484000 -- (-232.272) (-233.508) [-229.246] (-228.999) * (-229.998) [-228.350] (-230.106) (-228.850) -- 0:00:31
      484500 -- (-232.857) (-230.030) (-229.776) [-230.426] * (-229.589) (-230.327) [-232.985] (-229.699) -- 0:00:31
      485000 -- (-229.944) [-231.119] (-230.153) (-230.823) * (-231.812) (-229.915) (-229.133) [-229.979] -- 0:00:31

      Average standard deviation of split frequencies: 0.008406

      485500 -- (-233.159) [-234.061] (-230.295) (-228.743) * (-229.881) (-228.922) (-229.372) [-230.196] -- 0:00:31
      486000 -- (-235.278) [-230.797] (-230.308) (-232.337) * [-229.430] (-228.829) (-229.223) (-232.386) -- 0:00:31
      486500 -- [-232.832] (-231.598) (-230.288) (-234.198) * [-229.515] (-228.274) (-227.909) (-233.629) -- 0:00:31
      487000 -- [-228.505] (-231.641) (-231.953) (-236.468) * (-228.861) (-230.516) [-228.772] (-230.808) -- 0:00:31
      487500 -- (-228.318) (-228.726) (-230.912) [-233.991] * [-230.173] (-232.856) (-230.579) (-229.760) -- 0:00:31
      488000 -- (-229.405) (-230.296) (-229.338) [-229.741] * (-229.715) (-230.407) (-230.927) [-229.086] -- 0:00:31
      488500 -- (-230.208) (-228.463) [-232.900] (-230.066) * (-229.703) [-234.351] (-230.868) (-228.296) -- 0:00:31
      489000 -- (-230.042) [-228.752] (-229.358) (-229.881) * (-229.841) (-231.436) (-236.980) [-229.067] -- 0:00:31
      489500 -- (-228.811) (-228.959) [-230.999] (-231.567) * (-229.275) [-232.894] (-231.177) (-231.229) -- 0:00:31
      490000 -- [-228.106] (-229.887) (-229.523) (-233.934) * (-233.727) (-234.788) [-231.527] (-231.050) -- 0:00:31

      Average standard deviation of split frequencies: 0.008006

      490500 -- (-229.540) (-229.070) [-228.645] (-234.233) * (-228.184) (-233.667) [-231.339] (-231.456) -- 0:00:31
      491000 -- (-232.085) (-228.297) [-229.351] (-231.905) * [-229.534] (-234.366) (-230.128) (-233.441) -- 0:00:31
      491500 -- (-228.712) [-230.368] (-230.502) (-228.857) * (-229.001) (-233.897) (-228.231) [-232.345] -- 0:00:31
      492000 -- (-229.789) [-228.057] (-231.517) (-229.158) * (-229.589) [-230.500] (-229.441) (-230.426) -- 0:00:30
      492500 -- (-231.772) (-227.925) (-232.378) [-228.454] * (-228.640) (-230.874) (-232.459) [-231.131] -- 0:00:30
      493000 -- [-228.417] (-229.881) (-229.660) (-229.950) * [-230.510] (-232.032) (-228.181) (-229.802) -- 0:00:30
      493500 -- (-231.795) (-233.556) [-230.052] (-231.440) * (-228.548) (-230.731) [-230.228] (-231.722) -- 0:00:30
      494000 -- (-230.844) (-232.143) [-228.901] (-230.340) * (-229.705) [-230.217] (-231.953) (-231.854) -- 0:00:30
      494500 -- (-228.410) (-231.876) (-228.159) [-229.998] * [-227.961] (-229.983) (-231.449) (-230.737) -- 0:00:30
      495000 -- (-231.515) (-229.244) [-230.034] (-230.680) * (-229.508) [-230.760] (-230.808) (-231.711) -- 0:00:30

      Average standard deviation of split frequencies: 0.007920

      495500 -- (-234.170) (-228.541) [-231.464] (-231.808) * (-228.266) (-231.834) (-232.832) [-230.346] -- 0:00:30
      496000 -- (-230.746) (-230.404) [-230.258] (-233.302) * (-228.763) [-230.660] (-232.205) (-229.051) -- 0:00:30
      496500 -- (-228.155) (-233.439) (-229.770) [-230.427] * [-229.658] (-228.701) (-230.365) (-228.344) -- 0:00:30
      497000 -- (-229.590) [-230.481] (-229.253) (-228.934) * (-229.857) [-229.616] (-228.859) (-229.363) -- 0:00:30
      497500 -- (-231.464) (-231.697) (-230.624) [-228.943] * (-235.852) (-232.788) (-228.891) [-228.642] -- 0:00:31
      498000 -- (-230.803) [-230.565] (-231.388) (-231.305) * (-231.093) (-233.197) (-231.377) [-228.813] -- 0:00:31
      498500 -- (-229.772) (-231.719) [-233.715] (-230.291) * (-230.489) [-229.298] (-228.972) (-228.725) -- 0:00:31
      499000 -- (-233.352) (-230.575) [-233.080] (-229.855) * [-231.799] (-233.092) (-232.929) (-230.226) -- 0:00:31
      499500 -- (-230.426) (-229.157) (-232.479) [-229.101] * (-231.732) (-230.361) (-233.347) [-229.847] -- 0:00:31
      500000 -- (-228.443) (-228.689) [-229.651] (-228.997) * (-232.612) (-231.531) [-229.425] (-229.540) -- 0:00:31

      Average standard deviation of split frequencies: 0.008003

      500500 -- (-230.425) (-231.516) [-229.238] (-230.921) * (-231.207) [-233.651] (-230.371) (-229.361) -- 0:00:30
      501000 -- (-229.694) [-228.344] (-233.237) (-231.365) * (-230.934) (-231.443) (-229.812) [-231.362] -- 0:00:30
      501500 -- [-229.533] (-231.464) (-232.272) (-231.043) * (-229.955) (-233.159) (-232.460) [-228.368] -- 0:00:30
      502000 -- (-230.225) (-233.852) (-233.544) [-231.374] * (-229.949) (-229.017) [-228.916] (-228.998) -- 0:00:30
      502500 -- (-229.015) (-232.234) [-230.390] (-231.595) * (-233.783) (-234.619) [-230.342] (-233.256) -- 0:00:30
      503000 -- (-230.696) (-229.782) [-230.371] (-229.586) * (-229.575) (-228.212) [-229.898] (-239.738) -- 0:00:30
      503500 -- [-229.741] (-231.364) (-230.806) (-232.390) * [-230.420] (-229.469) (-230.796) (-229.103) -- 0:00:30
      504000 -- (-230.359) (-229.630) (-233.403) [-229.417] * (-233.762) [-230.551] (-230.291) (-228.015) -- 0:00:30
      504500 -- (-231.517) (-228.903) [-228.949] (-233.230) * [-228.838] (-230.834) (-232.549) (-228.841) -- 0:00:30
      505000 -- [-229.943] (-229.231) (-228.353) (-230.014) * (-232.316) [-229.408] (-228.437) (-232.217) -- 0:00:30

      Average standard deviation of split frequencies: 0.007971

      505500 -- [-231.085] (-232.370) (-230.620) (-230.376) * (-232.409) [-228.470] (-235.186) (-228.183) -- 0:00:30
      506000 -- (-229.985) (-233.637) (-238.890) [-234.567] * (-231.638) (-229.328) (-235.013) [-229.025] -- 0:00:30
      506500 -- (-229.889) (-230.306) (-239.653) [-231.789] * (-230.587) [-230.047] (-231.737) (-229.594) -- 0:00:30
      507000 -- [-228.943] (-229.463) (-230.334) (-230.086) * (-230.122) [-228.510] (-230.413) (-231.816) -- 0:00:30
      507500 -- (-231.145) [-229.003] (-229.248) (-229.236) * (-229.806) (-228.504) (-231.002) [-231.828] -- 0:00:30
      508000 -- (-231.444) (-228.157) (-231.498) [-229.836] * (-229.715) (-233.500) [-230.817] (-230.924) -- 0:00:30
      508500 -- (-231.105) (-228.723) (-228.984) [-228.623] * [-230.502] (-228.869) (-230.459) (-230.254) -- 0:00:29
      509000 -- (-230.999) [-229.963] (-232.776) (-228.435) * (-231.595) [-229.121] (-232.730) (-230.327) -- 0:00:29
      509500 -- (-229.503) (-236.579) [-229.120] (-229.127) * (-229.471) [-231.810] (-232.252) (-230.664) -- 0:00:29
      510000 -- (-230.539) (-229.412) [-229.128] (-233.508) * (-233.495) (-229.282) (-231.968) [-230.019] -- 0:00:29

      Average standard deviation of split frequencies: 0.008154

      510500 -- [-231.838] (-233.130) (-229.166) (-231.690) * (-229.221) [-229.032] (-228.956) (-228.867) -- 0:00:29
      511000 -- [-231.937] (-231.059) (-230.599) (-228.672) * (-228.196) (-228.352) (-231.383) [-228.779] -- 0:00:29
      511500 -- (-230.963) (-229.345) (-231.781) [-230.411] * (-230.316) (-229.373) [-229.970] (-229.163) -- 0:00:29
      512000 -- (-229.174) (-228.460) (-229.313) [-231.226] * (-230.665) (-233.680) (-231.342) [-230.088] -- 0:00:29
      512500 -- (-229.445) (-230.560) (-229.007) [-233.001] * [-228.774] (-235.452) (-233.454) (-229.305) -- 0:00:30
      513000 -- (-234.363) [-232.170] (-228.363) (-230.853) * [-231.056] (-232.426) (-229.526) (-229.325) -- 0:00:30
      513500 -- (-230.718) (-235.343) [-228.880] (-229.987) * (-230.450) (-230.292) [-230.835] (-229.637) -- 0:00:30
      514000 -- [-232.124] (-232.427) (-228.903) (-230.348) * (-232.360) [-229.317] (-232.773) (-230.630) -- 0:00:30
      514500 -- (-230.884) (-230.261) [-228.622] (-229.585) * (-228.306) (-232.416) (-229.853) [-233.267] -- 0:00:30
      515000 -- (-230.700) (-231.342) [-231.871] (-228.799) * (-228.524) (-230.383) (-229.660) [-230.123] -- 0:00:30

      Average standard deviation of split frequencies: 0.008070

      515500 -- (-231.380) (-231.057) (-230.230) [-229.172] * (-228.512) (-232.014) (-231.610) [-228.602] -- 0:00:30
      516000 -- (-233.444) (-229.664) [-228.310] (-230.020) * (-231.367) (-229.334) [-232.280] (-231.174) -- 0:00:30
      516500 -- (-232.283) (-228.430) (-229.797) [-230.800] * (-234.901) (-230.054) (-229.720) [-228.275] -- 0:00:29
      517000 -- (-231.712) (-230.541) (-235.708) [-231.005] * (-233.010) [-229.201] (-229.936) (-236.257) -- 0:00:29
      517500 -- (-231.002) (-229.385) (-229.924) [-230.228] * [-230.690] (-229.929) (-231.670) (-231.968) -- 0:00:29
      518000 -- [-231.764] (-232.265) (-233.996) (-230.974) * (-231.426) [-230.275] (-232.511) (-228.925) -- 0:00:29
      518500 -- (-229.266) (-232.910) [-230.316] (-234.680) * (-232.379) [-229.371] (-232.716) (-228.940) -- 0:00:29
      519000 -- (-228.960) (-230.312) [-229.641] (-229.813) * (-233.784) [-228.551] (-238.032) (-228.147) -- 0:00:29
      519500 -- (-229.697) [-230.619] (-232.283) (-231.294) * [-230.653] (-229.214) (-239.556) (-229.244) -- 0:00:29
      520000 -- (-228.749) [-233.513] (-230.069) (-231.092) * (-231.948) (-229.608) [-230.514] (-229.379) -- 0:00:29

      Average standard deviation of split frequencies: 0.008299

      520500 -- (-228.770) [-229.673] (-230.774) (-228.544) * (-231.766) [-231.147] (-228.947) (-229.311) -- 0:00:29
      521000 -- [-232.078] (-229.571) (-230.391) (-230.603) * (-229.661) (-230.976) [-229.315] (-228.676) -- 0:00:29
      521500 -- [-230.241] (-231.471) (-234.138) (-230.601) * [-229.455] (-231.376) (-230.115) (-231.067) -- 0:00:29
      522000 -- (-235.691) (-230.980) (-228.765) [-228.999] * (-230.386) (-231.334) [-228.809] (-230.691) -- 0:00:29
      522500 -- (-229.740) [-232.725] (-228.240) (-228.866) * (-228.579) [-230.897] (-229.967) (-230.681) -- 0:00:29
      523000 -- [-229.846] (-234.748) (-230.573) (-229.056) * (-231.320) [-232.590] (-234.697) (-232.026) -- 0:00:29
      523500 -- (-232.603) (-235.133) [-231.985] (-230.495) * (-229.993) (-228.780) [-229.685] (-229.292) -- 0:00:29
      524000 -- [-231.477] (-234.828) (-230.841) (-230.377) * (-231.101) [-230.684] (-230.378) (-228.534) -- 0:00:29
      524500 -- [-230.954] (-230.592) (-231.840) (-231.040) * [-230.808] (-230.276) (-229.476) (-229.717) -- 0:00:29
      525000 -- [-229.813] (-230.150) (-233.255) (-231.367) * (-228.983) (-228.612) [-229.209] (-231.208) -- 0:00:28

      Average standard deviation of split frequencies: 0.007966

      525500 -- (-228.651) [-230.822] (-232.148) (-232.189) * [-230.836] (-231.248) (-228.581) (-230.277) -- 0:00:28
      526000 -- (-230.080) [-230.238] (-233.793) (-230.089) * (-229.912) (-228.704) [-230.627] (-228.768) -- 0:00:28
      526500 -- (-232.715) (-229.329) [-231.467] (-231.452) * (-229.549) (-229.488) [-229.417] (-234.291) -- 0:00:29
      527000 -- (-228.975) (-230.083) (-229.674) [-229.163] * [-228.209] (-233.039) (-230.340) (-231.359) -- 0:00:29
      527500 -- (-230.802) (-229.558) (-230.686) [-231.703] * (-228.513) (-231.410) [-229.314] (-229.124) -- 0:00:29
      528000 -- (-228.739) (-231.734) (-232.802) [-229.103] * [-229.424] (-231.801) (-231.700) (-231.735) -- 0:00:29
      528500 -- (-228.859) (-233.433) (-233.762) [-229.834] * (-230.443) (-232.862) [-229.994] (-229.616) -- 0:00:29
      529000 -- [-228.687] (-231.784) (-233.604) (-235.391) * (-228.834) (-232.549) (-228.910) [-228.424] -- 0:00:29
      529500 -- [-227.958] (-232.368) (-231.093) (-236.129) * (-229.822) (-230.453) (-227.999) [-228.561] -- 0:00:29
      530000 -- [-228.039] (-231.192) (-230.550) (-228.675) * (-233.974) (-231.516) [-229.756] (-230.804) -- 0:00:29

      Average standard deviation of split frequencies: 0.007995

      530500 -- (-230.981) [-229.788] (-231.579) (-229.046) * (-234.002) [-232.096] (-233.804) (-228.965) -- 0:00:29
      531000 -- [-230.425] (-233.170) (-233.393) (-229.336) * (-233.686) (-228.543) [-229.918] (-234.040) -- 0:00:29
      531500 -- [-231.194] (-228.711) (-230.063) (-228.710) * (-230.511) (-229.522) [-235.009] (-233.443) -- 0:00:29
      532000 -- (-228.153) [-229.030] (-232.781) (-231.170) * (-229.891) (-229.013) [-229.760] (-229.321) -- 0:00:29
      532500 -- (-230.576) (-228.314) [-230.377] (-231.588) * (-232.323) (-229.138) [-230.509] (-235.865) -- 0:00:28
      533000 -- (-229.280) [-229.350] (-229.939) (-229.004) * (-229.550) [-231.288] (-231.552) (-238.112) -- 0:00:28
      533500 -- (-227.986) (-229.306) (-228.518) [-228.028] * [-229.513] (-228.035) (-229.979) (-232.520) -- 0:00:28
      534000 -- [-229.377] (-232.127) (-228.800) (-229.252) * [-229.894] (-229.234) (-230.070) (-228.742) -- 0:00:28
      534500 -- (-230.316) (-230.096) (-229.784) [-232.220] * [-229.514] (-231.950) (-231.616) (-228.537) -- 0:00:28
      535000 -- (-232.089) [-228.228] (-231.117) (-234.118) * [-229.509] (-229.314) (-230.378) (-228.557) -- 0:00:28

      Average standard deviation of split frequencies: 0.008062

      535500 -- (-231.134) (-228.104) [-228.186] (-232.180) * [-232.113] (-230.328) (-231.085) (-229.281) -- 0:00:28
      536000 -- (-230.299) (-232.443) (-228.944) [-231.740] * (-228.523) [-229.665] (-228.458) (-231.696) -- 0:00:28
      536500 -- [-232.870] (-229.177) (-228.754) (-232.604) * (-228.937) [-229.168] (-228.418) (-227.945) -- 0:00:28
      537000 -- (-229.762) (-229.986) [-232.355] (-230.460) * (-233.314) (-229.096) (-233.576) [-230.601] -- 0:00:28
      537500 -- [-229.759] (-231.127) (-229.514) (-239.600) * (-229.687) (-230.289) (-235.484) [-228.412] -- 0:00:28
      538000 -- [-231.082] (-228.346) (-229.796) (-235.891) * [-231.014] (-230.966) (-233.184) (-228.417) -- 0:00:28
      538500 -- (-231.508) (-229.197) (-229.442) [-229.703] * [-228.062] (-230.859) (-236.121) (-228.822) -- 0:00:28
      539000 -- (-231.085) (-234.458) [-231.855] (-228.590) * (-235.549) [-229.659] (-229.053) (-229.897) -- 0:00:28
      539500 -- (-229.114) [-232.578] (-231.630) (-229.463) * (-228.836) (-231.431) (-229.889) [-229.477] -- 0:00:28
      540000 -- (-233.795) (-229.555) (-231.709) [-229.731] * (-233.623) (-232.403) (-228.372) [-233.785] -- 0:00:28

      Average standard deviation of split frequencies: 0.006719

      540500 -- (-229.884) (-234.170) (-233.854) [-229.890] * (-231.086) (-228.401) (-230.366) [-232.028] -- 0:00:28
      541000 -- (-230.351) (-230.893) [-230.342] (-228.328) * [-232.883] (-234.455) (-230.841) (-231.376) -- 0:00:27
      541500 -- (-233.670) [-233.133] (-229.044) (-230.835) * (-230.218) [-230.588] (-233.405) (-231.700) -- 0:00:27
      542000 -- (-232.818) (-229.370) (-230.622) [-227.848] * (-229.041) (-231.702) (-228.513) [-230.371] -- 0:00:27
      542500 -- (-232.236) (-232.187) [-229.043] (-231.580) * (-228.901) (-231.155) [-228.937] (-229.304) -- 0:00:27
      543000 -- (-236.090) (-230.032) [-229.414] (-230.852) * [-232.429] (-230.138) (-230.168) (-228.175) -- 0:00:28
      543500 -- (-230.354) [-230.220] (-229.606) (-233.535) * (-233.668) (-229.710) [-232.748] (-228.308) -- 0:00:28
      544000 -- (-230.340) (-228.972) [-231.302] (-229.966) * (-236.296) (-228.947) [-232.205] (-232.463) -- 0:00:28
      544500 -- [-230.999] (-228.350) (-229.307) (-229.254) * (-229.271) (-228.938) [-230.651] (-231.543) -- 0:00:28
      545000 -- (-229.080) (-233.771) [-228.466] (-229.567) * (-234.637) (-229.843) (-232.032) [-229.354] -- 0:00:28

      Average standard deviation of split frequencies: 0.006247

      545500 -- (-230.354) (-231.191) [-231.271] (-229.349) * [-233.868] (-229.398) (-231.509) (-229.542) -- 0:00:28
      546000 -- [-232.195] (-230.643) (-232.404) (-229.958) * (-234.104) (-231.561) [-229.345] (-232.733) -- 0:00:28
      546500 -- (-230.776) (-231.296) [-228.523] (-228.428) * (-229.913) (-229.245) (-231.641) [-230.133] -- 0:00:28
      547000 -- (-232.963) (-230.490) (-230.226) [-229.440] * [-230.514] (-228.379) (-230.788) (-230.070) -- 0:00:28
      547500 -- [-230.374] (-230.923) (-230.415) (-232.107) * (-229.012) (-229.798) [-229.030] (-233.562) -- 0:00:28
      548000 -- (-229.981) (-229.755) (-229.642) [-230.453] * (-229.647) (-229.452) [-230.705] (-231.728) -- 0:00:28
      548500 -- (-230.028) [-228.618] (-231.488) (-230.078) * (-230.869) (-228.272) [-230.934] (-229.779) -- 0:00:27
      549000 -- (-229.055) (-228.482) [-228.118] (-229.540) * [-228.819] (-230.743) (-230.638) (-233.527) -- 0:00:27
      549500 -- (-234.507) (-230.740) (-229.807) [-232.030] * (-229.353) [-230.031] (-228.052) (-229.746) -- 0:00:27
      550000 -- (-230.034) (-234.895) [-230.073] (-234.702) * [-228.977] (-229.990) (-228.911) (-229.284) -- 0:00:27

      Average standard deviation of split frequencies: 0.006563

      550500 -- (-229.246) (-229.905) [-228.211] (-236.201) * (-228.042) (-229.137) [-228.531] (-229.989) -- 0:00:27
      551000 -- (-231.698) (-232.764) [-228.878] (-230.402) * [-228.893] (-228.777) (-231.653) (-230.239) -- 0:00:27
      551500 -- [-228.771] (-231.883) (-229.077) (-230.434) * (-230.529) (-228.041) (-232.389) [-228.614] -- 0:00:27
      552000 -- (-229.906) [-230.484] (-231.640) (-229.421) * (-230.423) (-230.338) (-235.202) [-229.580] -- 0:00:27
      552500 -- (-229.976) [-228.720] (-229.828) (-229.187) * [-231.864] (-230.726) (-228.699) (-232.840) -- 0:00:27
      553000 -- (-233.046) (-228.946) [-231.837] (-228.251) * (-231.033) (-230.812) (-230.421) [-232.355] -- 0:00:27
      553500 -- [-230.481] (-228.376) (-231.197) (-228.729) * [-228.856] (-229.247) (-229.670) (-232.144) -- 0:00:27
      554000 -- (-231.743) [-229.771] (-228.959) (-230.828) * (-229.595) (-231.473) [-228.234] (-230.013) -- 0:00:27
      554500 -- (-236.626) [-229.153] (-229.877) (-230.764) * (-231.551) (-228.776) [-228.493] (-228.963) -- 0:00:27
      555000 -- [-232.860] (-230.487) (-230.630) (-229.239) * [-229.350] (-228.716) (-231.870) (-232.892) -- 0:00:27

      Average standard deviation of split frequencies: 0.005985

      555500 -- (-230.870) (-230.234) [-232.423] (-230.062) * (-234.634) [-229.874] (-232.945) (-230.347) -- 0:00:27
      556000 -- (-229.044) [-229.293] (-229.128) (-230.163) * (-228.876) [-229.311] (-229.770) (-229.482) -- 0:00:27
      556500 -- (-229.437) (-228.938) [-231.262] (-228.489) * [-231.553] (-231.147) (-228.672) (-232.566) -- 0:00:27
      557000 -- [-231.198] (-232.123) (-228.213) (-231.336) * (-230.534) [-234.235] (-229.765) (-228.506) -- 0:00:27
      557500 -- (-231.152) (-228.453) [-229.073] (-230.253) * (-230.107) (-233.711) (-231.352) [-229.985] -- 0:00:26
      558000 -- [-229.813] (-227.852) (-230.862) (-228.268) * [-229.653] (-234.576) (-233.255) (-230.905) -- 0:00:26
      558500 -- (-229.760) (-230.099) [-232.007] (-229.255) * (-231.345) (-230.444) (-231.995) [-230.279] -- 0:00:26
      559000 -- (-228.410) [-230.152] (-230.722) (-233.831) * [-229.262] (-231.587) (-232.108) (-230.531) -- 0:00:26
      559500 -- (-229.697) [-227.903] (-232.493) (-232.687) * (-232.398) [-228.752] (-232.147) (-234.085) -- 0:00:26
      560000 -- [-228.875] (-229.462) (-231.528) (-231.607) * (-230.421) (-230.972) [-229.554] (-231.716) -- 0:00:27

      Average standard deviation of split frequencies: 0.006096

      560500 -- (-228.394) (-229.627) [-227.958] (-231.949) * (-231.076) [-229.455] (-228.293) (-228.420) -- 0:00:27
      561000 -- (-232.055) (-232.827) (-232.957) [-231.036] * (-238.319) (-230.654) (-231.171) [-229.570] -- 0:00:27
      561500 -- (-230.663) [-232.663] (-230.601) (-229.645) * (-232.032) (-231.984) [-230.294] (-229.135) -- 0:00:27
      562000 -- (-234.771) (-230.226) [-228.598] (-230.806) * (-231.826) (-228.510) (-231.254) [-230.532] -- 0:00:27
      562500 -- (-228.744) [-233.271] (-228.419) (-231.826) * (-230.679) (-231.372) [-229.780] (-231.839) -- 0:00:27
      563000 -- (-229.415) (-230.674) [-228.449] (-233.048) * (-231.422) (-236.703) (-228.432) [-229.889] -- 0:00:27
      563500 -- (-230.101) (-229.911) (-230.661) [-229.101] * (-231.174) (-231.544) (-232.578) [-231.750] -- 0:00:27
      564000 -- (-230.173) [-232.277] (-232.734) (-229.350) * (-231.329) (-230.055) (-230.336) [-231.016] -- 0:00:27
      564500 -- (-229.699) (-229.480) [-230.996] (-230.118) * [-230.519] (-231.920) (-232.327) (-229.798) -- 0:00:27
      565000 -- (-230.713) (-230.541) (-232.650) [-231.862] * [-228.275] (-234.017) (-230.155) (-231.816) -- 0:00:26

      Average standard deviation of split frequencies: 0.007349

      565500 -- (-231.218) [-230.042] (-231.129) (-231.244) * [-230.814] (-232.977) (-232.122) (-229.279) -- 0:00:26
      566000 -- (-231.486) [-231.941] (-232.431) (-227.791) * (-228.313) (-228.613) (-232.667) [-229.129] -- 0:00:26
      566500 -- (-232.865) (-230.075) (-228.656) [-230.308] * (-228.913) (-229.313) (-230.651) [-231.042] -- 0:00:26
      567000 -- (-230.116) (-240.216) (-228.232) [-229.278] * [-228.308] (-229.617) (-230.991) (-234.276) -- 0:00:26
      567500 -- (-228.327) [-228.907] (-228.302) (-229.380) * (-230.985) [-228.962] (-231.665) (-229.351) -- 0:00:26
      568000 -- (-231.402) (-228.660) [-229.715] (-228.453) * (-229.068) [-231.180] (-233.249) (-230.639) -- 0:00:26
      568500 -- [-229.602] (-228.874) (-231.571) (-229.698) * (-230.953) [-230.481] (-232.039) (-229.885) -- 0:00:26
      569000 -- (-229.198) (-232.543) (-232.643) [-228.365] * [-231.720] (-230.344) (-229.798) (-230.008) -- 0:00:26
      569500 -- [-229.677] (-229.926) (-231.245) (-228.343) * (-231.852) (-232.983) [-228.608] (-229.926) -- 0:00:26
      570000 -- (-230.246) (-230.181) [-228.673] (-229.234) * (-229.610) (-229.263) (-230.181) [-228.664] -- 0:00:26

      Average standard deviation of split frequencies: 0.007337

      570500 -- [-233.302] (-230.013) (-229.416) (-228.242) * (-232.256) [-228.561] (-229.686) (-229.487) -- 0:00:26
      571000 -- [-229.011] (-229.423) (-230.073) (-229.970) * (-230.492) (-232.776) (-230.733) [-228.908] -- 0:00:26
      571500 -- (-231.787) (-231.320) (-232.278) [-228.898] * (-231.867) (-230.197) (-229.703) [-231.666] -- 0:00:26
      572000 -- [-228.469] (-232.282) (-229.561) (-231.536) * [-231.548] (-231.778) (-229.279) (-229.742) -- 0:00:26
      572500 -- (-229.822) [-229.607] (-229.560) (-232.639) * (-229.842) [-230.845] (-229.086) (-229.414) -- 0:00:26
      573000 -- [-232.301] (-228.948) (-229.721) (-229.862) * (-231.082) (-229.998) [-229.341] (-233.247) -- 0:00:26
      573500 -- (-234.230) [-229.332] (-230.878) (-229.226) * (-235.481) (-230.372) (-229.182) [-229.715] -- 0:00:26
      574000 -- (-237.327) (-228.638) (-232.194) [-229.141] * (-228.846) [-227.987] (-231.627) (-229.531) -- 0:00:26
      574500 -- (-230.636) (-229.054) (-233.535) [-228.927] * (-231.699) (-229.034) [-230.834] (-232.084) -- 0:00:26
      575000 -- (-229.444) (-228.718) [-229.920] (-230.078) * (-229.717) (-230.695) [-232.025] (-229.286) -- 0:00:26

      Average standard deviation of split frequencies: 0.007318

      575500 -- (-229.299) [-229.521] (-227.797) (-230.664) * (-233.548) (-229.518) [-229.900] (-231.494) -- 0:00:26
      576000 -- (-228.886) [-232.940] (-229.092) (-230.545) * (-231.457) (-231.954) [-230.629] (-229.648) -- 0:00:26
      576500 -- [-231.538] (-229.685) (-228.902) (-230.336) * (-233.570) (-234.622) [-229.460] (-229.716) -- 0:00:26
      577000 -- (-229.551) [-229.999] (-228.988) (-231.060) * [-229.433] (-233.341) (-230.246) (-233.586) -- 0:00:26
      577500 -- (-228.038) [-235.891] (-230.601) (-230.921) * [-229.391] (-229.586) (-232.759) (-228.625) -- 0:00:26
      578000 -- (-231.244) (-233.787) (-230.442) [-230.791] * [-228.617] (-228.279) (-231.213) (-233.934) -- 0:00:26
      578500 -- [-229.937] (-233.721) (-229.986) (-232.852) * [-229.165] (-232.783) (-229.088) (-230.187) -- 0:00:26
      579000 -- (-231.180) (-237.970) (-228.329) [-233.295] * (-234.493) [-231.680] (-233.103) (-234.404) -- 0:00:26
      579500 -- [-229.580] (-230.090) (-228.269) (-228.999) * (-234.853) (-228.787) [-231.223] (-228.349) -- 0:00:26
      580000 -- [-235.900] (-232.551) (-235.539) (-231.153) * (-229.112) (-230.698) (-229.097) [-228.165] -- 0:00:26

      Average standard deviation of split frequencies: 0.007002

      580500 -- [-230.597] (-230.794) (-229.786) (-232.896) * (-229.456) (-230.559) [-228.632] (-229.753) -- 0:00:26
      581000 -- (-228.133) [-229.501] (-230.498) (-237.118) * (-232.162) (-230.090) (-228.090) [-229.228] -- 0:00:25
      581500 -- (-229.395) (-230.009) (-230.361) [-230.126] * (-229.538) (-229.154) [-229.282] (-229.972) -- 0:00:25
      582000 -- [-228.840] (-228.618) (-228.838) (-237.155) * (-229.514) (-231.022) [-228.712] (-234.046) -- 0:00:25
      582500 -- (-228.223) (-229.170) [-235.222] (-230.166) * (-227.938) [-229.145] (-231.205) (-231.205) -- 0:00:25
      583000 -- (-228.190) (-230.240) [-232.052] (-228.429) * (-229.341) (-228.941) [-231.587] (-231.142) -- 0:00:25
      583500 -- (-230.608) (-232.351) [-228.912] (-231.123) * (-229.643) (-231.058) (-229.446) [-228.767] -- 0:00:25
      584000 -- (-231.539) [-230.737] (-229.245) (-232.620) * (-231.156) (-230.668) [-230.113] (-230.294) -- 0:00:25
      584500 -- (-229.202) [-228.511] (-231.000) (-229.385) * [-229.618] (-231.243) (-228.985) (-232.749) -- 0:00:25
      585000 -- [-230.577] (-228.911) (-229.660) (-232.237) * (-231.648) (-236.866) (-232.345) [-232.319] -- 0:00:25

      Average standard deviation of split frequencies: 0.006838

      585500 -- [-233.631] (-232.267) (-233.487) (-230.915) * [-231.117] (-232.994) (-229.774) (-229.776) -- 0:00:25
      586000 -- (-229.526) (-233.152) [-229.297] (-232.924) * (-230.074) (-230.527) (-228.051) [-231.155] -- 0:00:25
      586500 -- (-231.134) (-237.391) [-233.889] (-230.863) * (-230.416) [-232.472] (-229.775) (-231.982) -- 0:00:25
      587000 -- (-229.402) (-233.208) [-229.203] (-228.731) * (-230.785) (-231.218) (-228.601) [-231.778] -- 0:00:26
      587500 -- (-228.937) (-230.885) [-228.766] (-228.480) * [-234.313] (-228.963) (-231.121) (-228.374) -- 0:00:25
      588000 -- (-234.901) [-229.529] (-231.468) (-230.196) * (-232.208) (-229.411) (-233.801) [-231.455] -- 0:00:25
      588500 -- (-235.396) [-231.858] (-231.076) (-229.268) * (-232.275) (-229.656) [-228.655] (-230.295) -- 0:00:25
      589000 -- (-231.985) (-233.423) [-230.175] (-234.163) * (-230.589) [-228.212] (-228.650) (-232.443) -- 0:00:25
      589500 -- [-230.555] (-231.129) (-229.643) (-229.621) * (-231.223) [-230.890] (-229.095) (-235.376) -- 0:00:25
      590000 -- [-228.071] (-230.114) (-230.739) (-230.543) * (-232.977) (-230.522) [-228.169] (-233.782) -- 0:00:25

      Average standard deviation of split frequencies: 0.006332

      590500 -- (-231.724) (-229.440) [-228.768] (-233.278) * [-232.487] (-229.780) (-231.456) (-231.658) -- 0:00:25
      591000 -- (-229.463) (-229.931) [-231.897] (-231.081) * [-230.797] (-237.334) (-228.016) (-232.229) -- 0:00:25
      591500 -- [-229.737] (-229.672) (-228.822) (-235.999) * (-229.746) (-230.019) (-229.429) [-228.783] -- 0:00:25
      592000 -- (-232.868) (-229.828) (-230.355) [-230.460] * (-232.014) [-230.466] (-229.610) (-231.692) -- 0:00:25
      592500 -- [-231.279] (-229.128) (-229.501) (-228.262) * (-232.475) [-232.023] (-229.084) (-230.232) -- 0:00:25
      593000 -- (-228.433) (-228.720) (-229.939) [-230.219] * (-232.625) (-230.710) (-230.269) [-231.147] -- 0:00:25
      593500 -- (-228.875) [-228.904] (-229.793) (-231.181) * (-233.670) (-229.149) (-229.581) [-231.538] -- 0:00:25
      594000 -- (-231.853) (-232.313) [-229.057] (-228.698) * [-230.506] (-228.178) (-231.146) (-230.716) -- 0:00:25
      594500 -- (-231.926) (-230.147) [-229.472] (-230.576) * (-231.034) (-228.049) [-233.631] (-229.001) -- 0:00:25
      595000 -- (-229.515) [-228.826] (-229.489) (-231.259) * (-230.090) (-228.406) [-231.303] (-231.882) -- 0:00:25

      Average standard deviation of split frequencies: 0.006908

      595500 -- (-229.856) (-230.935) [-229.867] (-231.207) * (-230.193) (-228.811) [-228.800] (-234.988) -- 0:00:25
      596000 -- [-228.252] (-233.186) (-228.665) (-233.663) * (-231.867) (-228.598) [-230.420] (-230.984) -- 0:00:25
      596500 -- [-230.502] (-229.046) (-230.398) (-230.103) * (-232.361) (-230.631) [-232.515] (-230.066) -- 0:00:25
      597000 -- [-229.445] (-228.903) (-228.809) (-231.570) * [-229.885] (-233.214) (-229.454) (-232.122) -- 0:00:24
      597500 -- (-227.903) [-230.313] (-230.863) (-229.302) * [-228.700] (-231.084) (-232.764) (-232.185) -- 0:00:24
      598000 -- (-231.632) (-228.967) [-234.588] (-228.702) * (-230.778) [-229.194] (-229.777) (-233.374) -- 0:00:24
      598500 -- (-229.084) (-230.823) (-230.593) [-230.384] * [-230.908] (-229.805) (-231.395) (-233.626) -- 0:00:24
      599000 -- (-228.481) [-229.700] (-230.471) (-230.716) * (-230.817) (-234.367) (-230.444) [-231.887] -- 0:00:24
      599500 -- (-229.767) (-229.379) [-229.903] (-229.849) * [-233.650] (-234.121) (-229.911) (-230.040) -- 0:00:24
      600000 -- (-231.185) (-229.283) [-229.290] (-229.248) * (-234.940) (-232.168) (-233.906) [-230.988] -- 0:00:24

      Average standard deviation of split frequencies: 0.007011

      600500 -- (-232.403) (-232.711) [-228.509] (-229.742) * (-231.095) [-234.704] (-231.985) (-230.129) -- 0:00:24
      601000 -- (-228.709) (-231.325) (-232.083) [-229.049] * (-231.632) (-232.245) (-231.977) [-233.079] -- 0:00:24
      601500 -- [-232.717] (-232.516) (-231.053) (-228.163) * (-232.264) (-229.927) (-231.963) [-228.473] -- 0:00:24
      602000 -- [-230.430] (-230.667) (-230.906) (-229.288) * (-230.577) [-228.162] (-230.270) (-228.223) -- 0:00:24
      602500 -- [-232.754] (-228.728) (-233.314) (-234.928) * [-228.981] (-228.709) (-230.768) (-229.063) -- 0:00:25
      603000 -- (-228.979) (-235.982) [-229.006] (-228.637) * (-230.455) (-234.665) (-230.564) [-229.598] -- 0:00:25
      603500 -- (-230.356) [-233.432] (-231.365) (-228.953) * (-227.756) (-231.029) [-229.335] (-229.870) -- 0:00:24
      604000 -- (-228.041) (-229.642) (-232.911) [-229.348] * (-228.340) (-230.137) (-230.164) [-228.189] -- 0:00:24
      604500 -- (-233.799) [-228.941] (-231.368) (-231.228) * (-228.909) (-234.152) [-230.085] (-229.662) -- 0:00:24
      605000 -- (-229.657) [-228.850] (-233.094) (-230.288) * (-229.949) (-232.770) (-231.630) [-229.786] -- 0:00:24

      Average standard deviation of split frequencies: 0.007730

      605500 -- (-230.650) [-228.991] (-231.373) (-231.154) * [-230.791] (-229.942) (-228.341) (-229.539) -- 0:00:24
      606000 -- (-231.848) (-230.092) [-229.935] (-229.287) * (-230.968) (-229.125) (-228.998) [-228.402] -- 0:00:24
      606500 -- (-232.615) (-228.709) [-233.733] (-229.630) * (-234.760) (-230.176) (-229.054) [-228.680] -- 0:00:24
      607000 -- (-228.393) (-231.146) [-234.037] (-233.079) * [-231.642] (-232.739) (-229.695) (-231.531) -- 0:00:24
      607500 -- (-228.778) (-231.615) [-228.966] (-228.660) * (-231.086) [-231.392] (-228.227) (-233.115) -- 0:00:24
      608000 -- (-229.124) (-232.501) [-229.190] (-229.433) * [-230.069] (-230.053) (-228.280) (-230.865) -- 0:00:24
      608500 -- [-228.847] (-228.095) (-231.947) (-230.077) * [-229.280] (-230.444) (-233.485) (-231.225) -- 0:00:24
      609000 -- (-229.188) (-228.298) (-229.497) [-228.641] * (-228.782) [-229.515] (-228.196) (-233.793) -- 0:00:24
      609500 -- (-229.062) [-234.600] (-232.475) (-229.042) * [-229.801] (-229.233) (-229.573) (-230.259) -- 0:00:24
      610000 -- (-228.182) (-236.774) (-234.947) [-230.686] * [-230.831] (-228.121) (-230.322) (-232.237) -- 0:00:24

      Average standard deviation of split frequencies: 0.007102

      610500 -- (-229.399) [-229.549] (-230.136) (-230.400) * (-229.761) (-233.334) [-228.968] (-230.959) -- 0:00:24
      611000 -- (-229.181) [-228.905] (-230.710) (-229.260) * (-233.972) (-230.463) (-229.219) [-229.405] -- 0:00:24
      611500 -- (-231.845) (-236.022) [-234.575] (-230.374) * [-229.095] (-228.678) (-229.543) (-235.406) -- 0:00:24
      612000 -- (-237.133) [-228.393] (-234.097) (-231.935) * (-228.238) (-229.433) [-228.782] (-228.141) -- 0:00:24
      612500 -- (-230.227) [-232.095] (-230.082) (-231.080) * [-228.012] (-229.265) (-229.240) (-229.406) -- 0:00:24
      613000 -- (-230.431) [-229.725] (-231.040) (-230.640) * (-229.565) (-228.736) (-228.913) [-229.557] -- 0:00:23
      613500 -- (-232.640) (-231.027) [-229.827] (-228.273) * (-232.972) [-230.182] (-231.282) (-229.642) -- 0:00:23
      614000 -- (-231.159) (-228.732) [-231.729] (-230.458) * (-230.770) (-229.708) (-229.537) [-228.615] -- 0:00:23
      614500 -- (-230.086) (-232.161) (-230.076) [-229.191] * (-229.789) [-228.569] (-236.915) (-231.771) -- 0:00:23
      615000 -- (-229.306) (-233.610) [-230.950] (-228.225) * (-231.390) (-229.967) [-228.618] (-228.857) -- 0:00:23

      Average standard deviation of split frequencies: 0.006836

      615500 -- [-228.915] (-233.043) (-231.138) (-228.136) * (-228.416) (-228.968) [-232.526] (-232.977) -- 0:00:23
      616000 -- (-230.525) [-228.752] (-231.559) (-229.857) * (-229.617) [-230.464] (-233.412) (-232.181) -- 0:00:23
      616500 -- [-232.015] (-229.302) (-228.515) (-229.535) * (-238.514) [-231.270] (-230.224) (-229.001) -- 0:00:23
      617000 -- [-229.006] (-228.687) (-231.984) (-228.863) * (-233.093) (-231.888) (-229.189) [-232.495] -- 0:00:23
      617500 -- (-229.111) (-229.133) (-233.871) [-229.272] * (-230.187) (-231.431) (-229.176) [-231.246] -- 0:00:24
      618000 -- (-233.290) (-235.966) [-233.534] (-233.441) * (-233.347) [-229.450] (-229.768) (-229.953) -- 0:00:24
      618500 -- (-231.994) [-230.089] (-232.279) (-231.457) * (-236.285) [-233.984] (-228.203) (-229.534) -- 0:00:24
      619000 -- (-228.405) (-229.729) [-231.620] (-235.321) * (-228.402) [-230.734] (-228.404) (-233.289) -- 0:00:24
      619500 -- (-230.374) [-228.194] (-233.188) (-229.712) * [-229.808] (-231.328) (-229.390) (-229.899) -- 0:00:23
      620000 -- (-231.692) (-229.335) [-228.167] (-234.671) * (-229.003) (-228.577) [-229.311] (-231.643) -- 0:00:23

      Average standard deviation of split frequencies: 0.008117

      620500 -- (-232.134) (-229.967) [-228.993] (-228.535) * (-228.828) (-229.488) [-228.824] (-231.748) -- 0:00:23
      621000 -- (-233.005) (-233.263) (-229.541) [-229.820] * (-231.407) [-230.200] (-228.374) (-231.103) -- 0:00:23
      621500 -- (-231.919) [-229.932] (-230.665) (-232.305) * (-228.283) (-230.038) (-228.494) [-231.145] -- 0:00:23
      622000 -- (-230.333) [-231.413] (-229.735) (-235.247) * (-229.002) [-229.121] (-229.323) (-229.421) -- 0:00:23
      622500 -- (-230.062) (-230.169) (-228.622) [-230.204] * (-230.715) (-231.573) (-229.153) [-232.361] -- 0:00:23
      623000 -- (-230.654) (-229.900) [-230.236] (-228.257) * (-228.924) [-229.746] (-230.448) (-230.132) -- 0:00:23
      623500 -- (-228.669) (-233.938) (-229.641) [-228.401] * [-228.906] (-231.284) (-229.203) (-230.628) -- 0:00:23
      624000 -- (-230.120) [-231.836] (-230.614) (-234.937) * [-229.343] (-230.318) (-232.088) (-228.813) -- 0:00:23
      624500 -- (-228.059) [-229.302] (-231.779) (-238.904) * (-230.111) (-233.084) (-235.499) [-229.387] -- 0:00:23
      625000 -- (-228.874) (-232.427) [-232.386] (-229.504) * [-229.855] (-227.990) (-229.038) (-229.582) -- 0:00:23

      Average standard deviation of split frequencies: 0.008378

      625500 -- [-228.678] (-230.274) (-229.465) (-228.687) * [-229.338] (-232.257) (-228.973) (-231.957) -- 0:00:23
      626000 -- [-232.982] (-229.408) (-233.323) (-228.023) * (-230.757) (-233.652) (-229.119) [-228.780] -- 0:00:23
      626500 -- (-232.703) [-228.490] (-231.772) (-228.681) * (-229.697) (-239.912) (-229.320) [-228.769] -- 0:00:23
      627000 -- (-230.353) (-230.024) [-236.123] (-231.874) * (-229.023) (-237.626) [-229.161] (-229.998) -- 0:00:23
      627500 -- [-230.108] (-229.249) (-232.484) (-232.844) * [-233.717] (-228.810) (-228.904) (-230.234) -- 0:00:23
      628000 -- (-229.877) [-229.277] (-229.092) (-230.181) * (-231.704) (-230.545) [-228.959] (-233.707) -- 0:00:23
      628500 -- (-230.653) (-236.405) (-228.897) [-229.308] * [-235.759] (-237.663) (-229.528) (-231.621) -- 0:00:23
      629000 -- [-228.860] (-230.913) (-228.654) (-231.428) * (-230.143) (-229.506) (-229.933) [-229.468] -- 0:00:23
      629500 -- (-229.060) (-229.470) [-234.241] (-233.905) * (-232.434) (-229.918) [-230.627] (-230.987) -- 0:00:22
      630000 -- [-231.593] (-231.998) (-231.194) (-234.354) * (-230.753) [-228.558] (-232.433) (-230.252) -- 0:00:22

      Average standard deviation of split frequencies: 0.008643

      630500 -- (-228.568) [-229.606] (-230.481) (-229.339) * (-236.245) [-229.758] (-228.687) (-236.313) -- 0:00:22
      631000 -- (-232.338) [-231.098] (-236.585) (-229.484) * (-232.888) (-232.737) [-229.984] (-229.867) -- 0:00:22
      631500 -- [-230.121] (-229.415) (-231.547) (-231.228) * [-229.695] (-228.386) (-234.877) (-229.646) -- 0:00:22
      632000 -- (-233.269) (-229.163) [-229.963] (-230.217) * (-230.272) (-228.299) [-233.874] (-230.003) -- 0:00:22
      632500 -- (-229.219) (-229.582) (-232.512) [-231.289] * (-231.523) (-229.163) (-229.007) [-232.166] -- 0:00:22
      633000 -- (-230.444) (-229.138) [-229.571] (-229.139) * (-230.186) (-228.918) [-229.055] (-228.687) -- 0:00:23
      633500 -- [-229.982] (-228.933) (-232.366) (-235.667) * (-231.673) (-228.574) [-229.486] (-231.377) -- 0:00:23
      634000 -- (-233.473) [-229.534] (-229.736) (-231.733) * (-228.346) [-234.956] (-229.524) (-233.792) -- 0:00:23
      634500 -- (-232.430) (-229.742) (-232.758) [-230.938] * [-230.152] (-229.850) (-229.731) (-228.941) -- 0:00:23
      635000 -- (-228.917) (-230.125) (-230.442) [-231.031] * (-231.743) (-230.231) [-231.460] (-230.960) -- 0:00:22

      Average standard deviation of split frequencies: 0.008200

      635500 -- (-230.569) (-230.363) (-230.953) [-229.869] * (-231.635) (-229.564) [-233.006] (-229.891) -- 0:00:22
      636000 -- [-232.385] (-229.401) (-232.597) (-229.683) * (-229.701) (-230.146) [-232.971] (-231.849) -- 0:00:22
      636500 -- (-230.058) (-230.260) [-234.229] (-228.678) * (-232.058) [-229.102] (-232.633) (-232.255) -- 0:00:22
      637000 -- [-229.887] (-230.112) (-234.249) (-231.502) * (-231.572) (-230.752) [-231.324] (-232.136) -- 0:00:22
      637500 -- (-228.725) (-231.816) (-232.444) [-231.997] * [-230.515] (-231.286) (-231.954) (-229.015) -- 0:00:22
      638000 -- (-229.284) (-229.557) [-230.696] (-230.677) * (-228.961) (-231.191) [-232.134] (-230.237) -- 0:00:22
      638500 -- [-231.511] (-229.873) (-229.437) (-228.446) * (-230.065) [-233.324] (-229.735) (-229.310) -- 0:00:22
      639000 -- (-229.013) (-233.544) (-229.985) [-228.986] * (-229.340) (-231.320) (-229.119) [-231.346] -- 0:00:22
      639500 -- (-231.107) (-232.969) [-228.823] (-228.653) * (-230.141) (-228.899) (-229.185) [-229.514] -- 0:00:22
      640000 -- (-231.237) (-230.272) (-229.159) [-231.182] * [-229.706] (-231.311) (-232.568) (-233.587) -- 0:00:22

      Average standard deviation of split frequencies: 0.008048

      640500 -- [-228.579] (-229.352) (-228.450) (-232.724) * (-230.108) [-233.287] (-229.724) (-232.402) -- 0:00:22
      641000 -- (-232.486) (-229.816) [-230.233] (-233.978) * (-233.101) (-230.536) (-230.861) [-230.943] -- 0:00:22
      641500 -- (-229.420) (-228.680) (-231.157) [-231.403] * (-229.275) [-229.184] (-234.000) (-233.439) -- 0:00:22
      642000 -- (-230.464) (-228.892) [-228.429] (-230.956) * (-230.103) (-229.253) (-232.164) [-228.981] -- 0:00:22
      642500 -- (-235.909) (-230.077) [-236.619] (-229.540) * (-233.038) [-229.691] (-231.875) (-229.203) -- 0:00:22
      643000 -- (-230.952) (-229.675) [-229.023] (-229.359) * (-228.938) (-231.928) (-229.062) [-232.433] -- 0:00:22
      643500 -- (-228.487) [-227.873] (-229.639) (-229.698) * (-228.385) (-228.971) (-230.279) [-228.754] -- 0:00:22
      644000 -- (-228.258) [-228.664] (-229.616) (-229.434) * [-232.064] (-230.082) (-235.158) (-230.813) -- 0:00:22
      644500 -- [-228.618] (-229.011) (-232.487) (-229.052) * [-230.192] (-233.499) (-233.297) (-228.069) -- 0:00:22
      645000 -- (-229.582) (-230.122) [-231.127] (-230.263) * (-232.170) (-231.019) [-230.863] (-231.964) -- 0:00:22

      Average standard deviation of split frequencies: 0.007684

      645500 -- (-231.244) (-235.009) [-232.543] (-230.125) * (-229.880) [-230.242] (-228.855) (-229.877) -- 0:00:21
      646000 -- (-229.828) [-231.223] (-230.886) (-228.718) * (-230.046) (-234.804) (-229.781) [-230.928] -- 0:00:21
      646500 -- [-232.599] (-230.440) (-235.264) (-232.545) * [-228.815] (-229.790) (-228.726) (-229.666) -- 0:00:21
      647000 -- (-229.230) [-228.744] (-229.594) (-231.051) * [-231.242] (-230.354) (-230.276) (-231.901) -- 0:00:21
      647500 -- (-230.927) (-233.135) (-230.749) [-230.733] * (-231.329) (-229.069) [-232.984] (-230.051) -- 0:00:21
      648000 -- (-229.226) [-230.076] (-230.907) (-229.497) * (-231.021) [-230.279] (-229.192) (-229.727) -- 0:00:21
      648500 -- (-229.431) (-228.502) (-232.327) [-229.333] * [-231.734] (-229.681) (-229.533) (-230.844) -- 0:00:21
      649000 -- (-232.553) (-228.025) (-229.999) [-230.626] * (-229.282) (-230.709) [-228.741] (-231.447) -- 0:00:22
      649500 -- (-231.814) [-228.439] (-230.514) (-229.385) * [-230.604] (-230.982) (-230.016) (-228.321) -- 0:00:22
      650000 -- (-232.343) (-228.477) (-229.914) [-229.487] * (-228.254) [-229.786] (-231.173) (-234.360) -- 0:00:22

      Average standard deviation of split frequencies: 0.008286

      650500 -- (-229.207) (-228.430) [-234.749] (-228.637) * (-231.360) [-232.880] (-228.905) (-229.128) -- 0:00:22
      651000 -- [-229.693] (-227.862) (-228.865) (-229.436) * (-230.477) (-236.402) (-230.708) [-228.760] -- 0:00:21
      651500 -- [-230.813] (-228.095) (-229.146) (-231.453) * (-232.126) (-229.022) (-231.963) [-228.569] -- 0:00:21
      652000 -- (-230.660) (-229.235) (-233.023) [-229.496] * (-230.405) (-230.609) [-231.978] (-231.298) -- 0:00:21
      652500 -- (-236.782) [-230.045] (-229.837) (-234.739) * [-228.580] (-231.557) (-230.489) (-229.503) -- 0:00:21
      653000 -- (-229.113) (-229.263) [-228.880] (-232.179) * (-229.957) [-234.953] (-230.792) (-229.201) -- 0:00:21
      653500 -- [-229.308] (-230.367) (-228.535) (-230.019) * (-233.037) (-230.116) [-229.775] (-229.228) -- 0:00:21
      654000 -- [-228.615] (-228.530) (-229.136) (-229.457) * [-229.144] (-231.842) (-229.781) (-230.828) -- 0:00:21
      654500 -- (-228.373) (-228.488) [-231.134] (-229.142) * [-229.213] (-233.401) (-234.038) (-229.909) -- 0:00:21
      655000 -- (-228.949) [-228.886] (-232.512) (-229.782) * (-231.156) [-231.633] (-234.738) (-238.740) -- 0:00:21

      Average standard deviation of split frequencies: 0.008668

      655500 -- [-229.942] (-228.690) (-231.382) (-230.630) * (-230.056) (-229.906) [-233.331] (-227.899) -- 0:00:21
      656000 -- (-229.262) (-231.121) [-231.236] (-230.861) * (-232.542) (-230.418) [-232.204] (-232.028) -- 0:00:21
      656500 -- (-229.851) [-228.947] (-232.489) (-232.321) * (-229.353) [-228.004] (-229.228) (-228.220) -- 0:00:21
      657000 -- [-229.253] (-233.418) (-231.785) (-233.687) * (-228.429) [-232.486] (-229.482) (-229.251) -- 0:00:21
      657500 -- (-231.182) (-229.249) (-231.804) [-228.933] * [-232.012] (-228.156) (-228.164) (-230.129) -- 0:00:21
      658000 -- (-231.272) (-229.192) (-232.548) [-228.840] * (-229.279) (-231.937) (-231.736) [-229.847] -- 0:00:21
      658500 -- (-229.437) (-229.237) [-229.523] (-230.764) * (-230.335) (-230.676) (-235.043) [-232.554] -- 0:00:21
      659000 -- (-231.075) (-228.627) (-230.627) [-231.173] * (-228.143) [-229.771] (-231.885) (-232.871) -- 0:00:21
      659500 -- (-229.637) [-230.039] (-230.149) (-228.746) * [-233.855] (-232.198) (-229.752) (-230.835) -- 0:00:21
      660000 -- (-228.940) [-230.324] (-228.583) (-230.025) * (-231.746) [-231.425] (-233.204) (-228.772) -- 0:00:21

      Average standard deviation of split frequencies: 0.008562

      660500 -- (-229.055) (-231.839) (-228.886) [-229.352] * (-232.147) [-227.894] (-229.496) (-229.508) -- 0:00:21
      661000 -- (-229.455) (-232.447) [-232.143] (-231.603) * [-230.278] (-229.743) (-229.010) (-230.903) -- 0:00:21
      661500 -- (-229.749) (-229.031) (-228.755) [-228.395] * (-228.768) [-229.726] (-228.236) (-232.336) -- 0:00:20
      662000 -- (-229.375) (-229.032) [-229.680] (-232.442) * [-229.603] (-231.479) (-230.211) (-230.172) -- 0:00:20
      662500 -- (-230.508) [-229.927] (-235.040) (-230.484) * [-229.568] (-229.645) (-227.897) (-229.577) -- 0:00:20
      663000 -- (-229.038) (-233.033) (-228.597) [-229.289] * [-228.388] (-228.801) (-228.082) (-227.860) -- 0:00:20
      663500 -- (-232.178) (-232.446) (-232.814) [-229.474] * (-231.900) (-228.694) [-229.598] (-228.461) -- 0:00:20
      664000 -- (-229.737) (-231.711) (-233.692) [-228.373] * (-232.006) [-228.703] (-228.339) (-233.313) -- 0:00:20
      664500 -- (-231.111) (-228.375) (-233.397) [-229.567] * (-229.494) (-229.236) (-231.013) [-231.226] -- 0:00:20
      665000 -- (-229.101) (-230.029) [-228.798] (-228.927) * (-229.138) [-228.734] (-230.430) (-228.770) -- 0:00:20

      Average standard deviation of split frequencies: 0.008671

      665500 -- (-228.578) (-239.172) [-230.810] (-231.451) * (-229.293) [-228.512] (-232.022) (-230.642) -- 0:00:20
      666000 -- [-229.654] (-234.810) (-229.375) (-228.698) * (-229.363) [-229.164] (-229.674) (-231.045) -- 0:00:21
      666500 -- (-228.833) (-229.747) [-231.575] (-228.873) * (-229.194) [-231.705] (-230.918) (-228.620) -- 0:00:21
      667000 -- (-231.558) [-231.180] (-229.764) (-228.571) * (-236.718) (-228.459) (-231.558) [-229.124] -- 0:00:20
      667500 -- (-231.863) (-229.949) [-228.799] (-236.702) * [-234.338] (-230.442) (-229.367) (-228.096) -- 0:00:20
      668000 -- (-231.362) (-229.429) (-233.373) [-230.140] * [-234.257] (-230.419) (-230.414) (-230.172) -- 0:00:20
      668500 -- (-232.015) (-230.501) (-229.364) [-230.042] * (-241.987) (-230.839) [-230.278] (-228.789) -- 0:00:20
      669000 -- (-231.492) (-229.113) (-231.786) [-228.839] * [-229.091] (-229.420) (-229.386) (-233.595) -- 0:00:20
      669500 -- (-228.890) (-229.777) (-233.110) [-230.808] * [-229.524] (-230.053) (-228.009) (-230.368) -- 0:00:20
      670000 -- [-229.277] (-229.525) (-234.362) (-229.831) * [-230.173] (-228.164) (-229.868) (-229.130) -- 0:00:20

      Average standard deviation of split frequencies: 0.008523

      670500 -- (-232.157) (-231.457) (-227.863) [-229.246] * (-229.687) (-228.828) (-232.611) [-231.439] -- 0:00:20
      671000 -- (-235.847) (-230.573) [-235.000] (-229.256) * (-230.139) (-228.172) [-229.827] (-232.281) -- 0:00:20
      671500 -- [-228.547] (-228.666) (-229.588) (-229.426) * [-229.919] (-228.724) (-229.078) (-232.138) -- 0:00:20
      672000 -- (-229.259) (-231.905) (-229.466) [-231.678] * (-229.559) (-229.508) [-232.261] (-230.222) -- 0:00:20
      672500 -- (-228.291) [-232.350] (-229.668) (-228.641) * (-229.937) (-235.350) (-230.109) [-228.770] -- 0:00:20
      673000 -- (-229.141) (-231.068) [-230.056] (-229.502) * (-233.137) [-229.465] (-229.763) (-228.106) -- 0:00:20
      673500 -- (-230.238) [-230.290] (-228.638) (-229.037) * (-231.554) [-229.726] (-229.330) (-233.048) -- 0:00:20
      674000 -- (-229.016) (-229.909) [-229.968] (-227.993) * (-229.169) (-228.073) (-230.898) [-230.182] -- 0:00:20
      674500 -- (-229.018) [-229.302] (-230.146) (-229.474) * (-229.709) (-231.875) [-229.146] (-231.367) -- 0:00:20
      675000 -- (-230.617) [-228.693] (-232.999) (-229.232) * (-233.342) (-230.583) (-232.977) [-229.919] -- 0:00:20

      Average standard deviation of split frequencies: 0.008063

      675500 -- (-232.569) (-229.329) (-229.312) [-231.012] * (-228.578) (-233.627) [-229.153] (-230.872) -- 0:00:20
      676000 -- [-231.481] (-228.836) (-228.775) (-232.384) * (-231.932) (-230.254) [-229.091] (-229.607) -- 0:00:20
      676500 -- [-231.614] (-229.164) (-228.108) (-235.745) * (-229.595) [-228.763] (-230.753) (-228.945) -- 0:00:20
      677000 -- (-229.873) (-230.597) (-228.387) [-230.099] * [-228.743] (-228.646) (-232.658) (-229.690) -- 0:00:20
      677500 -- (-229.999) (-228.926) (-228.509) [-229.810] * (-230.382) (-231.189) [-228.578] (-228.538) -- 0:00:19
      678000 -- (-229.565) [-228.524] (-234.589) (-228.495) * (-228.948) [-233.532] (-229.751) (-229.232) -- 0:00:19
      678500 -- (-230.633) (-229.107) [-232.233] (-232.207) * [-232.150] (-231.215) (-230.056) (-233.016) -- 0:00:19
      679000 -- (-232.489) (-231.542) (-229.491) [-230.030] * (-238.071) [-232.454] (-231.927) (-230.380) -- 0:00:19
      679500 -- (-235.206) (-233.629) (-230.371) [-229.712] * (-234.536) (-228.658) (-230.951) [-230.300] -- 0:00:19
      680000 -- (-231.919) (-232.128) (-232.410) [-228.103] * [-230.598] (-229.430) (-228.789) (-230.335) -- 0:00:19

      Average standard deviation of split frequencies: 0.008700

      680500 -- (-233.500) [-229.308] (-230.528) (-230.957) * (-230.327) (-231.156) [-229.185] (-228.815) -- 0:00:19
      681000 -- [-232.656] (-228.426) (-231.556) (-229.744) * [-230.947] (-231.348) (-232.085) (-231.234) -- 0:00:19
      681500 -- (-230.095) [-229.800] (-230.692) (-237.374) * (-231.511) [-228.951] (-236.470) (-230.392) -- 0:00:19
      682000 -- (-230.015) [-230.482] (-229.713) (-233.982) * (-232.561) (-227.957) (-233.101) [-228.805] -- 0:00:19
      682500 -- (-229.739) (-231.151) (-229.188) [-228.529] * [-230.497] (-228.126) (-230.917) (-230.222) -- 0:00:20
      683000 -- (-232.433) (-233.492) (-229.383) [-228.569] * (-229.375) (-229.070) [-229.574] (-228.215) -- 0:00:19
      683500 -- [-231.485] (-231.654) (-231.092) (-229.906) * (-230.946) [-228.575] (-228.469) (-228.134) -- 0:00:19
      684000 -- (-234.836) [-231.219] (-229.599) (-230.336) * (-231.721) [-231.983] (-228.339) (-231.303) -- 0:00:19
      684500 -- (-231.031) [-229.215] (-229.390) (-229.782) * [-228.614] (-232.786) (-232.219) (-231.108) -- 0:00:19
      685000 -- [-230.748] (-228.936) (-229.752) (-231.177) * (-231.528) (-230.415) [-229.738] (-228.088) -- 0:00:19

      Average standard deviation of split frequencies: 0.008418

      685500 -- (-232.505) [-229.174] (-231.783) (-230.664) * (-232.176) [-229.063] (-230.444) (-230.208) -- 0:00:19
      686000 -- [-233.182] (-232.939) (-231.646) (-229.583) * (-229.369) (-230.130) [-228.893] (-230.068) -- 0:00:19
      686500 -- (-231.242) [-230.247] (-229.752) (-230.138) * (-228.674) (-230.963) [-229.596] (-230.208) -- 0:00:19
      687000 -- (-229.066) (-231.011) [-228.826] (-231.858) * (-228.619) (-234.862) [-228.913] (-230.465) -- 0:00:19
      687500 -- [-228.300] (-228.870) (-231.556) (-230.024) * [-230.721] (-234.739) (-229.710) (-232.873) -- 0:00:19
      688000 -- (-233.236) (-228.613) [-231.324] (-231.468) * (-228.735) (-234.652) [-230.728] (-230.384) -- 0:00:19
      688500 -- [-233.979] (-229.182) (-229.865) (-233.197) * (-234.215) (-232.209) [-229.820] (-231.242) -- 0:00:19
      689000 -- [-230.454] (-229.153) (-228.873) (-228.845) * (-229.731) (-233.183) (-230.240) [-230.676] -- 0:00:19
      689500 -- (-230.544) (-229.011) [-230.770] (-229.900) * (-229.964) (-230.436) (-235.047) [-230.735] -- 0:00:19
      690000 -- (-229.501) (-230.975) [-233.125] (-235.503) * (-229.947) (-233.518) (-233.344) [-227.778] -- 0:00:19

      Average standard deviation of split frequencies: 0.009086

      690500 -- [-232.363] (-232.964) (-233.161) (-232.226) * [-229.874] (-232.667) (-233.285) (-236.653) -- 0:00:19
      691000 -- (-231.117) (-233.490) (-229.426) [-233.207] * [-230.885] (-232.385) (-229.479) (-229.091) -- 0:00:19
      691500 -- (-230.592) [-229.245] (-232.602) (-230.757) * [-228.693] (-230.856) (-229.221) (-230.485) -- 0:00:19
      692000 -- (-230.614) (-232.205) [-230.300] (-228.379) * (-237.147) (-230.944) (-228.802) [-229.950] -- 0:00:19
      692500 -- (-230.552) [-229.091] (-229.865) (-230.326) * (-231.931) [-231.795] (-228.828) (-229.506) -- 0:00:19
      693000 -- (-231.354) [-228.945] (-230.726) (-231.629) * (-229.229) (-231.604) [-228.270] (-232.054) -- 0:00:19
      693500 -- (-230.441) [-229.053] (-230.226) (-230.685) * [-231.136] (-228.398) (-230.109) (-229.061) -- 0:00:19
      694000 -- (-231.048) (-230.714) (-231.256) [-231.765] * [-229.774] (-230.842) (-229.038) (-229.130) -- 0:00:18
      694500 -- [-228.792] (-232.778) (-229.051) (-232.800) * [-230.461] (-233.004) (-231.340) (-229.794) -- 0:00:18
      695000 -- [-229.696] (-229.395) (-230.549) (-229.484) * (-230.349) (-230.412) (-232.339) [-229.059] -- 0:00:18

      Average standard deviation of split frequencies: 0.009101

      695500 -- [-230.121] (-228.844) (-237.471) (-233.747) * (-236.682) (-228.257) [-235.418] (-228.534) -- 0:00:18
      696000 -- [-232.739] (-228.765) (-230.789) (-229.341) * (-230.922) (-228.124) (-231.578) [-231.021] -- 0:00:18
      696500 -- (-232.087) [-231.459] (-228.968) (-229.404) * (-228.578) (-229.244) (-231.341) [-229.106] -- 0:00:18
      697000 -- (-230.677) (-229.013) [-228.215] (-231.203) * [-234.493] (-230.729) (-230.657) (-228.823) -- 0:00:18
      697500 -- (-228.639) [-229.071] (-228.206) (-230.492) * (-229.203) (-231.262) [-231.284] (-232.573) -- 0:00:18
      698000 -- [-228.584] (-229.464) (-229.769) (-229.289) * (-229.574) [-229.835] (-229.053) (-229.897) -- 0:00:18
      698500 -- (-229.987) [-228.051] (-228.975) (-229.294) * [-229.478] (-230.305) (-229.338) (-230.324) -- 0:00:18
      699000 -- (-238.202) (-230.085) (-231.268) [-228.974] * (-229.492) [-228.627] (-233.975) (-230.216) -- 0:00:18
      699500 -- (-231.591) (-231.873) (-229.502) [-228.611] * (-230.346) (-229.227) (-232.553) [-229.906] -- 0:00:18
      700000 -- [-231.471] (-229.014) (-229.294) (-233.893) * (-235.047) [-228.585] (-228.775) (-228.834) -- 0:00:18

      Average standard deviation of split frequencies: 0.009251

      700500 -- (-230.333) [-229.313] (-230.061) (-228.594) * [-235.700] (-231.246) (-230.936) (-230.031) -- 0:00:18
      701000 -- (-228.913) (-231.098) (-229.160) [-230.809] * (-230.480) (-231.283) (-229.374) [-228.638] -- 0:00:18
      701500 -- (-230.383) (-235.121) [-230.253] (-229.767) * (-236.809) (-230.940) (-229.115) [-229.331] -- 0:00:18
      702000 -- (-231.102) (-238.889) [-231.557] (-231.819) * (-230.772) (-229.569) [-229.462] (-228.803) -- 0:00:18
      702500 -- (-229.715) (-229.096) (-230.152) [-229.998] * (-230.956) [-231.197] (-228.876) (-229.068) -- 0:00:18
      703000 -- (-228.278) [-230.085] (-230.312) (-231.390) * (-230.775) (-230.979) [-229.690] (-228.624) -- 0:00:18
      703500 -- (-229.008) [-231.975] (-231.880) (-232.525) * (-230.221) (-230.920) (-229.585) [-229.940] -- 0:00:18
      704000 -- (-228.853) [-234.068] (-228.492) (-231.475) * [-231.239] (-232.539) (-234.975) (-229.545) -- 0:00:18
      704500 -- (-230.705) (-229.799) (-229.906) [-229.308] * [-229.588] (-232.725) (-231.580) (-230.648) -- 0:00:18
      705000 -- (-230.171) [-230.474] (-229.230) (-230.881) * (-229.931) (-231.994) [-229.800] (-228.506) -- 0:00:18

      Average standard deviation of split frequencies: 0.009598

      705500 -- (-232.159) (-229.582) [-230.014] (-229.041) * (-231.384) [-231.051] (-231.311) (-230.287) -- 0:00:18
      706000 -- (-232.170) [-230.385] (-230.377) (-230.876) * (-231.479) (-230.822) [-232.482] (-230.814) -- 0:00:18
      706500 -- [-232.591] (-230.923) (-228.812) (-230.165) * (-229.645) (-233.481) [-228.328] (-229.659) -- 0:00:18
      707000 -- (-231.374) [-232.661] (-229.574) (-232.357) * [-230.189] (-234.381) (-228.579) (-229.627) -- 0:00:18
      707500 -- (-230.929) [-228.087] (-228.918) (-231.695) * (-228.985) (-229.507) (-230.764) [-230.272] -- 0:00:18
      708000 -- (-230.022) [-228.135] (-230.030) (-231.821) * (-231.853) [-229.109] (-228.314) (-229.251) -- 0:00:18
      708500 -- (-230.364) (-229.150) (-228.480) [-231.973] * [-228.115] (-228.882) (-228.772) (-231.670) -- 0:00:18
      709000 -- [-228.805] (-230.787) (-230.498) (-234.623) * [-228.969] (-232.784) (-230.272) (-230.937) -- 0:00:18
      709500 -- (-230.171) (-229.920) [-229.091] (-235.279) * (-229.306) (-235.629) [-232.172] (-231.103) -- 0:00:18
      710000 -- (-232.165) (-229.990) [-230.873] (-229.181) * (-228.861) (-230.268) (-233.319) [-228.181] -- 0:00:17

      Average standard deviation of split frequencies: 0.009701

      710500 -- (-233.624) [-229.606] (-230.449) (-234.412) * [-228.535] (-228.250) (-235.722) (-229.332) -- 0:00:17
      711000 -- (-229.338) (-232.183) (-228.168) [-231.152] * (-229.036) [-232.715] (-229.636) (-230.330) -- 0:00:17
      711500 -- [-231.693] (-234.640) (-228.000) (-232.112) * [-229.161] (-232.123) (-231.257) (-232.325) -- 0:00:17
      712000 -- (-230.283) (-230.657) [-228.972] (-231.046) * (-228.762) (-229.883) [-231.547] (-230.952) -- 0:00:17
      712500 -- (-230.442) [-231.902] (-230.403) (-231.683) * (-230.338) (-230.645) [-230.198] (-229.593) -- 0:00:17
      713000 -- (-229.567) [-229.603] (-230.873) (-230.016) * [-229.429] (-230.099) (-230.385) (-234.243) -- 0:00:17
      713500 -- (-229.642) [-231.171] (-229.653) (-233.771) * (-229.642) (-232.580) [-230.360] (-230.409) -- 0:00:17
      714000 -- (-229.307) (-231.755) [-229.711] (-232.901) * (-229.860) (-230.649) (-228.888) [-228.700] -- 0:00:18
      714500 -- (-229.281) (-228.954) [-232.096] (-235.926) * (-230.675) (-233.317) (-231.579) [-232.547] -- 0:00:17
      715000 -- (-228.592) [-229.767] (-231.760) (-233.667) * [-230.209] (-232.096) (-229.271) (-233.049) -- 0:00:17

      Average standard deviation of split frequencies: 0.009300

      715500 -- (-228.042) (-231.427) [-228.919] (-234.923) * [-229.692] (-233.309) (-232.927) (-232.541) -- 0:00:17
      716000 -- [-230.054] (-228.927) (-231.242) (-231.435) * [-229.451] (-230.296) (-232.540) (-229.172) -- 0:00:17
      716500 -- [-230.884] (-229.192) (-232.324) (-229.996) * (-229.526) (-228.801) [-230.684] (-230.355) -- 0:00:17
      717000 -- (-229.891) [-229.688] (-235.592) (-230.454) * (-229.901) (-232.167) (-230.428) [-228.306] -- 0:00:17
      717500 -- (-230.224) [-230.620] (-229.836) (-231.592) * (-230.769) (-231.803) (-229.112) [-228.928] -- 0:00:17
      718000 -- (-232.368) (-230.645) (-234.015) [-232.163] * (-232.222) [-229.646] (-231.523) (-229.130) -- 0:00:17
      718500 -- (-232.351) (-231.781) (-229.690) [-230.108] * (-231.160) (-229.890) (-228.624) [-228.586] -- 0:00:17
      719000 -- (-232.025) (-230.186) [-231.193] (-232.520) * (-228.611) [-230.177] (-229.536) (-229.207) -- 0:00:17
      719500 -- (-234.385) (-228.801) [-229.328] (-229.524) * [-228.415] (-228.717) (-229.117) (-229.388) -- 0:00:17
      720000 -- (-229.442) (-230.762) (-230.751) [-228.860] * (-232.207) (-229.170) [-230.122] (-229.199) -- 0:00:17

      Average standard deviation of split frequencies: 0.008994

      720500 -- (-237.277) [-231.539] (-232.855) (-228.627) * (-230.238) [-229.728] (-228.933) (-230.464) -- 0:00:17
      721000 -- [-229.971] (-232.661) (-233.244) (-231.005) * (-230.745) (-229.007) (-230.625) [-229.082] -- 0:00:17
      721500 -- (-228.558) (-228.897) (-229.015) [-228.558] * (-232.816) (-231.457) (-229.791) [-229.366] -- 0:00:17
      722000 -- [-229.970] (-231.011) (-229.976) (-229.190) * (-230.785) (-232.842) [-230.645] (-231.597) -- 0:00:17
      722500 -- [-230.621] (-231.278) (-230.910) (-230.223) * [-232.214] (-233.511) (-230.013) (-230.306) -- 0:00:17
      723000 -- (-227.993) (-230.984) (-229.134) [-230.272] * (-228.588) (-232.157) (-228.783) [-230.598] -- 0:00:17
      723500 -- (-230.388) [-229.731] (-228.685) (-231.891) * (-230.299) (-230.555) (-228.795) [-232.105] -- 0:00:17
      724000 -- (-228.185) (-231.275) [-232.605] (-230.720) * (-232.122) [-229.880] (-228.953) (-231.572) -- 0:00:17
      724500 -- (-230.625) (-231.887) [-234.836] (-232.069) * (-231.428) (-229.853) [-230.399] (-228.027) -- 0:00:17
      725000 -- (-228.363) (-229.456) [-232.068] (-229.763) * (-229.299) (-230.214) [-229.917] (-231.324) -- 0:00:17

      Average standard deviation of split frequencies: 0.008644

      725500 -- [-231.370] (-232.686) (-229.542) (-229.087) * (-229.394) [-230.486] (-231.857) (-228.726) -- 0:00:17
      726000 -- (-235.800) (-228.970) (-232.044) [-232.239] * (-229.659) (-230.215) (-230.997) [-229.141] -- 0:00:16
      726500 -- (-234.187) [-229.214] (-234.006) (-230.922) * (-229.734) (-232.367) [-231.683] (-229.584) -- 0:00:16
      727000 -- (-230.400) (-232.093) [-232.448] (-228.943) * (-232.465) [-229.896] (-228.630) (-231.377) -- 0:00:16
      727500 -- (-230.414) (-235.142) (-228.439) [-228.227] * (-232.050) [-230.262] (-229.048) (-228.498) -- 0:00:16
      728000 -- (-236.947) (-233.333) [-229.710] (-229.603) * [-230.013] (-229.090) (-230.554) (-230.093) -- 0:00:16
      728500 -- (-234.951) (-229.333) [-229.441] (-229.840) * (-233.088) (-228.974) (-228.709) [-232.180] -- 0:00:16
      729000 -- (-235.952) (-229.912) [-228.328] (-233.858) * (-238.053) [-228.753] (-229.299) (-232.373) -- 0:00:16
      729500 -- (-229.082)