--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:03:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpmG/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -227.15          -229.62
2       -227.20          -231.14
--------------------------------------
TOTAL     -227.17          -230.65
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.892980    0.094100    0.330173    1.474825    0.853939   1461.17   1481.09    1.000
r(A<->C){all}   0.164989    0.019142    0.000112    0.447357    0.128372    142.30    178.66    1.009
r(A<->G){all}   0.172423    0.022049    0.000428    0.473967    0.130686    143.39    224.24    1.003
r(A<->T){all}   0.171906    0.022366    0.000032    0.470901    0.131355    160.81    182.31    1.001
r(C<->G){all}   0.163079    0.018251    0.000045    0.426252    0.130941    241.82    345.73    1.000
r(C<->T){all}   0.166965    0.021293    0.000006    0.466400    0.124651    219.34    231.46    1.001
r(G<->T){all}   0.160637    0.019943    0.000048    0.454216    0.121588    116.71    197.72    1.003
pi(A){all}      0.295803    0.001178    0.229516    0.360310    0.295775    934.07   1162.52    1.000
pi(C){all}      0.254050    0.001150    0.192112    0.323018    0.252813   1257.45   1332.76    1.000
pi(G){all}      0.278570    0.001191    0.210810    0.343265    0.277271   1456.97   1457.79    1.000
pi(T){all}      0.171577    0.000803    0.119293    0.227825    0.169780   1271.78   1315.37    1.000
alpha{1,2}      0.400242    0.220805    0.000128    1.373620    0.238755   1142.97   1202.50    1.000
alpha{3}        0.452634    0.243734    0.000379    1.458966    0.291037   1142.43   1321.71    1.000
pinvar{all}     0.988966    0.000184    0.964666    0.999996    0.993128   1074.42   1222.35    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-214.842638
Model 2: PositiveSelection	-214.842658
Model 0: one-ratio	-214.842634
Model 7: beta	-214.842655
Model 8: beta&w>1	-214.842612


Model 0 vs 1	7.999999979801942E-6

Model 2 vs 1	4.0000000012696546E-5

Model 8 vs 7	8.600000001024455E-5
>C1
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C2
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C3
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C4
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C5
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C6
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=55 

C1              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C2              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C3              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C4              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C5              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C6              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
                **************************************************

C1              HRETR
C2              HRETR
C3              HRETR
C4              HRETR
C5              HRETR
C6              HRETR
                *****




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   55 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   55 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1650]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [1650]--->[1650]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.442 Mb, Max= 30.571 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C2              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C3              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C4              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C5              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C6              MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
                **************************************************

C1              HRETR
C2              HRETR
C3              HRETR
C4              HRETR
C5              HRETR
C6              HRETR
                *****




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
C2              ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
C3              ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
C4              ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
C5              ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
C6              ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
                **************************************************

C1              GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
C2              GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
C3              GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
C4              GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
C5              GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
C6              GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
                **************************************************

C1              ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
C2              ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
C3              ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
C4              ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
C5              ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
C6              ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
                **************************************************

C1              CATCGTGAGACACGG
C2              CATCGTGAGACACGG
C3              CATCGTGAGACACGG
C4              CATCGTGAGACACGG
C5              CATCGTGAGACACGG
C6              CATCGTGAGACACGG
                ***************



>C1
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C2
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C3
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C4
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C5
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C6
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C1
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C2
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C3
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C4
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C5
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C6
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 165 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579791730
      Setting output file names to "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1419920897
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0813676410
      Seed = 847060396
      Swapseed = 1579791730
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -369.277912 -- -24.965149
         Chain 2 -- -369.277891 -- -24.965149
         Chain 3 -- -369.277912 -- -24.965149
         Chain 4 -- -369.277855 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -369.277891 -- -24.965149
         Chain 2 -- -369.277912 -- -24.965149
         Chain 3 -- -369.277912 -- -24.965149
         Chain 4 -- -369.277855 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-369.278] (-369.278) (-369.278) (-369.278) * [-369.278] (-369.278) (-369.278) (-369.278) 
        500 -- (-237.297) (-234.759) [-235.421] (-247.011) * [-232.089] (-238.544) (-239.553) (-244.843) -- 0:00:00
       1000 -- (-241.289) [-236.770] (-234.337) (-237.145) * (-244.146) (-236.853) (-237.401) [-237.629] -- 0:00:00
       1500 -- (-235.183) [-233.916] (-239.234) (-239.037) * [-234.280] (-233.729) (-237.038) (-234.317) -- 0:00:00
       2000 -- (-237.852) (-238.463) [-239.651] (-235.984) * (-240.256) [-237.846] (-234.291) (-240.515) -- 0:00:00
       2500 -- (-240.021) (-237.948) [-237.768] (-244.472) * (-240.941) (-239.247) (-237.328) [-234.634] -- 0:00:00
       3000 -- [-235.164] (-237.818) (-230.299) (-249.944) * [-233.863] (-235.690) (-231.538) (-232.143) -- 0:00:00
       3500 -- (-234.619) (-237.837) [-234.418] (-247.373) * (-233.551) [-233.627] (-241.387) (-243.527) -- 0:00:00
       4000 -- (-234.735) (-236.485) (-235.513) [-232.090] * (-240.745) [-234.347] (-233.911) (-239.159) -- 0:00:00
       4500 -- (-234.273) (-234.119) [-236.520] (-235.007) * (-236.662) (-236.362) (-244.077) [-235.488] -- 0:00:00
       5000 -- (-238.987) [-232.963] (-236.071) (-237.996) * [-236.180] (-238.291) (-233.676) (-242.512) -- 0:00:00

      Average standard deviation of split frequencies: 0.055459

       5500 -- (-237.590) (-235.802) (-242.217) [-234.125] * (-237.258) (-239.003) [-231.847] (-244.336) -- 0:00:00
       6000 -- (-244.657) (-243.023) [-234.385] (-234.856) * (-243.257) (-230.159) (-234.391) [-238.678] -- 0:00:00
       6500 -- [-234.747] (-238.105) (-237.893) (-237.993) * (-247.574) [-238.454] (-232.025) (-244.439) -- 0:00:00
       7000 -- (-238.812) (-239.073) [-234.577] (-238.809) * (-244.946) [-236.213] (-243.979) (-257.730) -- 0:00:00
       7500 -- [-233.103] (-233.408) (-233.688) (-248.272) * (-247.003) (-239.047) [-238.844] (-251.146) -- 0:00:00
       8000 -- (-238.261) [-237.294] (-243.939) (-237.898) * (-246.586) [-233.535] (-237.165) (-242.483) -- 0:00:00
       8500 -- (-230.087) (-239.093) (-245.076) [-234.419] * (-239.844) (-230.663) (-238.148) [-249.239] -- 0:00:00
       9000 -- (-241.123) (-237.405) (-234.105) [-233.212] * (-232.143) [-238.249] (-238.384) (-241.652) -- 0:00:00
       9500 -- (-242.900) (-241.655) [-235.570] (-227.508) * [-228.491] (-252.115) (-240.097) (-238.737) -- 0:00:00
      10000 -- (-242.336) (-237.499) (-238.576) [-227.522] * (-226.986) (-237.855) (-240.932) [-235.519] -- 0:00:00

      Average standard deviation of split frequencies: 0.066291

      10500 -- (-245.111) (-235.067) (-239.733) [-226.520] * [-225.861] (-239.844) (-250.122) (-233.655) -- 0:00:00
      11000 -- (-244.298) [-235.320] (-237.205) (-227.176) * [-227.756] (-246.237) (-248.043) (-227.796) -- 0:00:00
      11500 -- (-244.182) (-237.653) (-236.584) [-226.289] * (-227.886) (-242.772) (-241.701) [-226.831] -- 0:00:00
      12000 -- (-234.982) (-237.910) (-239.222) [-231.680] * [-227.743] (-238.831) (-228.704) (-228.135) -- 0:00:00
      12500 -- (-227.080) (-242.330) (-240.097) [-226.666] * (-227.652) (-239.550) (-229.786) [-232.499] -- 0:00:00
      13000 -- [-229.048] (-249.118) (-236.848) (-227.932) * [-227.131] (-239.574) (-231.421) (-228.557) -- 0:00:00
      13500 -- [-228.133] (-245.196) (-237.208) (-228.382) * [-225.748] (-244.717) (-227.161) (-228.910) -- 0:00:00
      14000 -- [-227.731] (-246.181) (-241.583) (-228.392) * [-226.376] (-256.969) (-229.129) (-227.796) -- 0:00:00
      14500 -- (-228.374) (-236.678) [-244.373] (-226.339) * (-232.768) (-245.616) [-229.332] (-229.111) -- 0:00:00
      15000 -- [-227.806] (-230.602) (-247.020) (-225.734) * (-230.144) (-241.819) (-228.970) [-229.703] -- 0:00:00

      Average standard deviation of split frequencies: 0.058926

      15500 -- (-225.930) (-230.323) [-237.995] (-230.188) * (-230.402) (-243.273) (-232.943) [-228.214] -- 0:00:00
      16000 -- (-226.224) (-227.045) [-235.816] (-229.084) * (-228.928) (-235.839) (-227.543) [-229.270] -- 0:01:01
      16500 -- (-228.657) (-229.476) (-238.863) [-227.355] * [-227.278] (-231.483) (-228.972) (-227.820) -- 0:00:59
      17000 -- (-227.617) [-227.161] (-247.969) (-227.174) * (-229.081) [-233.288] (-228.638) (-228.861) -- 0:00:57
      17500 -- (-228.406) [-230.871] (-245.994) (-228.528) * (-227.143) (-227.068) [-227.730] (-226.978) -- 0:00:56
      18000 -- (-232.521) (-227.171) (-239.550) [-230.021] * (-227.481) (-229.309) (-227.333) [-226.816] -- 0:00:54
      18500 -- (-225.841) (-226.609) [-229.741] (-226.805) * (-229.812) (-226.915) [-226.228] (-227.869) -- 0:00:53
      19000 -- (-227.645) (-226.498) [-236.339] (-228.022) * [-230.288] (-226.902) (-228.096) (-228.136) -- 0:00:51
      19500 -- (-230.629) [-228.100] (-241.819) (-228.080) * (-226.346) (-228.919) [-227.037] (-226.412) -- 0:00:50
      20000 -- [-233.019] (-229.196) (-248.086) (-228.008) * [-229.115] (-225.689) (-226.221) (-228.461) -- 0:00:49

      Average standard deviation of split frequencies: 0.061721

      20500 -- (-229.418) (-229.958) (-241.568) [-227.577] * [-231.208] (-226.004) (-229.781) (-227.730) -- 0:00:47
      21000 -- [-228.166] (-228.291) (-235.645) (-227.571) * (-226.607) (-228.353) [-227.732] (-234.441) -- 0:00:46
      21500 -- (-227.229) (-228.650) (-227.193) [-226.984] * [-226.548] (-232.381) (-231.633) (-230.488) -- 0:00:45
      22000 -- (-229.636) [-227.729] (-228.301) (-226.303) * (-231.042) [-227.113] (-229.325) (-229.161) -- 0:00:44
      22500 -- (-228.537) [-228.379] (-226.435) (-227.794) * (-229.174) [-226.376] (-226.532) (-226.686) -- 0:00:43
      23000 -- (-226.494) [-226.129] (-228.110) (-228.035) * (-226.263) (-226.926) (-229.079) [-228.529] -- 0:00:42
      23500 -- (-227.187) [-226.984] (-229.100) (-227.216) * [-225.868] (-228.296) (-228.225) (-228.012) -- 0:00:41
      24000 -- (-234.337) (-230.129) [-228.595] (-226.761) * (-227.101) [-226.367] (-227.458) (-228.462) -- 0:00:40
      24500 -- (-230.154) (-225.988) (-228.503) [-228.476] * [-227.403] (-225.534) (-227.946) (-228.956) -- 0:00:39
      25000 -- (-230.371) [-227.547] (-229.046) (-230.337) * (-229.985) (-228.493) (-230.366) [-228.792] -- 0:00:39

      Average standard deviation of split frequencies: 0.046976

      25500 -- (-230.208) (-227.837) (-232.092) [-229.674] * (-227.080) (-229.338) [-230.899] (-227.852) -- 0:00:38
      26000 -- (-230.177) (-231.543) [-227.839] (-229.550) * (-228.831) [-228.674] (-227.378) (-226.102) -- 0:00:37
      26500 -- (-226.931) (-232.593) (-228.617) [-226.150] * (-227.148) [-230.149] (-230.557) (-226.228) -- 0:00:36
      27000 -- (-229.535) (-232.599) (-226.971) [-231.899] * (-229.460) [-230.100] (-229.219) (-229.308) -- 0:00:36
      27500 -- [-228.707] (-226.043) (-225.842) (-231.174) * (-230.424) [-228.007] (-226.877) (-227.077) -- 0:00:35
      28000 -- (-232.569) (-227.784) (-227.657) [-229.290] * (-226.206) (-227.698) [-226.264] (-226.749) -- 0:00:34
      28500 -- (-231.137) (-226.981) [-226.285] (-226.803) * (-226.778) (-229.370) (-226.429) [-226.732] -- 0:00:34
      29000 -- [-228.351] (-230.164) (-229.491) (-228.179) * (-225.790) (-226.998) [-226.177] (-229.471) -- 0:00:33
      29500 -- (-229.656) (-231.731) (-227.590) [-228.862] * (-225.860) [-227.456] (-226.476) (-228.256) -- 0:00:32
      30000 -- (-229.354) (-228.790) [-229.691] (-226.120) * (-227.602) [-229.231] (-227.534) (-234.007) -- 0:00:32

      Average standard deviation of split frequencies: 0.046116

      30500 -- (-230.560) (-229.102) (-227.786) [-228.636] * (-229.939) [-226.141] (-228.065) (-228.233) -- 0:00:31
      31000 -- [-226.528] (-230.653) (-228.581) (-227.514) * [-226.941] (-231.829) (-228.498) (-227.321) -- 0:00:31
      31500 -- (-227.710) (-228.765) (-229.913) [-226.239] * (-233.290) (-228.076) [-232.535] (-227.829) -- 0:00:30
      32000 -- (-227.501) (-229.804) [-227.501] (-230.444) * (-230.066) (-230.208) (-229.225) [-227.769] -- 0:00:30
      32500 -- [-227.810] (-229.187) (-229.920) (-226.877) * [-229.183] (-230.628) (-227.034) (-226.367) -- 0:00:29
      33000 -- (-226.951) (-228.550) [-227.244] (-232.050) * (-226.766) (-227.398) (-230.675) [-226.693] -- 0:00:58
      33500 -- (-228.463) [-227.928] (-226.128) (-226.875) * (-227.170) (-229.200) (-226.286) [-227.843] -- 0:00:57
      34000 -- (-225.800) (-228.518) [-228.952] (-228.827) * (-226.217) [-228.171] (-227.439) (-227.199) -- 0:00:56
      34500 -- [-229.238] (-230.421) (-227.240) (-229.227) * [-226.428] (-230.161) (-226.627) (-227.903) -- 0:00:55
      35000 -- [-226.121] (-227.332) (-227.984) (-228.230) * (-227.500) [-225.939] (-227.381) (-230.195) -- 0:00:55

      Average standard deviation of split frequencies: 0.036010

      35500 -- [-226.038] (-227.824) (-229.010) (-226.720) * (-227.377) [-229.547] (-228.730) (-227.279) -- 0:00:54
      36000 -- (-226.131) (-227.755) [-227.492] (-226.262) * [-226.044] (-230.104) (-228.882) (-227.435) -- 0:00:53
      36500 -- [-227.735] (-229.402) (-226.523) (-227.876) * (-226.505) [-228.886] (-231.415) (-228.018) -- 0:00:52
      37000 -- [-227.145] (-227.655) (-230.012) (-227.626) * (-229.024) (-226.102) [-226.325] (-228.820) -- 0:00:52
      37500 -- (-226.598) (-227.401) (-227.277) [-227.362] * (-227.638) (-225.828) [-226.492] (-232.405) -- 0:00:51
      38000 -- (-227.725) [-228.602] (-228.937) (-226.867) * (-228.313) (-225.993) [-227.546] (-237.398) -- 0:00:50
      38500 -- (-226.718) (-225.896) (-226.082) [-227.594] * [-229.863] (-228.266) (-228.322) (-231.540) -- 0:00:49
      39000 -- (-227.317) (-227.560) (-226.294) [-226.200] * (-230.499) (-228.848) [-227.216] (-227.305) -- 0:00:49
      39500 -- (-229.211) (-226.900) (-231.215) [-226.617] * [-228.400] (-232.142) (-227.231) (-228.262) -- 0:00:48
      40000 -- (-226.928) [-226.296] (-226.368) (-227.062) * [-228.928] (-229.557) (-229.735) (-226.766) -- 0:00:48

      Average standard deviation of split frequencies: 0.035355

      40500 -- (-229.367) (-225.941) [-226.001] (-226.515) * (-232.737) (-231.485) [-227.254] (-227.515) -- 0:00:47
      41000 -- [-227.625] (-226.901) (-229.329) (-229.468) * (-237.542) (-229.841) [-228.544] (-227.119) -- 0:00:46
      41500 -- (-226.428) [-226.299] (-226.954) (-228.795) * (-226.421) (-231.431) (-231.752) [-229.697] -- 0:00:46
      42000 -- [-226.198] (-226.103) (-226.999) (-231.464) * (-226.840) [-232.618] (-226.006) (-228.268) -- 0:00:45
      42500 -- (-225.954) (-228.082) [-227.045] (-226.171) * (-226.082) (-227.247) [-229.141] (-229.301) -- 0:00:45
      43000 -- (-225.862) (-228.069) [-226.723] (-226.477) * (-228.207) [-226.131] (-228.387) (-228.370) -- 0:00:44
      43500 -- [-227.739] (-227.099) (-230.172) (-228.762) * (-228.653) (-229.045) (-227.696) [-229.711] -- 0:00:43
      44000 -- (-228.794) [-229.167] (-229.454) (-227.649) * (-228.519) [-226.558] (-229.242) (-227.538) -- 0:00:43
      44500 -- (-228.964) (-227.667) (-226.898) [-229.114] * (-228.721) (-230.184) (-227.117) [-226.789] -- 0:00:42
      45000 -- (-227.936) [-227.588] (-226.691) (-229.849) * [-225.829] (-227.640) (-227.091) (-227.350) -- 0:00:42

      Average standard deviation of split frequencies: 0.029346

      45500 -- (-229.719) (-227.520) [-226.324] (-226.642) * (-226.936) (-227.074) [-228.002] (-230.207) -- 0:00:41
      46000 -- [-226.930] (-229.231) (-230.703) (-228.681) * (-227.077) [-227.567] (-228.417) (-233.103) -- 0:00:41
      46500 -- (-226.919) [-227.048] (-225.636) (-228.262) * [-228.149] (-227.296) (-227.866) (-229.713) -- 0:00:41
      47000 -- (-229.215) [-227.251] (-229.915) (-228.484) * (-226.984) (-228.213) [-226.908] (-230.001) -- 0:00:40
      47500 -- [-228.384] (-229.745) (-229.311) (-226.006) * (-230.286) (-231.069) (-228.411) [-230.060] -- 0:00:40
      48000 -- (-227.021) (-227.279) (-227.356) [-227.101] * (-227.261) (-228.016) (-227.748) [-226.402] -- 0:00:39
      48500 -- (-227.080) [-227.704] (-226.962) (-226.626) * (-228.351) (-229.023) [-225.917] (-226.213) -- 0:00:39
      49000 -- (-229.002) [-227.012] (-227.247) (-230.668) * (-229.158) [-226.072] (-225.945) (-229.280) -- 0:00:38
      49500 -- (-229.998) [-226.431] (-228.525) (-229.036) * (-227.995) (-230.015) [-227.206] (-229.235) -- 0:00:38
      50000 -- [-231.362] (-227.581) (-226.391) (-225.903) * (-231.094) (-228.262) [-227.579] (-227.097) -- 0:00:38

      Average standard deviation of split frequencies: 0.033495

      50500 -- (-229.444) (-226.934) (-227.027) [-226.919] * (-227.895) [-228.240] (-228.957) (-227.156) -- 0:00:56
      51000 -- (-226.665) (-228.511) [-226.684] (-228.444) * (-228.069) [-227.459] (-228.671) (-226.495) -- 0:00:55
      51500 -- (-227.081) (-227.134) (-227.050) [-226.597] * (-228.661) (-230.183) (-227.562) [-226.908] -- 0:00:55
      52000 -- (-227.702) (-226.005) (-226.788) [-227.145] * (-236.165) (-229.286) (-229.328) [-227.945] -- 0:00:54
      52500 -- (-226.488) (-228.185) [-230.066] (-229.126) * (-226.900) (-231.230) (-227.116) [-226.238] -- 0:00:54
      53000 -- (-226.799) (-227.011) [-228.108] (-235.619) * [-227.667] (-232.314) (-228.308) (-228.461) -- 0:00:53
      53500 -- (-227.001) (-228.025) [-229.863] (-229.583) * (-226.864) (-226.857) [-226.499] (-226.877) -- 0:00:53
      54000 -- (-226.567) (-228.931) [-226.300] (-228.270) * [-226.674] (-227.164) (-226.877) (-227.302) -- 0:00:52
      54500 -- [-225.850] (-228.215) (-227.083) (-228.215) * [-227.774] (-227.787) (-225.676) (-226.009) -- 0:00:52
      55000 -- [-226.114] (-227.486) (-225.679) (-227.412) * (-230.302) [-227.533] (-226.256) (-226.254) -- 0:00:51

      Average standard deviation of split frequencies: 0.034820

      55500 -- [-225.679] (-227.921) (-231.551) (-226.247) * [-229.235] (-225.915) (-230.293) (-230.187) -- 0:00:51
      56000 -- (-226.892) (-228.613) (-230.077) [-228.065] * [-226.114] (-228.390) (-228.997) (-229.765) -- 0:00:50
      56500 -- [-228.512] (-231.571) (-227.932) (-230.419) * (-227.931) (-229.449) (-228.620) [-225.943] -- 0:00:50
      57000 -- (-231.773) (-226.329) [-226.983] (-226.802) * [-228.365] (-230.660) (-226.952) (-227.620) -- 0:00:49
      57500 -- (-229.555) (-227.312) [-227.107] (-229.706) * [-229.782] (-226.040) (-227.545) (-227.813) -- 0:00:49
      58000 -- (-227.817) [-225.956] (-228.067) (-226.919) * (-230.823) [-227.891] (-228.780) (-231.217) -- 0:00:48
      58500 -- (-227.038) (-226.029) (-229.766) [-227.872] * (-226.191) (-227.111) [-228.640] (-229.025) -- 0:00:48
      59000 -- (-226.680) (-228.094) (-226.647) [-227.085] * (-228.051) (-226.805) [-228.984] (-226.765) -- 0:00:47
      59500 -- (-228.460) (-227.839) [-226.653] (-228.838) * [-228.567] (-226.803) (-230.233) (-226.781) -- 0:00:47
      60000 -- (-227.864) (-227.276) (-229.331) [-227.226] * (-227.842) (-227.931) (-226.801) [-226.958] -- 0:00:47

      Average standard deviation of split frequencies: 0.035522

      60500 -- (-227.791) (-227.937) [-230.967] (-226.916) * (-226.324) (-227.429) [-227.907] (-227.493) -- 0:00:46
      61000 -- [-227.250] (-229.040) (-228.257) (-226.283) * (-227.448) (-226.041) [-228.546] (-231.176) -- 0:00:46
      61500 -- (-227.224) (-226.314) (-228.185) [-227.504] * (-226.522) (-228.707) (-227.283) [-229.937] -- 0:00:45
      62000 -- (-229.016) (-225.942) [-228.753] (-225.895) * (-226.590) [-228.768] (-226.521) (-228.027) -- 0:00:45
      62500 -- (-233.190) (-227.692) (-229.058) [-227.113] * (-225.878) [-226.356] (-227.473) (-234.285) -- 0:00:45
      63000 -- (-227.737) (-227.736) [-228.567] (-229.885) * (-229.800) (-227.486) [-227.051] (-227.272) -- 0:00:44
      63500 -- (-228.762) (-227.373) [-226.993] (-227.605) * (-231.008) (-230.778) (-228.282) [-227.042] -- 0:00:44
      64000 -- (-228.995) (-230.446) [-226.819] (-231.564) * (-227.939) (-228.474) [-226.798] (-230.191) -- 0:00:43
      64500 -- (-230.820) (-229.880) (-229.597) [-227.766] * (-226.585) (-227.695) [-227.544] (-226.766) -- 0:00:43
      65000 -- (-229.201) [-227.184] (-230.080) (-230.394) * (-227.588) [-227.544] (-226.874) (-227.052) -- 0:00:43

      Average standard deviation of split frequencies: 0.039608

      65500 -- [-226.441] (-228.705) (-228.820) (-229.192) * (-227.457) [-229.332] (-226.820) (-228.042) -- 0:00:42
      66000 -- (-226.109) (-228.889) (-228.564) [-229.393] * [-227.468] (-226.664) (-226.358) (-235.103) -- 0:00:42
      66500 -- (-226.798) (-229.215) [-228.626] (-228.709) * [-227.707] (-228.406) (-226.551) (-230.757) -- 0:00:42
      67000 -- (-228.530) (-226.550) (-227.921) [-227.288] * [-228.344] (-228.616) (-229.062) (-229.555) -- 0:00:41
      67500 -- (-230.327) (-228.951) (-228.253) [-228.348] * (-229.102) (-228.139) [-230.001] (-230.549) -- 0:00:55
      68000 -- (-226.644) (-229.630) [-227.688] (-227.658) * (-231.072) (-226.923) [-228.320] (-227.610) -- 0:00:54
      68500 -- (-225.759) (-229.719) [-226.876] (-228.837) * (-227.545) (-226.094) [-227.562] (-229.554) -- 0:00:54
      69000 -- (-227.632) (-226.389) [-226.151] (-229.200) * (-228.013) (-226.267) (-227.277) [-228.121] -- 0:00:53
      69500 -- [-227.454] (-226.168) (-229.525) (-227.731) * (-231.245) (-230.797) (-228.372) [-230.056] -- 0:00:53
      70000 -- [-225.960] (-229.059) (-228.900) (-225.747) * [-227.027] (-232.399) (-227.640) (-227.516) -- 0:00:53

      Average standard deviation of split frequencies: 0.038437

      70500 -- (-226.210) [-227.496] (-226.791) (-228.455) * (-230.392) (-226.777) (-227.406) [-229.741] -- 0:00:52
      71000 -- (-226.745) (-228.863) [-227.185] (-232.969) * (-230.837) (-228.456) (-225.761) [-230.554] -- 0:00:52
      71500 -- (-226.353) (-228.632) (-232.067) [-226.583] * (-230.845) (-227.985) [-227.768] (-236.464) -- 0:00:51
      72000 -- (-225.933) (-231.715) [-229.313] (-227.600) * [-233.976] (-226.252) (-228.593) (-230.697) -- 0:00:51
      72500 -- (-227.701) (-226.671) [-228.718] (-225.853) * (-227.137) [-225.867] (-230.847) (-232.117) -- 0:00:51
      73000 -- [-231.236] (-227.014) (-227.809) (-228.759) * [-226.542] (-227.569) (-229.432) (-228.933) -- 0:00:50
      73500 -- (-228.677) (-230.087) [-229.791] (-226.363) * (-226.997) (-227.890) [-228.133] (-227.627) -- 0:00:50
      74000 -- [-228.115] (-227.393) (-229.945) (-230.930) * [-227.635] (-226.843) (-230.582) (-227.617) -- 0:00:50
      74500 -- (-226.467) [-227.949] (-226.925) (-228.392) * (-233.255) (-229.751) (-233.211) [-226.430] -- 0:00:49
      75000 -- (-229.726) (-230.585) (-226.737) [-229.012] * (-230.533) (-226.820) [-228.102] (-226.992) -- 0:00:49

      Average standard deviation of split frequencies: 0.033967

      75500 -- [-229.016] (-233.535) (-229.609) (-226.776) * (-232.107) [-225.985] (-227.855) (-226.972) -- 0:00:48
      76000 -- (-227.776) (-226.912) (-227.887) [-226.776] * (-229.995) (-226.594) (-226.119) [-226.894] -- 0:00:48
      76500 -- (-226.892) [-227.092] (-230.660) (-227.061) * (-228.456) (-231.215) [-227.752] (-229.827) -- 0:00:48
      77000 -- [-228.107] (-226.389) (-227.919) (-229.164) * [-225.907] (-226.848) (-230.358) (-228.438) -- 0:00:47
      77500 -- (-228.502) (-230.273) (-226.227) [-227.974] * (-226.113) [-228.338] (-226.604) (-226.709) -- 0:00:47
      78000 -- (-229.614) (-229.381) (-230.371) [-226.605] * (-231.004) (-226.501) (-227.343) [-228.048] -- 0:00:47
      78500 -- [-231.200] (-225.939) (-231.485) (-227.098) * [-231.575] (-229.059) (-229.671) (-227.314) -- 0:00:46
      79000 -- (-227.333) (-229.062) (-228.125) [-228.318] * (-228.976) (-228.524) [-226.585] (-229.765) -- 0:00:46
      79500 -- (-226.543) (-228.557) [-226.631] (-231.451) * (-226.330) (-228.066) [-227.324] (-231.611) -- 0:00:46
      80000 -- (-225.963) [-228.555] (-230.719) (-226.671) * (-226.307) [-227.779] (-226.803) (-228.787) -- 0:00:46

      Average standard deviation of split frequencies: 0.038402

      80500 -- (-230.308) (-229.532) (-226.758) [-228.600] * (-227.640) [-229.340] (-226.157) (-226.107) -- 0:00:45
      81000 -- (-228.883) [-226.810] (-226.133) (-230.816) * (-226.889) (-229.480) (-227.849) [-225.903] -- 0:00:45
      81500 -- [-227.736] (-229.753) (-227.356) (-229.510) * (-227.561) (-230.223) [-227.382] (-226.816) -- 0:00:45
      82000 -- [-226.890] (-226.293) (-227.637) (-228.207) * [-226.134] (-227.093) (-226.469) (-227.849) -- 0:00:44
      82500 -- (-227.102) [-226.109] (-227.996) (-230.319) * (-230.893) (-230.462) (-228.452) [-226.244] -- 0:00:44
      83000 -- (-227.744) (-228.212) (-230.402) [-227.320] * (-233.385) (-228.644) (-227.851) [-225.738] -- 0:00:44
      83500 -- (-228.212) [-227.867] (-227.304) (-229.107) * (-232.412) [-227.219] (-230.306) (-238.177) -- 0:00:43
      84000 -- (-227.203) (-228.151) (-227.060) [-227.118] * (-228.740) [-228.631] (-229.412) (-230.850) -- 0:00:43
      84500 -- (-229.249) (-226.921) (-226.168) [-228.039] * (-228.598) [-227.903] (-228.005) (-233.396) -- 0:00:43
      85000 -- (-228.894) (-229.395) (-228.585) [-230.644] * [-228.149] (-227.051) (-229.728) (-227.676) -- 0:00:53

      Average standard deviation of split frequencies: 0.035629

      85500 -- (-228.009) (-228.753) (-229.824) [-229.851] * (-229.835) [-228.686] (-228.350) (-227.837) -- 0:00:53
      86000 -- [-227.194] (-230.419) (-226.343) (-228.295) * (-227.831) (-226.692) [-229.158] (-227.011) -- 0:00:53
      86500 -- (-226.121) (-235.208) [-227.802] (-226.142) * (-228.149) (-226.070) [-228.770] (-226.083) -- 0:00:52
      87000 -- [-226.083] (-228.230) (-228.421) (-227.500) * [-226.451] (-227.774) (-226.500) (-228.100) -- 0:00:52
      87500 -- (-228.732) (-229.508) [-230.042] (-225.699) * (-229.668) [-227.769] (-228.305) (-228.781) -- 0:00:52
      88000 -- (-226.633) [-229.850] (-227.769) (-226.212) * (-226.548) [-226.187] (-232.194) (-229.694) -- 0:00:51
      88500 -- [-227.613] (-230.990) (-227.868) (-229.953) * (-225.993) [-227.680] (-234.861) (-229.469) -- 0:00:51
      89000 -- (-226.276) (-228.771) (-226.627) [-228.675] * [-226.005] (-228.479) (-230.683) (-227.953) -- 0:00:51
      89500 -- [-226.818] (-229.555) (-229.512) (-226.587) * (-227.596) [-230.395] (-227.894) (-226.082) -- 0:00:50
      90000 -- (-226.285) [-228.893] (-226.505) (-228.840) * (-226.867) (-227.986) [-227.935] (-229.894) -- 0:00:50

      Average standard deviation of split frequencies: 0.027482

      90500 -- (-228.258) (-226.406) [-225.888] (-228.655) * (-228.605) (-226.464) [-227.579] (-230.350) -- 0:00:50
      91000 -- (-227.971) [-229.691] (-226.398) (-226.711) * [-226.402] (-228.641) (-229.755) (-227.623) -- 0:00:49
      91500 -- [-227.103] (-229.826) (-228.004) (-226.457) * (-226.170) [-226.876] (-226.658) (-227.111) -- 0:00:49
      92000 -- (-229.571) (-226.983) (-231.317) [-226.294] * (-226.133) [-227.715] (-229.706) (-227.302) -- 0:00:49
      92500 -- (-226.793) (-227.762) [-226.427] (-226.134) * (-227.299) (-228.570) [-227.198] (-228.659) -- 0:00:49
      93000 -- (-228.023) [-228.550] (-226.131) (-228.587) * (-229.683) (-229.079) (-226.640) [-226.658] -- 0:00:48
      93500 -- (-230.459) (-229.379) (-228.760) [-226.275] * (-226.618) [-229.136] (-228.398) (-229.702) -- 0:00:48
      94000 -- (-230.552) (-227.207) [-227.013] (-227.013) * (-227.490) (-227.990) [-227.534] (-227.587) -- 0:00:48
      94500 -- [-227.621] (-231.879) (-229.078) (-234.803) * (-235.331) (-228.197) [-228.798] (-228.103) -- 0:00:47
      95000 -- (-229.516) (-228.283) (-229.866) [-226.191] * (-232.060) (-228.985) (-227.337) [-228.614] -- 0:00:47

      Average standard deviation of split frequencies: 0.029463

      95500 -- (-231.291) (-228.816) [-226.727] (-228.650) * (-227.894) [-226.612] (-228.889) (-228.764) -- 0:00:47
      96000 -- (-230.063) (-227.030) (-227.568) [-228.127] * (-227.097) (-229.364) [-235.334] (-226.454) -- 0:00:47
      96500 -- [-229.624] (-230.484) (-225.423) (-226.880) * (-228.362) (-233.102) [-226.702] (-226.051) -- 0:00:46
      97000 -- (-226.050) [-228.821] (-227.799) (-226.533) * (-230.407) (-227.571) [-227.523] (-227.551) -- 0:00:46
      97500 -- (-229.219) [-228.155] (-229.655) (-229.081) * (-228.816) (-229.134) (-225.901) [-229.055] -- 0:00:46
      98000 -- (-227.006) (-226.947) (-228.147) [-226.916] * [-227.249] (-227.163) (-227.250) (-227.857) -- 0:00:46
      98500 -- [-225.795] (-227.634) (-234.236) (-229.385) * [-227.296] (-227.713) (-229.923) (-228.393) -- 0:00:45
      99000 -- [-228.621] (-231.506) (-227.506) (-231.762) * (-229.854) (-228.701) [-229.805] (-226.917) -- 0:00:45
      99500 -- (-229.735) (-228.715) (-227.604) [-228.655] * (-226.213) [-226.745] (-228.588) (-227.842) -- 0:00:45
      100000 -- [-229.823] (-228.416) (-231.586) (-231.730) * [-226.440] (-226.662) (-227.790) (-229.044) -- 0:00:45

      Average standard deviation of split frequencies: 0.027651

      100500 -- (-227.975) [-226.646] (-232.948) (-229.447) * (-227.168) [-226.571] (-229.552) (-226.579) -- 0:00:44
      101000 -- (-225.858) (-227.406) (-227.848) [-228.342] * (-227.486) (-227.869) (-228.767) [-229.217] -- 0:00:44
      101500 -- (-226.991) (-226.764) [-229.615] (-230.151) * [-227.351] (-228.141) (-228.554) (-230.853) -- 0:00:53
      102000 -- (-230.526) (-227.078) (-231.393) [-226.941] * [-226.052] (-227.819) (-228.175) (-230.796) -- 0:00:52
      102500 -- (-228.987) [-227.597] (-234.963) (-231.208) * [-227.496] (-226.569) (-230.383) (-234.632) -- 0:00:52
      103000 -- [-228.256] (-228.611) (-230.107) (-228.320) * (-225.887) (-227.309) (-231.464) [-226.312] -- 0:00:52
      103500 -- (-226.405) [-227.675] (-228.579) (-228.405) * (-229.757) (-226.098) (-230.023) [-226.634] -- 0:00:51
      104000 -- [-229.782] (-226.870) (-227.484) (-231.652) * (-227.583) (-231.593) (-227.808) [-227.109] -- 0:00:51
      104500 -- (-231.770) (-230.263) (-227.380) [-227.075] * [-225.945] (-227.787) (-230.271) (-229.185) -- 0:00:51
      105000 -- (-226.059) (-226.196) [-226.903] (-227.033) * [-226.465] (-229.248) (-229.567) (-229.635) -- 0:00:51

      Average standard deviation of split frequencies: 0.025875

      105500 -- (-228.728) (-228.699) [-226.829] (-229.912) * [-227.682] (-230.208) (-229.417) (-230.768) -- 0:00:50
      106000 -- (-228.006) (-228.021) [-226.132] (-227.590) * [-226.963] (-229.744) (-228.369) (-227.298) -- 0:00:50
      106500 -- (-227.887) (-226.640) [-227.437] (-228.056) * [-229.057] (-228.652) (-225.752) (-227.887) -- 0:00:50
      107000 -- [-226.164] (-227.378) (-226.688) (-226.582) * [-226.953] (-227.613) (-229.840) (-226.392) -- 0:00:50
      107500 -- (-226.770) [-227.718] (-227.937) (-226.715) * (-230.159) [-229.639] (-228.560) (-228.369) -- 0:00:49
      108000 -- (-231.645) (-228.781) (-228.929) [-227.236] * (-226.378) [-230.185] (-228.418) (-236.933) -- 0:00:49
      108500 -- [-230.056] (-226.292) (-227.986) (-226.034) * (-226.913) [-226.597] (-227.435) (-229.497) -- 0:00:49
      109000 -- (-231.778) (-228.120) [-227.342] (-229.723) * (-227.652) (-225.757) [-229.622] (-226.136) -- 0:00:49
      109500 -- (-228.887) (-229.250) [-227.824] (-233.890) * [-227.366] (-226.969) (-227.996) (-228.436) -- 0:00:48
      110000 -- (-228.707) (-229.490) (-228.124) [-230.531] * (-227.218) (-226.261) [-226.560] (-227.543) -- 0:00:48

      Average standard deviation of split frequencies: 0.023622

      110500 -- (-229.062) [-225.974] (-231.191) (-227.782) * (-228.041) (-228.966) (-226.014) [-225.982] -- 0:00:48
      111000 -- [-228.261] (-227.434) (-228.505) (-227.990) * (-227.296) (-228.104) (-226.426) [-225.967] -- 0:00:48
      111500 -- (-229.100) (-226.477) (-226.185) [-227.145] * (-227.093) (-227.493) [-226.526] (-227.225) -- 0:00:47
      112000 -- (-226.295) (-230.753) (-228.602) [-231.729] * [-227.693] (-229.435) (-226.777) (-228.242) -- 0:00:47
      112500 -- (-229.222) [-229.363] (-228.821) (-231.949) * (-227.198) (-226.517) (-226.490) [-226.155] -- 0:00:47
      113000 -- (-229.027) (-231.006) (-227.537) [-229.200] * (-226.145) (-227.018) [-226.443] (-226.121) -- 0:00:47
      113500 -- (-227.957) (-227.262) [-226.450] (-228.601) * (-226.808) [-227.895] (-227.308) (-227.631) -- 0:00:46
      114000 -- (-233.230) [-227.848] (-231.045) (-225.795) * (-228.131) (-229.679) [-226.144] (-226.527) -- 0:00:46
      114500 -- (-227.461) (-230.856) [-230.980] (-228.938) * (-227.058) (-228.777) (-226.776) [-226.765] -- 0:00:46
      115000 -- (-228.135) (-227.276) (-226.905) [-227.144] * (-226.965) [-225.785] (-229.807) (-229.741) -- 0:00:46

      Average standard deviation of split frequencies: 0.022721

      115500 -- (-227.714) (-228.664) [-229.576] (-227.049) * (-229.390) (-226.162) (-225.884) [-225.655] -- 0:00:45
      116000 -- (-230.113) (-227.366) [-230.959] (-228.825) * (-227.666) (-229.432) (-228.158) [-226.356] -- 0:00:45
      116500 -- [-226.737] (-235.964) (-229.752) (-231.262) * (-228.202) (-230.986) (-226.418) [-226.377] -- 0:00:45
      117000 -- (-226.491) (-229.857) [-228.303] (-228.083) * (-227.940) (-227.658) (-225.972) [-229.278] -- 0:00:45
      117500 -- (-229.092) (-228.339) [-228.484] (-227.358) * [-227.393] (-233.510) (-226.479) (-225.925) -- 0:00:45
      118000 -- [-229.669] (-227.164) (-230.385) (-227.406) * (-229.753) [-227.443] (-225.824) (-226.429) -- 0:00:44
      118500 -- (-228.193) (-233.483) (-228.293) [-227.389] * [-227.126] (-229.898) (-229.336) (-225.986) -- 0:00:44
      119000 -- (-230.268) [-226.269] (-230.589) (-228.347) * [-227.809] (-227.327) (-227.557) (-226.455) -- 0:00:51
      119500 -- (-228.116) [-230.547] (-228.790) (-226.844) * (-227.653) [-228.931] (-229.253) (-226.102) -- 0:00:51
      120000 -- (-227.500) (-230.344) [-228.282] (-229.403) * (-228.565) [-227.220] (-229.112) (-227.933) -- 0:00:51

      Average standard deviation of split frequencies: 0.021132

      120500 -- (-227.119) (-228.868) (-226.129) [-226.976] * (-227.478) (-226.345) (-228.575) [-228.832] -- 0:00:51
      121000 -- (-226.825) (-230.023) [-227.060] (-227.867) * (-229.301) [-228.562] (-229.335) (-228.816) -- 0:00:50
      121500 -- (-225.950) [-229.015] (-227.887) (-228.711) * (-227.565) [-227.243] (-230.342) (-229.336) -- 0:00:50
      122000 -- (-228.122) (-231.761) (-226.346) [-227.464] * [-229.691] (-229.094) (-229.899) (-226.061) -- 0:00:50
      122500 -- (-227.935) [-228.914] (-227.714) (-226.003) * (-229.209) (-227.744) [-227.238] (-227.074) -- 0:00:50
      123000 -- (-226.666) (-229.587) (-227.548) [-226.256] * (-226.127) (-226.679) [-229.109] (-232.150) -- 0:00:49
      123500 -- [-226.094] (-229.674) (-231.969) (-228.608) * [-227.329] (-230.649) (-235.147) (-227.174) -- 0:00:49
      124000 -- (-226.359) (-226.357) (-227.257) [-226.493] * (-226.846) (-231.726) [-227.677] (-229.964) -- 0:00:49
      124500 -- (-234.120) (-227.992) [-229.486] (-227.772) * (-229.943) (-229.477) [-227.232] (-227.835) -- 0:00:49
      125000 -- (-227.331) (-228.201) (-225.914) [-226.194] * (-228.361) (-230.265) (-227.312) [-226.897] -- 0:00:49

      Average standard deviation of split frequencies: 0.020488

      125500 -- [-230.655] (-226.031) (-228.180) (-231.410) * [-228.133] (-226.243) (-229.806) (-233.192) -- 0:00:48
      126000 -- (-227.765) [-226.142] (-232.491) (-227.246) * [-227.039] (-226.736) (-228.000) (-227.587) -- 0:00:48
      126500 -- (-226.238) (-228.200) [-227.881] (-227.314) * (-228.849) [-225.531] (-226.612) (-228.535) -- 0:00:48
      127000 -- (-232.738) [-226.945] (-227.619) (-228.752) * (-225.925) (-229.275) (-229.072) [-227.558] -- 0:00:48
      127500 -- (-229.113) (-226.636) [-228.033] (-228.659) * [-228.134] (-226.828) (-226.448) (-227.478) -- 0:00:47
      128000 -- (-228.583) (-228.864) [-227.069] (-228.308) * (-227.620) (-225.551) (-226.487) [-226.600] -- 0:00:47
      128500 -- (-231.922) (-228.485) [-227.828] (-229.033) * (-227.771) (-228.081) [-228.054] (-228.971) -- 0:00:47
      129000 -- (-229.316) (-227.355) [-227.228] (-228.761) * [-234.034] (-226.691) (-228.738) (-226.350) -- 0:00:47
      129500 -- (-231.033) (-231.102) (-227.715) [-229.660] * (-227.854) (-229.201) [-226.296] (-228.349) -- 0:00:47
      130000 -- (-228.868) (-226.498) [-226.081] (-229.198) * (-228.849) [-226.155] (-230.221) (-235.533) -- 0:00:46

      Average standard deviation of split frequencies: 0.020959

      130500 -- (-227.042) (-230.265) [-228.377] (-228.776) * [-227.694] (-231.681) (-227.946) (-231.522) -- 0:00:46
      131000 -- (-227.209) (-228.729) (-229.303) [-227.743] * (-226.392) (-226.515) (-230.689) [-228.863] -- 0:00:46
      131500 -- (-226.324) (-228.747) [-226.908] (-227.230) * (-226.789) (-227.659) [-229.053] (-227.359) -- 0:00:46
      132000 -- (-231.281) [-231.835] (-227.556) (-229.814) * [-229.656] (-226.237) (-232.652) (-227.857) -- 0:00:46
      132500 -- (-228.608) [-225.841] (-227.306) (-227.389) * (-232.273) (-228.599) (-232.126) [-227.023] -- 0:00:45
      133000 -- (-227.716) (-226.373) [-228.763] (-227.900) * [-229.710] (-226.446) (-234.068) (-226.015) -- 0:00:45
      133500 -- [-229.360] (-228.051) (-232.320) (-227.897) * (-227.836) [-227.909] (-232.324) (-226.601) -- 0:00:45
      134000 -- (-230.427) [-227.650] (-229.267) (-227.002) * (-229.625) (-233.469) [-228.766] (-228.559) -- 0:00:45
      134500 -- (-227.401) [-229.073] (-226.377) (-227.933) * (-227.558) [-226.754] (-231.131) (-227.460) -- 0:00:45
      135000 -- [-228.696] (-226.651) (-230.504) (-228.633) * (-226.480) [-229.126] (-230.096) (-227.857) -- 0:00:44

      Average standard deviation of split frequencies: 0.021457

      135500 -- [-229.166] (-226.758) (-228.282) (-227.983) * [-225.967] (-229.091) (-229.532) (-226.366) -- 0:00:44
      136000 -- (-227.447) (-227.105) (-229.983) [-229.645] * [-226.516] (-230.278) (-233.199) (-226.374) -- 0:00:50
      136500 -- (-230.827) (-226.829) (-228.139) [-227.492] * [-226.639] (-228.975) (-231.894) (-227.843) -- 0:00:50
      137000 -- (-226.372) (-226.764) [-226.924] (-228.927) * (-226.623) (-227.480) [-230.927] (-228.010) -- 0:00:50
      137500 -- (-226.122) [-226.043] (-227.343) (-233.307) * (-227.497) [-227.239] (-228.299) (-232.157) -- 0:00:50
      138000 -- [-227.474] (-226.574) (-227.863) (-230.833) * (-227.140) (-229.815) (-230.740) [-231.508] -- 0:00:49
      138500 -- (-225.760) (-226.389) [-226.233] (-227.263) * (-227.830) (-228.557) [-226.187] (-227.186) -- 0:00:49
      139000 -- (-228.389) (-226.355) (-226.437) [-228.855] * (-227.426) (-230.827) [-226.491] (-228.011) -- 0:00:49
      139500 -- (-227.351) (-234.852) (-226.364) [-228.681] * (-230.834) (-230.013) (-226.143) [-227.130] -- 0:00:49
      140000 -- (-226.449) (-229.172) (-227.011) [-230.310] * (-228.828) (-225.612) [-227.958] (-228.016) -- 0:00:49

      Average standard deviation of split frequencies: 0.021615

      140500 -- [-226.849] (-228.005) (-226.940) (-228.836) * (-227.656) [-229.028] (-226.802) (-226.557) -- 0:00:48
      141000 -- (-226.881) (-229.099) (-228.128) [-227.904] * [-225.894] (-228.145) (-227.738) (-226.978) -- 0:00:48
      141500 -- (-231.235) [-226.249] (-226.767) (-228.795) * (-227.825) (-229.050) [-227.786] (-226.766) -- 0:00:48
      142000 -- (-227.923) (-229.856) (-227.393) [-227.444] * (-231.364) [-226.609] (-227.702) (-228.513) -- 0:00:48
      142500 -- [-227.331] (-226.256) (-226.725) (-228.938) * [-225.855] (-229.497) (-226.071) (-228.031) -- 0:00:48
      143000 -- [-226.445] (-227.222) (-228.183) (-230.382) * (-226.225) (-226.604) (-228.437) [-226.584] -- 0:00:47
      143500 -- (-226.101) (-226.552) (-228.153) [-227.902] * (-228.796) [-227.316] (-226.611) (-226.513) -- 0:00:47
      144000 -- (-227.056) (-230.499) [-226.408] (-226.516) * (-227.894) [-226.754] (-226.119) (-227.800) -- 0:00:47
      144500 -- (-230.631) (-227.140) [-227.351] (-227.686) * (-225.936) (-226.401) [-229.943] (-230.365) -- 0:00:47
      145000 -- (-228.149) (-227.901) (-229.776) [-228.987] * (-226.844) (-228.057) (-227.988) [-228.737] -- 0:00:47

      Average standard deviation of split frequencies: 0.021064

      145500 -- (-229.068) [-228.092] (-228.953) (-227.118) * (-229.040) (-226.869) [-226.991] (-230.247) -- 0:00:46
      146000 -- [-229.803] (-226.768) (-228.717) (-229.630) * (-228.017) (-231.913) [-230.374] (-230.550) -- 0:00:46
      146500 -- (-226.339) (-229.066) [-227.722] (-227.607) * (-228.334) (-230.445) (-226.246) [-230.827] -- 0:00:46
      147000 -- [-229.200] (-227.295) (-226.898) (-227.514) * [-227.689] (-227.392) (-225.637) (-230.509) -- 0:00:46
      147500 -- (-227.097) (-229.691) (-231.493) [-227.726] * [-228.247] (-229.089) (-227.268) (-228.350) -- 0:00:46
      148000 -- (-230.155) (-229.563) (-232.092) [-227.301] * (-230.003) [-231.586] (-226.203) (-230.838) -- 0:00:46
      148500 -- (-226.390) (-231.618) [-227.453] (-226.943) * (-227.771) (-228.875) (-227.501) [-234.290] -- 0:00:45
      149000 -- [-226.542] (-228.154) (-230.198) (-227.361) * (-227.433) (-226.489) (-229.980) [-228.419] -- 0:00:45
      149500 -- (-226.009) [-228.893] (-227.533) (-227.918) * (-229.575) [-228.765] (-229.446) (-228.246) -- 0:00:45
      150000 -- [-227.825] (-227.220) (-226.296) (-230.591) * (-231.804) (-227.332) [-226.752] (-227.217) -- 0:00:45

      Average standard deviation of split frequencies: 0.019711

      150500 -- [-228.614] (-228.098) (-228.344) (-227.471) * (-226.680) [-227.027] (-226.582) (-227.264) -- 0:00:45
      151000 -- (-226.121) (-226.729) [-228.700] (-227.828) * (-227.246) (-227.079) (-229.791) [-227.312] -- 0:00:44
      151500 -- (-226.960) (-233.161) (-228.929) [-226.378] * (-226.146) (-227.671) (-226.365) [-226.495] -- 0:00:50
      152000 -- (-231.241) (-225.949) [-225.996] (-226.804) * (-226.868) (-228.858) (-226.086) [-227.947] -- 0:00:50
      152500 -- (-230.126) (-225.634) (-228.997) [-226.352] * (-227.139) (-228.874) [-227.521] (-233.782) -- 0:00:50
      153000 -- (-226.501) (-227.217) (-227.078) [-230.142] * (-226.429) (-229.139) [-230.466] (-226.518) -- 0:00:49
      153500 -- [-226.342] (-230.217) (-228.282) (-228.846) * (-226.065) (-227.469) [-229.279] (-227.895) -- 0:00:49
      154000 -- (-226.991) [-227.075] (-227.483) (-230.311) * (-225.631) (-228.224) (-226.287) [-226.706] -- 0:00:49
      154500 -- [-225.748] (-225.721) (-227.831) (-227.132) * (-230.078) (-229.782) (-226.460) [-226.349] -- 0:00:49
      155000 -- (-228.898) [-227.070] (-228.816) (-227.872) * [-230.774] (-230.486) (-227.569) (-226.650) -- 0:00:49

      Average standard deviation of split frequencies: 0.020835

      155500 -- (-233.514) [-227.756] (-230.262) (-226.992) * (-228.251) (-227.075) (-226.368) [-230.531] -- 0:00:48
      156000 -- [-227.735] (-233.713) (-227.430) (-227.466) * (-229.660) (-228.713) [-225.905] (-231.559) -- 0:00:48
      156500 -- [-227.669] (-229.247) (-230.158) (-229.205) * (-226.664) (-228.098) [-229.852] (-233.380) -- 0:00:48
      157000 -- (-226.312) [-227.490] (-226.883) (-230.093) * (-226.541) [-226.453] (-229.078) (-227.204) -- 0:00:48
      157500 -- (-228.614) (-228.286) [-226.550] (-229.289) * (-229.086) (-227.551) [-228.150] (-227.393) -- 0:00:48
      158000 -- (-228.157) (-228.004) (-228.341) [-225.716] * (-237.124) [-225.636] (-228.065) (-227.960) -- 0:00:47
      158500 -- [-226.906] (-228.142) (-228.428) (-230.695) * (-226.689) [-226.338] (-227.712) (-227.347) -- 0:00:47
      159000 -- [-226.787] (-227.647) (-227.552) (-228.208) * (-227.731) (-227.950) [-229.273] (-227.469) -- 0:00:47
      159500 -- (-227.533) (-227.429) (-226.958) [-226.678] * (-225.951) (-227.774) (-232.056) [-226.089] -- 0:00:47
      160000 -- (-227.589) [-229.544] (-229.024) (-228.192) * [-228.130] (-227.799) (-228.957) (-227.598) -- 0:00:47

      Average standard deviation of split frequencies: 0.020847

      160500 -- (-228.253) (-228.903) [-227.077] (-229.555) * (-228.449) [-226.008] (-226.455) (-226.671) -- 0:00:47
      161000 -- (-226.483) [-227.117] (-227.681) (-230.518) * (-233.617) (-226.241) [-229.534] (-227.654) -- 0:00:46
      161500 -- (-226.658) [-227.146] (-226.200) (-227.764) * [-230.803] (-226.569) (-227.504) (-232.105) -- 0:00:46
      162000 -- (-225.909) (-228.571) [-226.833] (-227.981) * (-227.049) (-226.249) (-232.486) [-228.397] -- 0:00:46
      162500 -- (-229.055) [-227.279] (-228.904) (-227.941) * [-226.363] (-228.021) (-235.562) (-229.809) -- 0:00:46
      163000 -- [-227.211] (-228.820) (-232.926) (-230.044) * [-226.488] (-229.625) (-242.519) (-227.725) -- 0:00:46
      163500 -- (-229.116) (-228.170) (-230.184) [-229.906] * (-229.369) (-232.207) [-240.470] (-226.479) -- 0:00:46
      164000 -- (-227.385) [-226.743] (-227.967) (-230.595) * (-230.406) (-230.672) (-237.030) [-226.250] -- 0:00:45
      164500 -- (-228.894) (-228.753) (-226.289) [-230.451] * (-228.219) (-229.821) [-226.636] (-227.739) -- 0:00:45
      165000 -- (-227.340) (-226.768) (-226.697) [-227.657] * (-231.609) (-227.120) [-227.104] (-229.789) -- 0:00:45

      Average standard deviation of split frequencies: 0.019580

      165500 -- (-227.657) (-226.648) (-227.560) [-227.016] * [-226.767] (-227.318) (-227.701) (-226.541) -- 0:00:45
      166000 -- [-227.009] (-227.600) (-225.725) (-227.548) * (-227.529) [-226.932] (-232.025) (-226.241) -- 0:00:45
      166500 -- [-226.899] (-227.355) (-226.335) (-227.363) * (-227.326) (-226.927) (-232.058) [-226.554] -- 0:00:45
      167000 -- [-228.712] (-231.872) (-226.504) (-227.341) * [-227.638] (-229.357) (-229.451) (-226.672) -- 0:00:44
      167500 -- (-225.748) (-228.776) (-229.383) [-226.414] * (-226.428) (-230.165) [-228.245] (-229.265) -- 0:00:44
      168000 -- (-226.592) (-226.471) (-228.361) [-228.340] * (-233.768) (-226.727) [-227.607] (-228.221) -- 0:00:49
      168500 -- (-229.659) [-226.494] (-225.709) (-230.107) * (-226.992) (-227.614) [-227.468] (-228.428) -- 0:00:49
      169000 -- (-229.359) (-226.810) (-229.037) [-226.270] * (-229.541) (-228.286) (-228.435) [-225.804] -- 0:00:49
      169500 -- (-227.012) [-226.452] (-227.523) (-229.418) * (-231.376) (-228.936) (-230.765) [-227.502] -- 0:00:48
      170000 -- (-227.403) (-228.672) (-227.777) [-226.386] * (-227.887) (-227.259) (-228.168) [-226.871] -- 0:00:48

      Average standard deviation of split frequencies: 0.021806

      170500 -- (-228.496) (-232.759) [-227.050] (-227.026) * (-228.712) (-226.237) (-225.596) [-228.551] -- 0:00:48
      171000 -- [-232.098] (-227.582) (-225.606) (-229.678) * (-227.748) (-228.024) [-226.509] (-228.761) -- 0:00:48
      171500 -- (-226.494) (-227.928) (-227.993) [-228.639] * (-228.189) [-227.531] (-228.580) (-226.910) -- 0:00:48
      172000 -- [-229.295] (-231.536) (-226.102) (-235.894) * (-229.589) (-232.210) [-226.797] (-228.347) -- 0:00:48
      172500 -- (-230.584) [-229.853] (-229.231) (-230.698) * (-228.394) [-227.108] (-228.267) (-230.763) -- 0:00:47
      173000 -- (-233.051) [-227.470] (-230.486) (-226.943) * (-226.824) (-229.061) [-226.970] (-226.965) -- 0:00:47
      173500 -- (-226.478) (-230.919) [-227.819] (-227.823) * (-226.162) [-226.351] (-230.492) (-228.889) -- 0:00:47
      174000 -- (-225.518) (-227.957) (-228.339) [-226.378] * (-226.921) [-227.627] (-226.097) (-225.899) -- 0:00:47
      174500 -- (-226.933) (-225.721) [-230.571] (-228.528) * (-228.732) (-226.368) [-226.658] (-229.191) -- 0:00:47
      175000 -- (-227.322) (-227.911) (-230.316) [-229.701] * (-228.090) (-227.021) (-230.153) [-226.611] -- 0:00:47

      Average standard deviation of split frequencies: 0.020582

      175500 -- (-227.250) [-226.605] (-226.402) (-228.359) * (-230.600) (-232.908) [-229.655] (-228.334) -- 0:00:46
      176000 -- (-227.424) (-225.827) [-228.050] (-229.565) * (-226.969) (-232.008) [-226.030] (-229.789) -- 0:00:46
      176500 -- (-228.191) (-227.326) [-227.682] (-232.369) * (-226.314) (-227.006) [-226.789] (-228.105) -- 0:00:46
      177000 -- (-226.575) (-227.621) (-230.668) [-230.746] * (-228.869) (-226.136) [-226.332] (-226.729) -- 0:00:46
      177500 -- (-228.588) [-228.722] (-228.759) (-230.283) * (-228.171) (-227.334) (-228.252) [-226.167] -- 0:00:46
      178000 -- (-227.643) (-226.979) (-228.057) [-226.450] * (-227.262) (-227.828) (-227.253) [-228.403] -- 0:00:46
      178500 -- (-230.130) (-230.146) (-230.334) [-229.559] * [-227.481] (-227.050) (-227.187) (-226.705) -- 0:00:46
      179000 -- [-229.038] (-231.309) (-228.215) (-227.679) * (-228.347) (-226.364) [-228.670] (-230.341) -- 0:00:45
      179500 -- (-231.769) (-228.072) [-227.983] (-229.838) * (-226.020) (-226.772) (-227.318) [-227.534] -- 0:00:45
      180000 -- (-227.398) (-227.271) [-226.997] (-228.974) * (-226.276) (-228.434) (-226.902) [-226.990] -- 0:00:45

      Average standard deviation of split frequencies: 0.019913

      180500 -- (-226.580) [-226.113] (-228.044) (-231.084) * [-226.203] (-226.232) (-227.892) (-227.429) -- 0:00:45
      181000 -- (-226.616) [-227.546] (-227.159) (-230.776) * [-228.320] (-230.797) (-227.624) (-225.934) -- 0:00:45
      181500 -- [-228.581] (-228.092) (-228.712) (-226.295) * (-226.380) (-230.232) (-227.172) [-227.959] -- 0:00:45
      182000 -- (-228.838) [-226.378] (-230.254) (-226.611) * [-227.219] (-231.002) (-227.145) (-232.801) -- 0:00:44
      182500 -- [-226.760] (-226.328) (-227.053) (-226.386) * [-226.646] (-228.110) (-228.190) (-231.144) -- 0:00:44
      183000 -- (-228.275) [-229.070] (-225.882) (-227.159) * [-227.328] (-227.030) (-230.418) (-229.031) -- 0:00:44
      183500 -- (-230.644) (-228.819) [-227.038] (-228.957) * (-228.229) [-229.085] (-231.517) (-227.034) -- 0:00:48
      184000 -- (-225.934) [-226.866] (-227.668) (-229.471) * (-230.525) [-228.061] (-231.826) (-229.817) -- 0:00:48
      184500 -- (-229.789) (-226.502) [-227.815] (-231.536) * (-226.582) [-228.279] (-228.153) (-231.624) -- 0:00:48
      185000 -- (-228.100) (-229.895) (-226.180) [-227.237] * [-225.635] (-228.903) (-231.513) (-233.604) -- 0:00:48

      Average standard deviation of split frequencies: 0.018541

      185500 -- (-228.654) (-230.016) (-229.232) [-229.059] * (-229.293) (-226.847) [-230.297] (-226.486) -- 0:00:48
      186000 -- (-225.940) [-225.582] (-229.236) (-226.287) * [-228.932] (-229.074) (-230.224) (-227.763) -- 0:00:48
      186500 -- (-227.575) [-226.782] (-229.359) (-227.256) * (-227.696) (-226.422) [-228.770] (-228.147) -- 0:00:47
      187000 -- (-226.656) [-227.920] (-227.527) (-228.782) * (-231.434) [-230.910] (-227.772) (-228.492) -- 0:00:47
      187500 -- [-227.278] (-227.652) (-226.425) (-227.480) * (-228.300) [-226.714] (-227.126) (-227.740) -- 0:00:47
      188000 -- [-229.125] (-226.645) (-228.754) (-228.213) * (-229.739) (-230.678) [-228.725] (-228.414) -- 0:00:47
      188500 -- (-227.754) (-226.042) [-227.977] (-225.605) * (-228.322) (-230.326) [-226.714] (-231.937) -- 0:00:47
      189000 -- [-229.468] (-228.196) (-229.767) (-229.428) * [-227.174] (-227.434) (-228.707) (-225.995) -- 0:00:47
      189500 -- (-227.776) (-226.845) (-227.100) [-227.375] * (-227.114) [-227.931] (-229.557) (-228.033) -- 0:00:47
      190000 -- [-228.662] (-227.357) (-229.747) (-230.250) * (-227.735) (-230.024) (-228.027) [-228.262] -- 0:00:46

      Average standard deviation of split frequencies: 0.015521

      190500 -- (-227.482) (-227.222) (-226.593) [-230.402] * [-233.206] (-228.307) (-229.674) (-227.340) -- 0:00:46
      191000 -- (-233.946) (-225.719) [-227.002] (-227.421) * (-226.181) (-227.064) [-230.265] (-229.206) -- 0:00:46
      191500 -- (-228.414) (-228.709) (-228.847) [-227.624] * (-228.288) (-226.501) [-226.098] (-230.286) -- 0:00:46
      192000 -- [-228.321] (-227.030) (-233.408) (-228.608) * [-225.713] (-227.346) (-228.601) (-232.136) -- 0:00:46
      192500 -- (-229.470) [-228.265] (-225.673) (-230.194) * (-226.136) [-226.710] (-226.776) (-229.811) -- 0:00:46
      193000 -- (-229.850) [-227.827] (-227.016) (-227.186) * (-227.337) [-226.233] (-226.303) (-226.311) -- 0:00:45
      193500 -- (-229.233) (-234.980) [-229.810] (-227.179) * (-230.081) (-226.781) (-227.279) [-230.258] -- 0:00:45
      194000 -- [-230.244] (-226.952) (-226.505) (-229.766) * (-229.788) (-226.627) (-228.403) [-229.925] -- 0:00:45
      194500 -- (-227.568) (-226.998) [-226.522] (-233.455) * (-230.217) (-226.459) [-231.149] (-229.685) -- 0:00:45
      195000 -- [-227.617] (-227.636) (-227.562) (-225.642) * (-230.706) (-225.727) (-226.353) [-225.988] -- 0:00:45

      Average standard deviation of split frequencies: 0.015366

      195500 -- (-227.854) [-227.716] (-227.100) (-225.573) * (-226.313) [-228.004] (-225.859) (-226.184) -- 0:00:45
      196000 -- (-227.048) (-230.639) [-227.791] (-226.729) * [-226.764] (-229.220) (-227.370) (-226.089) -- 0:00:45
      196500 -- [-229.194] (-226.348) (-236.094) (-227.088) * (-226.601) (-226.155) (-228.101) [-227.649] -- 0:00:44
      197000 -- (-229.153) [-225.946] (-227.150) (-229.095) * [-228.744] (-226.868) (-227.194) (-227.380) -- 0:00:44
      197500 -- (-226.061) [-228.824] (-230.676) (-228.598) * [-226.221] (-228.167) (-226.481) (-228.844) -- 0:00:44
      198000 -- (-226.304) (-227.041) (-229.216) [-226.859] * (-227.795) (-230.548) [-226.893] (-228.382) -- 0:00:44
      198500 -- (-230.814) (-226.837) [-227.642] (-226.526) * [-226.811] (-229.007) (-227.691) (-229.567) -- 0:00:44
      199000 -- (-227.227) (-228.380) (-228.707) [-226.296] * (-226.588) (-226.283) (-228.813) [-228.723] -- 0:00:44
      199500 -- (-225.878) [-226.722] (-226.050) (-228.472) * (-228.186) (-227.676) [-228.676] (-227.147) -- 0:00:48
      200000 -- [-229.726] (-226.000) (-227.547) (-227.273) * [-226.417] (-231.703) (-226.701) (-228.868) -- 0:00:48

      Average standard deviation of split frequencies: 0.013834

      200500 -- [-229.413] (-226.531) (-227.378) (-226.937) * [-231.291] (-229.397) (-226.461) (-226.950) -- 0:00:47
      201000 -- (-228.846) (-226.491) [-229.188] (-233.576) * (-230.322) (-228.710) [-226.591] (-230.005) -- 0:00:47
      201500 -- [-228.875] (-228.569) (-226.076) (-226.114) * (-227.583) (-226.789) [-227.335] (-230.034) -- 0:00:47
      202000 -- (-228.361) (-227.655) [-226.079] (-228.742) * [-230.280] (-226.872) (-227.267) (-226.313) -- 0:00:47
      202500 -- [-226.736] (-230.602) (-227.602) (-226.107) * (-228.589) (-228.380) [-225.852] (-226.393) -- 0:00:47
      203000 -- (-228.389) (-230.388) [-227.364] (-227.121) * (-227.184) (-227.001) (-226.854) [-227.730] -- 0:00:47
      203500 -- [-227.095] (-234.500) (-227.765) (-226.839) * (-226.660) (-231.297) (-226.501) [-228.919] -- 0:00:46
      204000 -- (-227.821) (-232.987) (-227.734) [-225.645] * (-226.842) (-226.106) [-227.708] (-226.593) -- 0:00:46
      204500 -- (-227.791) [-233.091] (-231.876) (-227.721) * [-227.394] (-232.029) (-227.342) (-226.963) -- 0:00:46
      205000 -- (-227.797) (-229.669) (-229.881) [-227.361] * (-228.168) [-227.990] (-226.254) (-228.047) -- 0:00:46

      Average standard deviation of split frequencies: 0.013476

      205500 -- (-230.335) [-227.730] (-231.592) (-226.797) * (-226.774) [-226.829] (-226.698) (-226.125) -- 0:00:46
      206000 -- (-228.458) [-229.751] (-233.486) (-228.585) * (-226.576) (-229.007) (-226.428) [-227.006] -- 0:00:46
      206500 -- (-228.054) [-227.330] (-227.083) (-226.350) * (-229.421) (-228.333) [-226.893] (-226.390) -- 0:00:46
      207000 -- (-233.272) [-228.666] (-229.084) (-229.594) * (-228.131) (-229.891) [-226.263] (-227.176) -- 0:00:45
      207500 -- (-227.179) (-227.367) [-229.715] (-227.453) * (-227.453) (-228.444) (-228.013) [-226.940] -- 0:00:45
      208000 -- [-227.725] (-226.449) (-226.081) (-228.649) * (-229.940) [-227.712] (-229.474) (-226.323) -- 0:00:45
      208500 -- (-226.583) [-227.214] (-226.024) (-231.395) * (-227.835) (-227.342) [-227.879] (-226.377) -- 0:00:45
      209000 -- (-227.863) [-229.073] (-228.065) (-227.236) * [-226.274] (-226.291) (-228.378) (-229.226) -- 0:00:45
      209500 -- (-229.781) (-231.312) (-232.356) [-228.007] * (-225.865) [-226.908] (-229.341) (-228.764) -- 0:00:45
      210000 -- [-227.342] (-231.092) (-226.496) (-227.609) * (-227.943) [-227.748] (-227.721) (-231.563) -- 0:00:45

      Average standard deviation of split frequencies: 0.011561

      210500 -- (-231.015) (-227.357) (-229.466) [-229.966] * (-231.955) [-229.502] (-229.040) (-227.092) -- 0:00:45
      211000 -- (-228.477) (-229.285) [-227.721] (-227.639) * (-229.541) [-227.882] (-231.582) (-229.176) -- 0:00:44
      211500 -- (-230.546) (-232.333) (-227.545) [-226.626] * (-230.549) (-227.621) [-228.919] (-226.759) -- 0:00:44
      212000 -- (-232.042) (-227.259) (-228.691) [-226.695] * (-231.254) (-227.397) (-228.234) [-227.182] -- 0:00:44
      212500 -- (-232.180) (-228.913) [-227.741] (-227.978) * [-228.621] (-227.481) (-226.741) (-228.749) -- 0:00:44
      213000 -- (-234.892) [-228.804] (-226.662) (-227.656) * [-226.371] (-228.779) (-226.240) (-227.680) -- 0:00:44
      213500 -- [-228.644] (-226.442) (-227.507) (-228.721) * (-227.206) (-228.848) [-226.050] (-229.138) -- 0:00:44
      214000 -- [-226.305] (-228.249) (-227.049) (-226.567) * (-227.722) (-227.082) [-228.326] (-228.711) -- 0:00:44
      214500 -- (-230.134) [-230.268] (-228.422) (-227.642) * (-233.865) (-231.830) [-226.637] (-231.284) -- 0:00:43
      215000 -- (-226.654) [-232.514] (-227.293) (-227.369) * (-227.352) (-229.534) [-226.784] (-229.222) -- 0:00:47

      Average standard deviation of split frequencies: 0.009821

      215500 -- [-227.476] (-229.069) (-226.268) (-227.453) * (-226.868) (-230.480) (-227.851) [-226.991] -- 0:00:47
      216000 -- (-229.395) (-228.448) (-226.684) [-227.010] * (-234.116) (-226.359) [-227.831] (-232.206) -- 0:00:47
      216500 -- [-232.416] (-230.739) (-228.122) (-229.616) * (-235.976) (-225.882) (-226.350) [-226.879] -- 0:00:47
      217000 -- (-232.661) (-227.527) [-227.849] (-226.112) * (-226.272) (-228.606) (-228.150) [-226.305] -- 0:00:46
      217500 -- (-227.671) (-226.847) [-227.205] (-226.290) * (-226.479) (-226.599) [-230.125] (-227.343) -- 0:00:46
      218000 -- (-225.913) (-227.256) [-227.759] (-227.617) * (-226.344) [-232.006] (-228.467) (-228.708) -- 0:00:46
      218500 -- [-229.072] (-228.727) (-227.476) (-228.839) * (-227.321) (-226.660) [-229.297] (-230.644) -- 0:00:46
      219000 -- (-227.322) (-227.647) (-228.405) [-229.594] * [-227.109] (-225.638) (-228.034) (-229.971) -- 0:00:46
      219500 -- (-228.698) [-230.297] (-227.489) (-229.934) * (-228.108) (-225.555) [-227.670] (-233.632) -- 0:00:46
      220000 -- [-228.200] (-228.189) (-228.114) (-230.308) * [-226.879] (-226.484) (-228.536) (-227.836) -- 0:00:46

      Average standard deviation of split frequencies: 0.010948

      220500 -- (-227.213) (-229.088) (-227.102) [-226.396] * [-227.830] (-227.422) (-227.954) (-232.044) -- 0:00:45
      221000 -- (-228.203) (-227.644) [-229.042] (-230.314) * (-226.171) [-228.363] (-230.838) (-229.890) -- 0:00:45
      221500 -- (-231.157) (-226.730) (-227.868) [-231.354] * (-226.421) (-230.486) [-227.521] (-226.045) -- 0:00:45
      222000 -- (-228.972) [-228.272] (-226.302) (-226.756) * (-226.321) [-225.705] (-230.873) (-226.831) -- 0:00:45
      222500 -- (-228.198) [-229.212] (-228.117) (-227.217) * (-226.290) [-229.613] (-230.943) (-226.127) -- 0:00:45
      223000 -- (-227.742) (-232.059) (-227.352) [-226.409] * [-232.035] (-227.917) (-229.488) (-230.512) -- 0:00:45
      223500 -- (-227.298) (-228.218) [-227.357] (-233.359) * (-229.129) (-226.847) [-230.062] (-226.411) -- 0:00:45
      224000 -- (-230.737) (-229.581) (-227.435) [-230.598] * [-226.572] (-227.347) (-229.053) (-229.278) -- 0:00:45
      224500 -- (-226.770) (-226.397) [-226.011] (-229.184) * (-227.210) (-227.012) (-227.125) [-230.603] -- 0:00:44
      225000 -- (-228.239) [-227.883] (-226.585) (-228.447) * (-229.654) (-226.908) [-227.862] (-231.566) -- 0:00:44

      Average standard deviation of split frequencies: 0.010299

      225500 -- (-232.199) (-230.758) [-228.949] (-231.117) * [-228.408] (-225.982) (-227.003) (-229.658) -- 0:00:44
      226000 -- [-230.478] (-228.601) (-232.170) (-230.151) * (-227.893) (-227.320) (-228.375) [-228.119] -- 0:00:44
      226500 -- (-229.296) (-227.208) [-228.140] (-229.870) * [-227.416] (-227.950) (-228.452) (-226.736) -- 0:00:44
      227000 -- (-228.339) [-230.998] (-229.436) (-228.405) * (-231.042) [-229.609] (-227.198) (-226.436) -- 0:00:44
      227500 -- (-226.736) (-228.465) (-227.108) [-226.857] * (-229.101) (-232.199) (-226.448) [-226.677] -- 0:00:44
      228000 -- (-229.058) (-228.530) [-229.188] (-226.106) * (-226.916) [-228.728] (-227.194) (-230.430) -- 0:00:44
      228500 -- (-229.743) (-225.945) [-227.056] (-228.436) * (-227.036) (-228.279) [-227.596] (-232.888) -- 0:00:43
      229000 -- (-228.669) [-226.484] (-231.019) (-226.789) * (-228.964) [-226.061] (-226.653) (-226.948) -- 0:00:43
      229500 -- (-228.457) (-232.511) (-227.206) [-227.339] * (-228.934) (-226.799) [-227.137] (-230.272) -- 0:00:43
      230000 -- (-230.462) (-230.169) (-230.327) [-228.355] * (-229.148) (-226.533) [-225.902] (-229.146) -- 0:00:46

      Average standard deviation of split frequencies: 0.010091

      230500 -- [-228.002] (-228.499) (-228.445) (-229.891) * (-229.758) [-226.307] (-227.552) (-227.565) -- 0:00:46
      231000 -- (-228.809) (-227.264) (-229.024) [-228.484] * (-228.209) (-230.059) [-226.681] (-227.233) -- 0:00:46
      231500 -- (-226.941) [-226.152] (-227.222) (-228.006) * (-228.440) [-229.965] (-228.212) (-229.706) -- 0:00:46
      232000 -- [-226.311] (-231.330) (-226.279) (-228.680) * (-227.204) (-226.335) (-228.724) [-226.900] -- 0:00:46
      232500 -- (-227.834) (-228.136) (-232.023) [-227.681] * (-230.470) [-229.665] (-231.162) (-226.758) -- 0:00:46
      233000 -- (-227.890) [-227.906] (-230.883) (-228.730) * [-226.045] (-229.490) (-235.548) (-228.382) -- 0:00:46
      233500 -- [-229.637] (-227.042) (-226.617) (-229.549) * (-229.659) (-225.700) [-232.311] (-227.564) -- 0:00:45
      234000 -- (-226.333) (-228.411) [-228.280] (-226.684) * (-228.329) (-229.286) (-233.787) [-229.433] -- 0:00:45
      234500 -- [-226.835] (-227.290) (-228.463) (-228.258) * [-228.277] (-227.104) (-227.574) (-230.534) -- 0:00:45
      235000 -- [-226.137] (-226.809) (-226.871) (-226.722) * (-227.712) [-226.957] (-227.004) (-228.443) -- 0:00:45

      Average standard deviation of split frequencies: 0.010612

      235500 -- (-227.135) (-226.470) (-227.140) [-228.230] * (-228.953) [-229.187] (-227.682) (-227.265) -- 0:00:45
      236000 -- (-230.073) (-231.871) (-225.817) [-227.576] * [-228.303] (-229.427) (-230.462) (-228.303) -- 0:00:45
      236500 -- [-230.804] (-230.841) (-227.273) (-227.788) * (-227.377) (-227.714) (-234.743) [-227.893] -- 0:00:45
      237000 -- (-233.068) [-231.041] (-228.222) (-227.430) * (-226.899) (-226.317) [-226.410] (-228.471) -- 0:00:45
      237500 -- (-226.941) [-228.616] (-228.153) (-226.768) * (-226.628) (-226.134) (-229.861) [-226.275] -- 0:00:44
      238000 -- [-226.733] (-229.986) (-231.426) (-228.913) * [-228.005] (-226.566) (-228.666) (-228.950) -- 0:00:44
      238500 -- (-226.588) (-226.316) [-225.770] (-234.981) * (-226.085) [-226.657] (-226.290) (-225.995) -- 0:00:44
      239000 -- (-226.401) (-226.990) [-226.981] (-232.219) * (-226.754) [-226.040] (-227.751) (-230.647) -- 0:00:44
      239500 -- [-227.120] (-227.241) (-225.973) (-231.209) * (-225.937) (-227.418) [-226.159] (-233.245) -- 0:00:44
      240000 -- (-226.390) (-226.275) (-228.095) [-230.458] * (-225.976) [-228.802] (-225.942) (-228.323) -- 0:00:44

      Average standard deviation of split frequencies: 0.009916

      240500 -- (-229.309) [-227.721] (-226.484) (-228.165) * (-227.018) (-227.713) (-227.760) [-230.272] -- 0:00:44
      241000 -- (-228.247) (-230.671) (-229.557) [-226.934] * (-226.574) (-230.109) (-228.691) [-225.688] -- 0:00:44
      241500 -- [-230.894] (-227.907) (-226.569) (-225.867) * [-227.016] (-230.806) (-226.559) (-227.155) -- 0:00:43
      242000 -- (-227.104) (-230.076) [-226.920] (-229.531) * (-230.895) (-229.596) (-227.839) [-226.171] -- 0:00:43
      242500 -- [-225.962] (-226.818) (-226.517) (-229.158) * [-225.859] (-227.237) (-228.355) (-228.877) -- 0:00:43
      243000 -- [-225.783] (-229.818) (-226.771) (-226.296) * (-227.274) [-226.914] (-227.221) (-227.324) -- 0:00:43
      243500 -- (-227.960) (-228.307) (-230.289) [-228.154] * [-227.726] (-227.865) (-228.069) (-227.531) -- 0:00:43
      244000 -- (-227.968) (-228.116) (-227.938) [-227.605] * [-226.882] (-228.070) (-226.134) (-227.984) -- 0:00:43
      244500 -- (-227.138) (-231.913) (-229.012) [-229.611] * (-227.910) (-226.429) (-227.454) [-226.019] -- 0:00:46
      245000 -- [-227.861] (-234.720) (-228.367) (-227.912) * (-226.994) (-227.739) (-228.859) [-227.757] -- 0:00:46

      Average standard deviation of split frequencies: 0.011047

      245500 -- (-226.857) (-229.720) (-227.061) [-227.429] * (-227.843) (-228.169) [-229.400] (-227.725) -- 0:00:46
      246000 -- (-225.690) (-230.046) (-227.259) [-230.873] * [-229.302] (-227.155) (-227.277) (-231.092) -- 0:00:45
      246500 -- [-226.260] (-228.767) (-227.972) (-228.473) * [-227.060] (-229.450) (-226.410) (-227.115) -- 0:00:45
      247000 -- (-225.577) (-227.141) [-226.560] (-227.242) * (-226.381) (-229.012) (-226.759) [-227.777] -- 0:00:45
      247500 -- [-226.655] (-227.454) (-229.509) (-226.911) * (-226.303) (-226.675) (-226.422) [-228.583] -- 0:00:45
      248000 -- (-229.323) [-227.024] (-230.985) (-226.732) * (-226.617) (-229.738) (-229.230) [-229.756] -- 0:00:45
      248500 -- (-230.355) [-228.789] (-228.954) (-226.750) * (-226.133) (-229.754) [-226.077] (-229.118) -- 0:00:45
      249000 -- (-228.850) (-229.341) (-227.262) [-226.253] * [-226.791] (-227.745) (-226.743) (-228.095) -- 0:00:45
      249500 -- [-228.379] (-226.681) (-229.214) (-227.374) * (-228.670) (-229.979) [-227.744] (-230.112) -- 0:00:45
      250000 -- [-225.735] (-232.141) (-228.704) (-228.961) * (-227.374) (-228.824) [-226.485] (-232.879) -- 0:00:45

      Average standard deviation of split frequencies: 0.010952

      250500 -- (-226.869) [-226.773] (-231.955) (-226.815) * [-228.258] (-226.182) (-226.643) (-226.082) -- 0:00:44
      251000 -- (-226.591) (-229.840) [-232.659] (-229.206) * (-227.679) (-227.667) [-227.695] (-229.363) -- 0:00:44
      251500 -- [-226.609] (-229.490) (-229.098) (-228.269) * (-228.272) (-233.396) (-226.867) [-227.065] -- 0:00:44
      252000 -- (-227.900) (-232.630) (-228.536) [-226.685] * (-229.057) [-227.744] (-226.124) (-228.675) -- 0:00:44
      252500 -- (-226.562) [-230.889] (-229.962) (-229.439) * (-228.777) [-231.298] (-226.999) (-228.364) -- 0:00:44
      253000 -- (-226.521) [-226.171] (-226.095) (-228.300) * (-232.147) (-233.452) (-231.696) [-227.124] -- 0:00:44
      253500 -- (-226.216) (-227.349) [-226.566] (-228.776) * (-226.303) [-227.907] (-229.202) (-226.400) -- 0:00:44
      254000 -- [-226.806] (-227.976) (-227.620) (-225.562) * (-228.386) (-227.089) (-229.682) [-229.374] -- 0:00:44
      254500 -- [-225.546] (-229.058) (-226.802) (-226.735) * (-227.495) (-228.711) (-227.571) [-232.316] -- 0:00:43
      255000 -- (-228.411) (-227.318) (-227.973) [-226.726] * (-226.943) (-228.912) [-226.783] (-229.889) -- 0:00:43

      Average standard deviation of split frequencies: 0.010724

      255500 -- (-228.574) [-226.300] (-227.356) (-229.405) * (-230.359) [-227.067] (-226.905) (-231.072) -- 0:00:43
      256000 -- (-225.891) [-230.059] (-227.341) (-232.333) * (-225.516) (-226.487) (-226.892) [-226.601] -- 0:00:43
      256500 -- [-226.813] (-227.311) (-226.821) (-229.748) * (-227.355) (-226.991) (-229.939) [-227.051] -- 0:00:43
      257000 -- (-228.289) [-231.339] (-227.405) (-227.484) * (-225.761) (-227.095) (-229.138) [-226.533] -- 0:00:43
      257500 -- (-232.432) (-229.962) (-228.772) [-226.848] * (-226.222) (-228.029) (-226.711) [-229.074] -- 0:00:43
      258000 -- (-230.696) (-230.115) [-227.069] (-228.843) * (-227.421) (-229.099) [-228.161] (-226.714) -- 0:00:43
      258500 -- (-226.784) (-227.830) (-230.366) [-227.051] * (-227.867) (-228.465) [-228.868] (-228.865) -- 0:00:45
      259000 -- (-227.958) [-227.989] (-228.642) (-227.269) * (-228.305) [-231.771] (-231.421) (-228.015) -- 0:00:45
      259500 -- (-226.603) (-225.927) (-231.186) [-228.182] * (-226.845) (-231.902) [-230.645] (-229.151) -- 0:00:45
      260000 -- (-227.488) [-225.878] (-226.690) (-229.251) * (-229.202) (-230.884) (-228.748) [-227.324] -- 0:00:45

      Average standard deviation of split frequencies: 0.010638

      260500 -- (-226.528) (-226.386) (-225.994) [-229.540] * (-228.550) (-228.641) (-228.127) [-230.765] -- 0:00:45
      261000 -- (-226.349) [-227.122] (-227.462) (-229.728) * (-227.937) (-227.942) [-228.372] (-229.657) -- 0:00:45
      261500 -- (-226.308) (-226.949) [-227.370] (-227.913) * [-226.661] (-228.324) (-231.235) (-231.505) -- 0:00:45
      262000 -- (-227.511) (-230.101) (-227.810) [-227.017] * (-227.322) [-230.390] (-228.382) (-228.242) -- 0:00:45
      262500 -- (-229.486) (-228.459) [-230.272] (-231.777) * (-229.852) (-230.704) [-229.105] (-226.942) -- 0:00:44
      263000 -- (-227.688) (-227.055) [-227.891] (-228.776) * (-228.367) (-229.620) [-230.111] (-228.315) -- 0:00:44
      263500 -- (-227.924) [-227.249] (-227.625) (-227.502) * (-228.991) (-227.347) (-231.952) [-226.790] -- 0:00:44
      264000 -- (-227.407) (-227.211) (-226.430) [-227.090] * (-227.298) (-228.679) (-231.989) [-230.358] -- 0:00:44
      264500 -- (-227.392) [-226.777] (-225.565) (-227.755) * (-226.814) [-226.875] (-229.733) (-225.653) -- 0:00:44
      265000 -- (-227.898) (-227.265) [-227.545] (-227.655) * (-226.749) (-228.076) (-229.301) [-226.827] -- 0:00:44

      Average standard deviation of split frequencies: 0.008965

      265500 -- (-228.049) [-227.968] (-229.388) (-230.222) * (-228.661) [-226.689] (-229.390) (-230.312) -- 0:00:44
      266000 -- [-228.179] (-228.161) (-229.314) (-228.056) * [-226.683] (-226.280) (-228.775) (-226.452) -- 0:00:44
      266500 -- [-228.789] (-228.424) (-226.760) (-227.917) * [-228.083] (-228.575) (-236.863) (-226.353) -- 0:00:44
      267000 -- (-233.791) (-228.569) [-228.665] (-227.870) * [-228.553] (-227.253) (-233.825) (-227.296) -- 0:00:43
      267500 -- (-227.181) (-228.700) (-226.684) [-228.976] * (-228.320) [-228.997] (-236.108) (-226.824) -- 0:00:43
      268000 -- (-227.096) (-227.282) [-230.555] (-228.590) * (-225.837) (-227.574) [-225.682] (-231.023) -- 0:00:43
      268500 -- (-227.201) [-227.149] (-231.127) (-232.241) * (-228.049) (-229.465) [-228.049] (-229.295) -- 0:00:43
      269000 -- (-228.339) (-228.100) (-229.675) [-231.212] * [-226.956] (-227.975) (-227.508) (-231.064) -- 0:00:43
      269500 -- (-231.213) [-229.025] (-226.188) (-228.651) * (-228.836) [-229.393] (-229.704) (-229.787) -- 0:00:43
      270000 -- (-227.970) (-226.502) [-231.193] (-227.459) * (-226.933) [-226.575] (-227.538) (-229.387) -- 0:00:43

      Average standard deviation of split frequencies: 0.009733

      270500 -- (-226.094) [-226.735] (-230.658) (-228.077) * (-228.409) [-226.218] (-226.599) (-226.834) -- 0:00:43
      271000 -- [-226.936] (-227.987) (-229.111) (-227.339) * (-227.883) [-228.155] (-228.115) (-227.899) -- 0:00:43
      271500 -- [-227.410] (-225.827) (-228.170) (-230.308) * (-228.137) (-227.413) (-228.279) [-227.058] -- 0:00:42
      272000 -- (-232.707) (-230.897) [-227.693] (-228.810) * (-227.635) (-226.773) (-227.076) [-228.919] -- 0:00:42
      272500 -- [-232.487] (-227.330) (-226.581) (-228.026) * [-228.108] (-228.705) (-226.478) (-233.521) -- 0:00:42
      273000 -- (-228.463) (-227.625) [-228.748] (-225.856) * [-228.019] (-229.290) (-227.351) (-226.733) -- 0:00:42
      273500 -- (-225.912) (-233.621) [-226.751] (-227.131) * (-227.252) (-234.246) (-230.440) [-227.498] -- 0:00:45
      274000 -- (-227.197) (-228.463) (-233.482) [-227.477] * (-229.794) (-227.319) (-229.314) [-227.556] -- 0:00:45
      274500 -- [-226.297] (-227.735) (-229.599) (-227.000) * (-231.926) [-227.350] (-226.840) (-228.407) -- 0:00:44
      275000 -- (-230.317) [-229.108] (-225.521) (-225.940) * (-228.670) (-229.832) (-226.710) [-226.470] -- 0:00:44

      Average standard deviation of split frequencies: 0.010248

      275500 -- [-229.269] (-226.728) (-227.694) (-228.766) * (-226.480) [-231.084] (-228.999) (-228.989) -- 0:00:44
      276000 -- (-229.487) (-228.863) (-228.717) [-226.550] * (-226.618) (-228.725) [-226.984] (-227.262) -- 0:00:44
      276500 -- [-226.179] (-231.240) (-230.838) (-227.275) * [-226.645] (-226.369) (-227.663) (-227.724) -- 0:00:44
      277000 -- (-229.358) (-225.707) (-230.590) [-229.118] * (-232.399) (-229.372) (-227.398) [-230.640] -- 0:00:44
      277500 -- (-231.199) (-230.180) (-230.627) [-226.688] * (-227.291) (-226.703) [-228.625] (-228.839) -- 0:00:44
      278000 -- (-230.822) (-228.763) (-226.603) [-228.757] * (-226.022) (-227.835) (-226.736) [-227.231] -- 0:00:44
      278500 -- (-229.327) (-231.247) (-227.118) [-226.928] * (-228.106) (-228.034) [-227.249] (-226.666) -- 0:00:44
      279000 -- (-229.911) (-229.849) (-227.002) [-227.037] * (-226.716) (-229.942) (-227.160) [-229.854] -- 0:00:43
      279500 -- (-229.378) [-227.673] (-227.394) (-225.825) * [-226.038] (-227.766) (-233.446) (-227.860) -- 0:00:43
      280000 -- (-226.308) [-226.609] (-225.884) (-229.659) * (-228.185) [-229.934] (-228.078) (-227.055) -- 0:00:43

      Average standard deviation of split frequencies: 0.009287

      280500 -- (-228.596) [-227.670] (-227.428) (-226.336) * (-228.751) (-226.750) (-228.820) [-229.615] -- 0:00:43
      281000 -- (-235.678) (-226.949) [-230.045] (-226.501) * (-226.282) (-226.181) (-226.937) [-226.306] -- 0:00:43
      281500 -- (-228.551) (-226.450) (-226.712) [-227.031] * (-226.785) [-228.242] (-227.850) (-228.771) -- 0:00:43
      282000 -- (-228.909) (-227.821) [-229.091] (-227.929) * (-226.779) [-226.949] (-226.491) (-227.705) -- 0:00:43
      282500 -- (-225.865) [-227.450] (-226.160) (-230.326) * (-227.374) (-227.296) (-228.543) [-228.273] -- 0:00:43
      283000 -- [-233.131] (-226.365) (-229.361) (-233.005) * [-229.533] (-228.487) (-227.300) (-225.610) -- 0:00:43
      283500 -- (-227.489) [-227.893] (-227.203) (-227.836) * (-227.503) [-227.153] (-228.945) (-227.460) -- 0:00:42
      284000 -- (-226.929) (-229.450) [-227.134] (-226.851) * (-228.465) (-226.154) [-229.442] (-226.166) -- 0:00:42
      284500 -- (-228.187) (-226.892) (-226.876) [-226.856] * (-228.260) (-226.301) (-226.108) [-228.400] -- 0:00:42
      285000 -- [-227.479] (-227.125) (-225.641) (-228.670) * [-227.562] (-226.476) (-227.139) (-227.321) -- 0:00:42

      Average standard deviation of split frequencies: 0.009696

      285500 -- (-229.150) (-229.734) [-226.235] (-227.824) * (-227.781) (-227.532) [-227.364] (-226.870) -- 0:00:42
      286000 -- [-226.898] (-228.782) (-231.165) (-229.634) * [-229.420] (-225.972) (-226.256) (-226.606) -- 0:00:42
      286500 -- (-227.541) (-227.798) (-228.831) [-226.935] * (-228.679) [-227.075] (-228.949) (-230.834) -- 0:00:42
      287000 -- (-229.366) (-227.947) [-226.802] (-228.830) * (-228.487) [-226.600] (-230.029) (-230.863) -- 0:00:42
      287500 -- [-230.344] (-227.339) (-226.175) (-226.313) * (-226.762) [-231.939] (-229.229) (-230.502) -- 0:00:42
      288000 -- (-233.027) [-229.256] (-229.882) (-225.840) * (-228.998) [-227.234] (-226.740) (-229.029) -- 0:00:44
      288500 -- [-229.647] (-228.545) (-228.596) (-227.845) * (-229.173) (-226.250) [-227.483] (-226.617) -- 0:00:44
      289000 -- (-227.701) (-230.369) [-231.009] (-226.212) * (-228.172) [-227.539] (-229.380) (-228.323) -- 0:00:44
      289500 -- (-226.916) (-227.053) (-230.641) [-227.076] * (-230.447) (-227.453) [-229.338] (-231.895) -- 0:00:44
      290000 -- (-226.814) [-227.312] (-231.319) (-227.505) * [-229.166] (-228.195) (-226.540) (-226.674) -- 0:00:44

      Average standard deviation of split frequencies: 0.009540

      290500 -- (-226.674) (-227.237) (-228.079) [-228.577] * (-228.857) (-230.349) [-228.139] (-228.379) -- 0:00:43
      291000 -- (-228.328) (-228.238) [-230.935] (-229.277) * (-226.853) [-228.947] (-227.559) (-225.893) -- 0:00:43
      291500 -- (-234.955) (-227.884) [-226.107] (-228.506) * [-226.838] (-229.723) (-225.957) (-227.322) -- 0:00:43
      292000 -- (-227.584) [-225.910] (-226.428) (-232.668) * (-231.693) (-226.500) [-228.548] (-229.301) -- 0:00:43
      292500 -- (-228.906) (-227.827) (-226.693) [-231.441] * (-230.949) (-226.676) [-227.042] (-226.494) -- 0:00:43
      293000 -- (-225.515) (-231.530) [-226.984] (-230.581) * (-226.289) (-228.440) (-227.269) [-226.292] -- 0:00:43
      293500 -- (-231.139) [-230.389] (-229.145) (-229.009) * (-230.611) [-230.432] (-227.955) (-225.893) -- 0:00:43
      294000 -- (-229.210) [-228.102] (-231.021) (-227.194) * (-231.400) (-229.243) [-227.509] (-228.070) -- 0:00:43
      294500 -- (-228.825) (-228.707) [-229.419] (-226.685) * (-230.516) (-228.521) [-227.479] (-226.247) -- 0:00:43
      295000 -- (-226.118) (-230.548) (-231.268) [-227.476] * (-226.279) (-226.481) (-227.165) [-226.006] -- 0:00:43

      Average standard deviation of split frequencies: 0.009555

      295500 -- (-228.223) [-232.425] (-226.763) (-226.992) * [-226.647] (-229.330) (-231.269) (-226.366) -- 0:00:42
      296000 -- (-228.327) [-229.364] (-226.745) (-227.042) * (-228.375) (-226.342) (-229.348) [-229.913] -- 0:00:42
      296500 -- (-230.474) (-230.940) (-226.532) [-226.733] * (-229.071) (-228.297) [-226.681] (-228.205) -- 0:00:42
      297000 -- (-228.838) [-227.368] (-227.401) (-230.666) * (-226.388) (-228.110) [-228.996] (-227.865) -- 0:00:42
      297500 -- (-227.648) (-226.798) [-228.070] (-228.464) * [-225.763] (-228.436) (-227.401) (-226.850) -- 0:00:42
      298000 -- (-228.486) (-227.096) (-228.422) [-226.232] * (-228.795) [-228.523] (-228.659) (-228.287) -- 0:00:42
      298500 -- [-226.522] (-234.618) (-229.499) (-227.551) * (-229.866) (-227.534) [-226.795] (-228.568) -- 0:00:42
      299000 -- [-227.966] (-230.149) (-230.653) (-226.305) * (-229.125) (-230.102) [-227.306] (-228.120) -- 0:00:42
      299500 -- (-231.644) (-227.996) (-235.527) [-225.813] * (-229.720) [-228.190] (-227.812) (-228.064) -- 0:00:42
      300000 -- (-231.184) [-227.820] (-235.324) (-228.025) * (-228.972) (-226.989) [-227.952] (-230.665) -- 0:00:42

      Average standard deviation of split frequencies: 0.009499

      300500 -- [-230.271] (-229.515) (-229.071) (-226.760) * (-227.315) (-226.167) (-228.850) [-227.059] -- 0:00:41
      301000 -- (-228.346) [-227.725] (-228.824) (-225.868) * [-228.312] (-228.982) (-231.491) (-228.327) -- 0:00:41
      301500 -- (-228.443) (-226.337) [-227.103] (-226.457) * [-228.193] (-226.238) (-228.094) (-231.661) -- 0:00:41
      302000 -- [-227.071] (-227.298) (-229.269) (-227.375) * (-226.807) [-227.477] (-229.050) (-227.021) -- 0:00:41
      302500 -- (-228.044) (-229.245) [-226.699] (-226.460) * [-227.069] (-226.879) (-227.613) (-227.548) -- 0:00:41
      303000 -- [-226.031] (-228.055) (-229.742) (-230.340) * (-227.102) [-227.844] (-229.112) (-228.697) -- 0:00:41
      303500 -- (-227.441) (-228.665) (-227.303) [-228.041] * (-226.869) [-226.852] (-227.508) (-227.964) -- 0:00:41
      304000 -- (-226.020) [-227.395] (-226.246) (-226.332) * [-228.731] (-230.785) (-228.256) (-237.195) -- 0:00:43
      304500 -- (-227.814) (-232.423) (-227.997) [-227.510] * (-228.272) [-227.646] (-229.008) (-231.074) -- 0:00:43
      305000 -- (-228.037) [-229.230] (-227.524) (-226.588) * (-227.193) (-226.198) (-228.015) [-227.457] -- 0:00:43

      Average standard deviation of split frequencies: 0.009787

      305500 -- (-227.512) (-227.648) (-230.380) [-234.466] * [-227.405] (-225.590) (-227.333) (-229.817) -- 0:00:43
      306000 -- (-227.305) (-226.322) [-226.076] (-231.706) * (-226.551) (-231.676) (-227.849) [-231.492] -- 0:00:43
      306500 -- (-227.930) [-228.481] (-225.988) (-233.234) * (-226.695) (-228.901) [-228.925] (-228.533) -- 0:00:42
      307000 -- (-228.800) [-226.531] (-228.864) (-231.373) * [-228.461] (-230.614) (-227.327) (-231.010) -- 0:00:42
      307500 -- [-227.775] (-232.557) (-228.761) (-228.486) * (-227.498) [-227.404] (-227.938) (-226.439) -- 0:00:42
      308000 -- (-231.447) (-228.753) [-227.169] (-227.806) * (-228.231) (-226.788) (-227.640) [-227.805] -- 0:00:42
      308500 -- (-235.245) (-234.572) [-228.963] (-230.735) * [-228.522] (-226.297) (-227.741) (-226.415) -- 0:00:42
      309000 -- [-228.537] (-228.095) (-230.797) (-229.520) * (-228.168) (-227.677) [-227.281] (-226.764) -- 0:00:42
      309500 -- (-226.198) (-227.220) (-228.897) [-228.967] * (-226.527) [-230.422] (-230.079) (-228.743) -- 0:00:42
      310000 -- (-226.887) (-230.712) [-226.169] (-231.160) * (-229.139) (-227.800) (-229.841) [-229.019] -- 0:00:42

      Average standard deviation of split frequencies: 0.010622

      310500 -- (-227.293) (-228.137) (-229.989) [-227.820] * (-227.210) [-229.835] (-227.870) (-229.470) -- 0:00:42
      311000 -- (-228.787) (-228.570) [-229.200] (-227.954) * (-227.540) (-228.529) [-227.233] (-226.236) -- 0:00:42
      311500 -- [-227.667] (-228.733) (-227.656) (-231.113) * [-226.998] (-225.792) (-230.064) (-227.661) -- 0:00:41
      312000 -- (-227.506) (-226.339) (-227.033) [-225.658] * (-228.288) [-228.434] (-233.085) (-230.617) -- 0:00:41
      312500 -- (-229.314) (-226.969) [-229.065] (-227.031) * [-230.191] (-228.014) (-229.142) (-226.202) -- 0:00:41
      313000 -- (-228.034) [-225.617] (-232.153) (-230.322) * (-228.829) (-230.659) [-229.449] (-227.701) -- 0:00:41
      313500 -- (-227.989) [-226.868] (-226.632) (-227.609) * [-227.742] (-226.716) (-231.123) (-227.415) -- 0:00:41
      314000 -- (-226.860) (-228.596) (-226.110) [-228.409] * (-227.281) [-225.819] (-225.955) (-226.310) -- 0:00:41
      314500 -- [-228.405] (-227.133) (-226.348) (-229.267) * (-229.261) (-227.742) (-227.148) [-226.214] -- 0:00:41
      315000 -- [-227.467] (-226.990) (-226.986) (-227.335) * [-228.590] (-227.476) (-227.285) (-230.695) -- 0:00:41

      Average standard deviation of split frequencies: 0.011408

      315500 -- (-228.225) (-226.491) [-226.770] (-228.627) * (-228.504) (-227.831) (-231.876) [-229.195] -- 0:00:41
      316000 -- (-227.522) (-226.083) (-233.490) [-229.056] * [-226.564] (-228.694) (-226.596) (-228.659) -- 0:00:41
      316500 -- (-228.597) (-226.267) [-231.914] (-229.580) * (-226.872) (-226.797) (-226.918) [-228.841] -- 0:00:41
      317000 -- [-228.884] (-227.391) (-228.265) (-228.915) * [-229.133] (-229.989) (-230.558) (-227.257) -- 0:00:40
      317500 -- (-227.042) (-229.187) (-226.396) [-227.744] * (-227.421) (-230.149) [-227.731] (-231.966) -- 0:00:40
      318000 -- (-229.103) (-227.509) (-228.167) [-231.621] * (-225.614) (-226.859) [-227.467] (-230.283) -- 0:00:42
      318500 -- (-227.932) (-229.528) [-229.240] (-227.226) * (-228.495) (-226.910) [-226.649] (-230.452) -- 0:00:42
      319000 -- (-229.777) (-228.887) [-226.034] (-226.344) * (-227.490) (-226.496) (-229.538) [-229.074] -- 0:00:42
      319500 -- (-233.840) [-226.847] (-226.914) (-226.432) * [-226.967] (-226.521) (-230.549) (-230.625) -- 0:00:42
      320000 -- (-230.410) (-230.692) [-227.820] (-226.749) * [-226.320] (-229.141) (-229.842) (-229.937) -- 0:00:42

      Average standard deviation of split frequencies: 0.010982

      320500 -- (-227.784) (-230.048) (-227.926) [-227.158] * [-227.196] (-228.355) (-228.545) (-226.356) -- 0:00:42
      321000 -- (-229.307) (-230.059) (-231.532) [-228.534] * (-226.022) (-228.880) (-239.149) [-227.203] -- 0:00:42
      321500 -- (-229.831) (-229.159) (-230.964) [-227.326] * (-229.456) (-228.799) [-227.148] (-228.496) -- 0:00:42
      322000 -- (-228.003) (-226.724) (-228.950) [-226.593] * (-229.913) [-233.797] (-226.333) (-225.844) -- 0:00:42
      322500 -- [-228.352] (-227.361) (-227.072) (-230.026) * (-227.143) [-226.366] (-226.122) (-227.214) -- 0:00:42
      323000 -- (-229.651) [-225.900] (-229.982) (-228.659) * (-227.335) (-226.247) (-226.923) [-231.036] -- 0:00:41
      323500 -- [-230.861] (-226.690) (-228.840) (-227.574) * (-226.662) [-226.500] (-228.432) (-226.592) -- 0:00:41
      324000 -- (-225.860) (-226.330) (-228.792) [-226.602] * (-228.388) [-228.414] (-226.275) (-228.738) -- 0:00:41
      324500 -- [-228.379] (-228.512) (-226.420) (-227.272) * [-227.793] (-232.533) (-228.986) (-227.857) -- 0:00:41
      325000 -- (-227.447) (-231.093) [-226.228] (-229.739) * (-229.963) (-228.382) [-225.832] (-226.392) -- 0:00:41

      Average standard deviation of split frequencies: 0.011143

      325500 -- (-228.073) (-227.123) (-226.662) [-229.519] * (-227.590) (-227.861) [-226.532] (-226.396) -- 0:00:41
      326000 -- [-226.771] (-227.011) (-226.461) (-227.611) * (-230.274) (-229.136) (-227.922) [-227.673] -- 0:00:41
      326500 -- (-228.512) (-226.172) [-225.871] (-227.256) * (-228.511) (-228.856) [-228.364] (-228.396) -- 0:00:41
      327000 -- (-226.362) [-228.016] (-228.827) (-228.015) * [-227.180] (-227.760) (-227.960) (-228.634) -- 0:00:41
      327500 -- (-228.740) (-228.361) [-227.079] (-225.948) * (-226.663) (-229.660) [-226.682] (-227.786) -- 0:00:41
      328000 -- [-226.722] (-235.309) (-229.587) (-227.073) * (-228.531) [-227.374] (-227.717) (-226.269) -- 0:00:40
      328500 -- (-229.604) (-229.307) [-226.374] (-226.367) * (-227.634) (-228.658) [-229.248] (-229.049) -- 0:00:40
      329000 -- [-226.912] (-228.108) (-228.154) (-226.468) * [-226.870] (-228.404) (-228.235) (-226.642) -- 0:00:42
      329500 -- (-228.902) (-229.015) (-227.217) [-225.911] * [-227.488] (-229.224) (-227.452) (-228.677) -- 0:00:42
      330000 -- (-230.816) (-226.711) (-228.410) [-225.587] * (-225.899) (-226.378) [-226.953] (-228.399) -- 0:00:42

      Average standard deviation of split frequencies: 0.011908

      330500 -- (-227.733) [-231.999] (-226.445) (-230.427) * (-226.658) [-226.181] (-232.446) (-226.592) -- 0:00:42
      331000 -- (-226.699) [-225.927] (-228.662) (-230.738) * (-226.915) (-227.351) [-231.618] (-227.213) -- 0:00:42
      331500 -- [-228.146] (-227.415) (-229.912) (-226.367) * [-228.344] (-229.082) (-227.084) (-227.983) -- 0:00:42
      332000 -- (-229.236) [-229.603] (-230.144) (-228.564) * (-226.186) (-228.709) [-227.697] (-228.433) -- 0:00:42
      332500 -- [-227.257] (-229.568) (-227.944) (-229.834) * [-227.097] (-226.729) (-228.424) (-230.794) -- 0:00:42
      333000 -- (-228.037) (-230.788) (-226.261) [-227.893] * (-226.139) (-227.923) (-227.661) [-227.489] -- 0:00:42
      333500 -- [-229.007] (-229.720) (-226.558) (-228.946) * (-228.737) [-227.939] (-239.179) (-227.050) -- 0:00:41
      334000 -- (-226.401) (-227.778) [-229.196] (-225.770) * [-229.128] (-229.245) (-229.918) (-230.843) -- 0:00:41
      334500 -- (-228.806) (-228.405) (-229.494) [-232.303] * (-231.828) (-228.827) (-228.088) [-226.648] -- 0:00:41
      335000 -- (-228.877) (-227.757) (-226.102) [-229.446] * (-231.752) (-228.068) [-226.608] (-227.241) -- 0:00:41

      Average standard deviation of split frequencies: 0.010564

      335500 -- (-228.019) [-227.236] (-229.561) (-226.728) * [-226.225] (-229.722) (-227.429) (-226.296) -- 0:00:41
      336000 -- (-228.104) (-229.021) (-228.624) [-227.396] * (-226.761) (-228.512) [-228.497] (-226.332) -- 0:00:41
      336500 -- (-228.027) [-228.137] (-235.861) (-227.055) * (-227.289) [-228.062] (-226.826) (-227.511) -- 0:00:41
      337000 -- (-226.804) [-232.259] (-226.982) (-227.139) * [-227.659] (-228.099) (-226.898) (-229.235) -- 0:00:41
      337500 -- (-229.031) (-228.869) [-226.330] (-226.902) * (-231.337) (-234.097) [-226.801] (-230.076) -- 0:00:41
      338000 -- [-228.676] (-228.043) (-228.526) (-228.932) * (-226.619) (-226.456) [-227.806] (-226.818) -- 0:00:41
      338500 -- (-227.764) [-227.113] (-227.116) (-231.763) * (-227.872) (-226.563) (-228.270) [-226.498] -- 0:00:41
      339000 -- [-229.354] (-228.064) (-226.345) (-233.859) * (-227.586) (-229.233) [-230.989] (-229.988) -- 0:00:40
      339500 -- [-225.949] (-227.811) (-226.256) (-226.441) * (-231.401) [-226.465] (-226.578) (-227.512) -- 0:00:40
      340000 -- [-227.376] (-226.467) (-229.651) (-228.398) * (-230.629) [-229.643] (-228.643) (-231.483) -- 0:00:40

      Average standard deviation of split frequencies: 0.011477

      340500 -- (-226.636) [-226.628] (-228.532) (-228.360) * (-227.782) (-227.403) (-226.452) [-226.539] -- 0:00:40
      341000 -- [-226.936] (-227.901) (-226.942) (-228.570) * (-230.996) (-230.168) (-231.730) [-225.927] -- 0:00:42
      341500 -- (-228.387) (-226.131) (-227.546) [-226.752] * [-226.456] (-229.037) (-227.179) (-226.214) -- 0:00:42
      342000 -- (-228.303) [-225.719] (-226.746) (-226.545) * [-225.930] (-229.682) (-229.365) (-226.529) -- 0:00:42
      342500 -- [-227.086] (-226.748) (-227.237) (-230.053) * (-235.515) (-227.246) [-226.878] (-227.752) -- 0:00:42
      343000 -- (-226.959) [-229.548] (-230.028) (-227.328) * (-227.160) [-226.589] (-227.367) (-227.878) -- 0:00:42
      343500 -- (-229.334) (-230.449) (-230.282) [-227.035] * (-225.665) (-228.365) [-229.988] (-227.221) -- 0:00:42
      344000 -- [-226.278] (-227.059) (-228.865) (-231.249) * (-228.874) (-225.739) (-227.474) [-228.742] -- 0:00:41
      344500 -- (-227.033) (-232.262) [-227.764] (-233.346) * [-226.639] (-226.716) (-231.475) (-226.273) -- 0:00:41
      345000 -- (-232.998) (-228.903) [-226.905] (-228.687) * (-227.778) [-226.033] (-229.182) (-226.022) -- 0:00:41

      Average standard deviation of split frequencies: 0.011051

      345500 -- (-228.732) (-227.853) (-227.653) [-229.213] * (-226.856) [-230.272] (-228.508) (-227.342) -- 0:00:41
      346000 -- [-227.427] (-232.713) (-229.451) (-228.599) * (-227.166) [-228.875] (-229.927) (-228.087) -- 0:00:41
      346500 -- (-229.397) (-231.058) (-228.092) [-228.124] * (-226.852) (-230.468) (-228.494) [-226.177] -- 0:00:41
      347000 -- (-231.507) [-229.489] (-232.510) (-229.090) * (-229.461) [-228.325] (-228.493) (-226.821) -- 0:00:41
      347500 -- (-230.953) (-229.689) (-233.969) [-227.010] * (-228.651) (-227.903) [-229.278] (-230.153) -- 0:00:41
      348000 -- (-226.004) (-228.417) (-230.973) [-228.056] * (-229.204) (-226.482) (-231.761) [-228.209] -- 0:00:41
      348500 -- (-229.387) [-227.415] (-230.930) (-226.650) * (-227.754) [-228.591] (-230.329) (-227.579) -- 0:00:41
      349000 -- (-229.336) [-230.416] (-226.947) (-227.759) * (-228.071) (-229.050) [-225.842] (-227.439) -- 0:00:41
      349500 -- (-226.894) (-227.895) (-228.738) [-227.686] * (-226.340) (-229.505) [-227.078] (-226.361) -- 0:00:40
      350000 -- (-226.197) (-226.499) [-227.356] (-228.798) * [-229.641] (-226.336) (-226.780) (-226.368) -- 0:00:40

      Average standard deviation of split frequencies: 0.011308

      350500 -- [-226.345] (-226.520) (-230.225) (-226.879) * (-227.676) (-228.975) [-228.590] (-226.951) -- 0:00:40
      351000 -- (-226.963) (-228.192) [-227.125] (-226.225) * [-226.736] (-227.378) (-227.901) (-231.822) -- 0:00:40
      351500 -- [-228.231] (-229.181) (-229.097) (-226.930) * (-226.006) (-227.049) [-229.087] (-226.035) -- 0:00:40
      352000 -- (-229.766) (-228.643) (-227.862) [-228.669] * (-226.879) (-229.799) [-228.096] (-227.246) -- 0:00:40
      352500 -- [-226.752] (-228.240) (-228.775) (-226.535) * [-226.908] (-228.348) (-229.635) (-228.885) -- 0:00:40
      353000 -- [-228.305] (-227.544) (-228.047) (-228.287) * (-227.121) (-230.618) (-226.547) [-227.590] -- 0:00:42
      353500 -- (-227.804) (-227.571) (-226.860) [-227.030] * [-226.932] (-226.642) (-226.530) (-227.383) -- 0:00:42
      354000 -- (-228.720) [-228.071] (-228.788) (-227.589) * [-227.028] (-227.514) (-228.497) (-228.407) -- 0:00:41
      354500 -- (-228.532) (-228.713) (-225.896) [-227.332] * [-228.496] (-226.578) (-228.227) (-227.542) -- 0:00:41
      355000 -- (-228.931) [-227.514] (-226.779) (-228.787) * (-227.314) [-227.217] (-227.219) (-228.949) -- 0:00:41

      Average standard deviation of split frequencies: 0.011606

      355500 -- (-227.797) (-227.749) [-228.419] (-228.528) * (-225.973) [-229.359] (-227.386) (-228.558) -- 0:00:41
      356000 -- (-227.970) (-228.437) (-228.795) [-227.692] * (-230.038) [-226.382] (-230.172) (-226.818) -- 0:00:41
      356500 -- [-226.814] (-228.376) (-230.077) (-227.246) * (-229.502) (-228.493) [-226.798] (-226.001) -- 0:00:41
      357000 -- (-228.835) (-229.509) (-226.851) [-227.782] * (-227.288) (-229.788) [-230.297] (-226.887) -- 0:00:41
      357500 -- (-227.917) (-226.354) [-228.554] (-226.176) * (-227.333) [-229.417] (-226.652) (-228.516) -- 0:00:41
      358000 -- (-227.631) (-227.432) (-230.530) [-225.982] * [-227.741] (-226.271) (-228.213) (-229.635) -- 0:00:41
      358500 -- (-229.978) (-227.425) (-229.468) [-226.187] * (-227.008) (-235.068) (-226.612) [-226.057] -- 0:00:41
      359000 -- (-227.131) [-225.931] (-227.066) (-227.402) * (-228.731) (-228.971) [-226.295] (-229.357) -- 0:00:41
      359500 -- (-227.894) (-227.846) (-230.312) [-227.067] * (-226.829) (-225.791) (-229.495) [-226.548] -- 0:00:40
      360000 -- (-226.121) (-230.553) (-228.317) [-226.312] * [-229.912] (-230.103) (-228.410) (-228.045) -- 0:00:40

      Average standard deviation of split frequencies: 0.010918

      360500 -- (-226.162) (-227.088) (-231.851) [-227.535] * (-228.304) (-229.231) (-227.387) [-227.721] -- 0:00:40
      361000 -- [-228.897] (-226.786) (-230.907) (-227.054) * [-226.941] (-229.799) (-226.282) (-228.748) -- 0:00:40
      361500 -- [-229.556] (-230.623) (-229.837) (-227.342) * (-229.227) (-228.798) (-229.535) [-229.140] -- 0:00:40
      362000 -- [-231.279] (-228.285) (-228.338) (-227.214) * [-228.778] (-227.776) (-231.277) (-226.791) -- 0:00:40
      362500 -- (-229.276) (-227.809) [-229.570] (-227.083) * (-231.337) [-227.189] (-228.308) (-226.414) -- 0:00:40
      363000 -- (-227.976) (-229.507) (-227.742) [-226.085] * (-229.802) [-226.245] (-229.493) (-231.100) -- 0:00:40
      363500 -- (-226.833) (-229.764) [-227.706] (-229.239) * (-228.335) (-228.909) [-227.568] (-226.231) -- 0:00:40
      364000 -- (-229.412) (-232.393) (-225.840) [-227.840] * (-226.996) (-230.741) (-227.858) [-232.270] -- 0:00:40
      364500 -- (-226.974) (-226.930) (-227.338) [-228.481] * (-228.398) (-231.773) (-227.198) [-229.251] -- 0:00:40
      365000 -- [-226.804] (-229.829) (-229.578) (-225.647) * (-230.607) [-228.619] (-226.024) (-228.618) -- 0:00:40

      Average standard deviation of split frequencies: 0.010986

      365500 -- (-230.314) (-227.568) (-228.683) [-232.471] * (-228.779) (-228.606) [-226.800] (-231.040) -- 0:00:39
      366000 -- [-227.382] (-227.126) (-226.963) (-230.438) * [-229.346] (-228.813) (-229.609) (-226.421) -- 0:00:41
      366500 -- (-226.813) [-228.929] (-229.370) (-227.316) * (-228.970) (-227.631) [-230.221] (-227.001) -- 0:00:41
      367000 -- (-228.049) (-228.207) (-230.060) [-228.283] * (-227.006) [-229.977] (-227.400) (-226.979) -- 0:00:41
      367500 -- (-228.590) (-230.194) [-227.773] (-227.531) * (-228.870) (-230.622) (-227.773) [-228.661] -- 0:00:41
      368000 -- (-226.487) (-226.251) (-226.452) [-228.926] * [-227.284] (-228.306) (-226.800) (-228.122) -- 0:00:41
      368500 -- [-227.020] (-225.994) (-226.291) (-227.616) * (-232.827) (-229.232) [-226.624] (-229.992) -- 0:00:41
      369000 -- [-227.214] (-230.059) (-226.157) (-229.855) * (-228.083) (-228.654) (-226.754) [-227.725] -- 0:00:41
      369500 -- (-226.580) [-226.610] (-227.050) (-232.774) * (-226.753) (-228.365) (-229.953) [-226.498] -- 0:00:40
      370000 -- (-228.354) (-227.056) [-227.565] (-234.922) * (-226.710) (-227.689) [-227.409] (-226.511) -- 0:00:40

      Average standard deviation of split frequencies: 0.010773

      370500 -- (-229.651) [-227.036] (-228.364) (-230.468) * (-230.278) (-232.142) (-229.175) [-226.805] -- 0:00:40
      371000 -- (-228.284) (-227.405) (-228.239) [-232.133] * (-226.711) (-228.604) [-230.573] (-227.494) -- 0:00:40
      371500 -- [-226.428] (-229.083) (-226.045) (-234.026) * (-230.483) [-227.996] (-235.163) (-228.062) -- 0:00:40
      372000 -- (-227.155) (-230.108) [-226.631] (-228.408) * (-233.347) [-225.932] (-227.197) (-227.767) -- 0:00:40
      372500 -- (-227.133) (-230.615) (-226.946) [-226.414] * (-231.024) (-225.674) [-228.767] (-230.482) -- 0:00:40
      373000 -- (-228.227) (-227.722) (-228.752) [-228.185] * (-236.636) [-227.408] (-228.295) (-226.165) -- 0:00:40
      373500 -- (-229.787) (-229.138) (-232.494) [-226.602] * (-226.487) [-230.365] (-227.274) (-226.335) -- 0:00:40
      374000 -- (-227.130) [-227.252] (-234.680) (-229.376) * (-226.407) [-226.998] (-228.173) (-228.631) -- 0:00:40
      374500 -- (-227.555) [-229.324] (-229.907) (-226.064) * (-229.711) [-227.059] (-230.219) (-228.120) -- 0:00:40
      375000 -- [-226.713] (-227.632) (-228.972) (-231.772) * [-230.724] (-228.239) (-227.232) (-226.439) -- 0:00:40

      Average standard deviation of split frequencies: 0.009735

      375500 -- (-228.111) (-226.307) [-227.388] (-226.418) * (-226.570) (-225.550) (-228.521) [-227.432] -- 0:00:39
      376000 -- (-227.633) (-226.631) [-226.384] (-226.929) * (-231.492) (-229.966) [-227.020] (-227.878) -- 0:00:39
      376500 -- (-226.622) [-226.993] (-229.024) (-228.475) * [-228.733] (-227.081) (-226.819) (-227.116) -- 0:00:39
      377000 -- [-226.618] (-228.338) (-233.851) (-228.370) * (-225.617) (-228.604) [-226.311] (-227.493) -- 0:00:39
      377500 -- (-227.003) [-227.805] (-230.685) (-227.888) * (-226.170) (-226.804) (-228.763) [-228.776] -- 0:00:39
      378000 -- (-227.512) (-226.367) (-229.997) [-227.043] * (-226.605) (-227.470) (-226.918) [-225.577] -- 0:00:39
      378500 -- (-228.430) (-226.903) [-227.205] (-227.102) * [-226.865] (-226.368) (-227.322) (-226.057) -- 0:00:39
      379000 -- [-227.585] (-226.506) (-226.828) (-229.870) * (-226.132) (-227.026) [-227.433] (-226.893) -- 0:00:39
      379500 -- [-228.456] (-227.623) (-230.160) (-228.263) * (-228.926) (-228.199) [-227.631] (-227.431) -- 0:00:39
      380000 -- [-228.690] (-234.369) (-228.538) (-227.821) * (-228.883) (-226.865) (-229.595) [-229.544] -- 0:00:39

      Average standard deviation of split frequencies: 0.009907

      380500 -- (-227.903) (-228.848) [-226.826] (-227.707) * (-227.009) (-226.718) (-226.724) [-225.968] -- 0:00:40
      381000 -- (-226.415) [-228.144] (-227.180) (-229.288) * [-225.796] (-226.765) (-225.978) (-228.328) -- 0:00:40
      381500 -- (-226.371) (-228.126) [-230.599] (-230.914) * (-226.858) (-226.588) [-227.115] (-226.086) -- 0:00:40
      382000 -- (-231.751) (-228.740) (-228.632) [-227.781] * [-229.205] (-228.182) (-226.795) (-229.356) -- 0:00:40
      382500 -- (-230.096) [-225.994] (-226.130) (-228.110) * (-230.870) [-226.714] (-228.237) (-228.034) -- 0:00:40
      383000 -- (-228.640) (-227.668) (-227.471) [-228.358] * (-231.149) (-230.219) [-227.341] (-227.682) -- 0:00:40
      383500 -- (-228.749) (-226.427) [-226.637] (-229.642) * (-228.152) [-228.973] (-227.726) (-227.761) -- 0:00:40
      384000 -- (-228.289) (-226.432) (-225.920) [-225.752] * (-228.016) (-226.419) [-228.710] (-227.775) -- 0:00:40
      384500 -- [-226.763] (-228.481) (-228.697) (-227.074) * (-228.264) [-225.994] (-230.123) (-228.634) -- 0:00:40
      385000 -- (-228.063) [-227.720] (-226.058) (-227.821) * (-227.989) (-225.983) [-229.521] (-231.814) -- 0:00:39

      Average standard deviation of split frequencies: 0.009842

      385500 -- (-230.312) (-231.199) [-228.268] (-226.053) * [-226.939] (-226.923) (-233.125) (-231.361) -- 0:00:39
      386000 -- [-227.748] (-227.035) (-229.132) (-226.849) * (-228.701) [-227.190] (-237.397) (-227.941) -- 0:00:39
      386500 -- (-230.789) (-227.216) [-227.408] (-227.709) * (-229.865) [-227.276] (-228.231) (-226.871) -- 0:00:39
      387000 -- [-231.496] (-228.552) (-233.016) (-229.141) * (-228.978) (-230.401) (-227.210) [-225.960] -- 0:00:39
      387500 -- (-226.381) (-232.584) (-230.352) [-227.578] * [-227.854] (-228.060) (-230.052) (-227.832) -- 0:00:39
      388000 -- (-227.842) (-230.411) (-231.465) [-226.720] * (-229.188) [-226.995] (-229.682) (-226.514) -- 0:00:39
      388500 -- (-232.470) (-226.890) (-229.542) [-227.071] * (-230.431) [-227.986] (-230.640) (-228.544) -- 0:00:39
      389000 -- [-229.077] (-227.520) (-228.473) (-226.471) * (-226.137) [-227.507] (-227.305) (-227.327) -- 0:00:39
      389500 -- [-230.240] (-226.720) (-227.646) (-227.797) * (-227.470) (-226.839) [-226.593] (-229.256) -- 0:00:39
      390000 -- [-228.319] (-228.056) (-226.551) (-228.276) * (-229.295) [-229.531] (-227.203) (-229.099) -- 0:00:39

      Average standard deviation of split frequencies: 0.010079

      390500 -- [-227.124] (-225.716) (-226.188) (-228.456) * (-227.832) (-227.360) (-227.409) [-226.833] -- 0:00:39
      391000 -- (-230.153) [-226.784] (-230.850) (-226.439) * [-226.645] (-228.883) (-230.459) (-227.069) -- 0:00:38
      391500 -- [-229.614] (-226.213) (-229.228) (-226.495) * [-229.468] (-229.550) (-232.904) (-228.578) -- 0:00:38
      392000 -- [-226.442] (-228.418) (-229.148) (-226.189) * (-226.847) (-229.400) (-230.032) [-228.175] -- 0:00:38
      392500 -- (-229.973) (-227.763) [-227.435] (-227.919) * [-231.807] (-228.017) (-226.538) (-232.039) -- 0:00:38
      393000 -- [-227.183] (-226.932) (-228.234) (-230.988) * (-226.811) (-226.926) (-228.813) [-229.938] -- 0:00:38
      393500 -- (-226.032) (-227.774) (-227.074) [-227.011] * (-230.357) [-227.022] (-227.436) (-231.356) -- 0:00:38
      394000 -- (-225.918) (-227.717) (-228.776) [-228.677] * (-227.034) (-226.465) (-228.528) [-227.359] -- 0:00:38
      394500 -- (-229.595) (-226.212) [-227.834] (-226.436) * [-229.220] (-228.039) (-228.357) (-226.804) -- 0:00:38
      395000 -- (-228.292) (-226.990) (-229.221) [-226.379] * [-228.109] (-230.482) (-234.864) (-228.077) -- 0:00:38

      Average standard deviation of split frequencies: 0.009873

      395500 -- (-233.236) [-228.540] (-225.868) (-227.554) * [-229.942] (-227.915) (-227.409) (-226.592) -- 0:00:38
      396000 -- (-226.160) (-229.717) [-227.713] (-227.483) * (-226.868) (-229.250) (-225.553) [-226.610] -- 0:00:39
      396500 -- (-226.557) (-226.519) (-227.573) [-227.434] * (-226.571) [-227.228] (-228.174) (-229.847) -- 0:00:39
      397000 -- (-228.517) (-226.564) [-230.350] (-228.463) * [-228.381] (-226.994) (-229.406) (-226.794) -- 0:00:39
      397500 -- (-228.846) [-227.621] (-228.912) (-232.766) * (-227.398) (-232.913) [-230.211] (-231.500) -- 0:00:39
      398000 -- (-230.553) [-227.851] (-227.432) (-231.509) * (-227.172) [-229.145] (-226.590) (-231.105) -- 0:00:39
      398500 -- (-227.775) [-226.075] (-229.349) (-228.306) * [-226.618] (-226.223) (-227.433) (-227.346) -- 0:00:39
      399000 -- (-235.826) (-228.216) [-227.026] (-228.520) * [-227.192] (-232.211) (-227.482) (-227.908) -- 0:00:39
      399500 -- (-232.102) (-228.795) (-227.596) [-231.490] * [-229.028] (-229.525) (-227.219) (-226.663) -- 0:00:39
      400000 -- (-225.801) (-226.926) (-230.359) [-227.988] * [-228.707] (-229.896) (-230.075) (-229.317) -- 0:00:39

      Average standard deviation of split frequencies: 0.010727

      400500 -- (-227.078) (-229.158) (-226.507) [-226.190] * (-226.413) (-235.186) [-228.781] (-234.498) -- 0:00:38
      401000 -- (-228.120) (-226.634) (-226.172) [-228.263] * (-226.663) (-230.089) [-228.009] (-227.010) -- 0:00:38
      401500 -- (-225.768) [-227.168] (-227.771) (-227.453) * (-228.765) [-227.716] (-230.611) (-226.599) -- 0:00:38
      402000 -- [-226.450] (-232.333) (-227.379) (-230.295) * (-227.555) (-226.239) [-234.457] (-226.357) -- 0:00:38
      402500 -- (-228.376) (-227.963) (-228.419) [-226.630] * (-226.778) [-225.822] (-228.970) (-227.899) -- 0:00:38
      403000 -- (-225.865) (-226.746) (-226.451) [-229.104] * [-227.592] (-226.284) (-226.931) (-229.230) -- 0:00:38
      403500 -- (-227.760) (-227.504) [-226.578] (-228.337) * (-226.215) (-228.165) [-227.064] (-226.658) -- 0:00:38
      404000 -- (-225.593) [-225.978] (-228.791) (-226.994) * (-229.015) [-229.835] (-228.526) (-229.366) -- 0:00:38
      404500 -- [-226.984] (-227.945) (-228.001) (-228.656) * (-229.397) (-229.760) [-227.712] (-226.651) -- 0:00:38
      405000 -- [-229.386] (-227.307) (-227.310) (-227.878) * [-225.988] (-231.071) (-226.925) (-228.451) -- 0:00:38

      Average standard deviation of split frequencies: 0.010586

      405500 -- [-228.970] (-226.558) (-229.011) (-229.029) * (-226.278) (-228.295) [-226.594] (-227.557) -- 0:00:38
      406000 -- (-226.502) (-228.248) (-226.981) [-226.674] * (-226.622) [-228.519] (-228.499) (-229.921) -- 0:00:38
      406500 -- [-231.997] (-230.521) (-227.454) (-228.665) * [-231.193] (-230.787) (-226.208) (-229.147) -- 0:00:37
      407000 -- (-227.016) (-228.322) [-227.068] (-228.981) * (-232.908) (-230.192) [-226.000] (-226.326) -- 0:00:37
      407500 -- (-227.389) (-226.475) [-227.106] (-227.801) * [-229.218] (-228.085) (-227.149) (-228.986) -- 0:00:37
      408000 -- (-227.015) (-228.382) (-226.980) [-227.340] * [-228.219] (-229.165) (-226.237) (-228.153) -- 0:00:37
      408500 -- (-228.485) (-228.355) (-226.231) [-229.655] * (-233.018) (-226.969) (-226.678) [-228.805] -- 0:00:37
      409000 -- (-227.972) (-227.581) (-226.353) [-227.487] * [-227.066] (-227.959) (-228.283) (-228.175) -- 0:00:37
      409500 -- (-226.032) (-228.347) (-230.420) [-226.127] * (-229.421) [-226.407] (-228.474) (-226.673) -- 0:00:37
      410000 -- (-229.807) [-229.486] (-234.359) (-226.441) * (-228.322) (-227.456) [-229.715] (-227.930) -- 0:00:37

      Average standard deviation of split frequencies: 0.010399

      410500 -- (-228.350) (-227.927) [-228.683] (-225.975) * (-228.464) (-228.289) [-227.593] (-229.665) -- 0:00:37
      411000 -- (-231.835) [-227.693] (-228.590) (-228.224) * [-227.790] (-227.749) (-230.325) (-234.349) -- 0:00:38
      411500 -- (-227.040) [-226.282] (-227.698) (-228.093) * (-226.239) (-226.719) (-230.529) [-226.115] -- 0:00:38
      412000 -- (-226.189) [-227.481] (-230.732) (-229.825) * [-226.261] (-226.591) (-228.631) (-226.347) -- 0:00:38
      412500 -- (-227.248) (-225.725) (-228.485) [-226.604] * [-228.122] (-226.786) (-228.560) (-226.880) -- 0:00:38
      413000 -- [-227.920] (-226.008) (-226.633) (-229.729) * (-226.122) [-225.690] (-227.350) (-227.673) -- 0:00:38
      413500 -- (-226.447) (-226.006) (-229.439) [-228.777] * (-227.667) (-226.263) [-228.455] (-228.421) -- 0:00:38
      414000 -- (-226.361) (-226.749) [-229.111] (-228.448) * (-229.478) [-227.823] (-226.649) (-229.229) -- 0:00:38
      414500 -- (-226.845) [-227.337] (-226.740) (-229.300) * (-229.797) (-229.678) [-231.411] (-231.940) -- 0:00:38
      415000 -- [-226.560] (-227.874) (-227.748) (-229.467) * (-227.071) (-234.651) (-227.433) [-228.761] -- 0:00:38

      Average standard deviation of split frequencies: 0.010732

      415500 -- (-228.735) [-226.603] (-226.370) (-226.596) * [-225.928] (-230.849) (-227.667) (-225.594) -- 0:00:37
      416000 -- (-229.436) (-228.468) [-230.185] (-227.396) * [-228.602] (-228.254) (-228.834) (-225.950) -- 0:00:37
      416500 -- [-229.983] (-232.177) (-226.254) (-226.092) * (-231.512) (-228.527) (-230.460) [-229.802] -- 0:00:37
      417000 -- (-227.252) (-227.437) [-228.131] (-226.400) * (-228.490) [-225.761] (-226.276) (-230.371) -- 0:00:37
      417500 -- (-229.469) (-228.405) [-227.892] (-228.932) * (-228.987) (-227.945) [-226.760] (-229.683) -- 0:00:37
      418000 -- (-227.533) [-226.795] (-226.151) (-230.579) * [-227.228] (-226.986) (-227.869) (-228.514) -- 0:00:37
      418500 -- (-226.482) (-226.536) [-229.538] (-227.375) * (-226.535) (-226.489) (-227.948) [-228.193] -- 0:00:37
      419000 -- (-234.769) [-229.101] (-226.722) (-225.825) * [-227.358] (-230.720) (-229.301) (-227.484) -- 0:00:37
      419500 -- [-227.463] (-229.719) (-229.099) (-226.232) * [-227.309] (-227.919) (-227.635) (-227.317) -- 0:00:37
      420000 -- [-226.825] (-227.815) (-227.925) (-227.672) * (-227.810) [-231.605] (-226.343) (-226.955) -- 0:00:37

      Average standard deviation of split frequencies: 0.011602

      420500 -- (-227.314) (-229.121) [-230.718] (-231.500) * (-227.654) (-228.592) [-226.982] (-225.912) -- 0:00:37
      421000 -- (-228.571) (-230.294) [-229.363] (-229.909) * (-228.026) (-229.364) (-228.907) [-227.007] -- 0:00:37
      421500 -- [-227.698] (-226.108) (-227.201) (-228.408) * (-228.688) (-228.292) [-228.857] (-229.840) -- 0:00:37
      422000 -- [-227.253] (-227.997) (-226.869) (-227.355) * [-228.556] (-227.826) (-228.915) (-226.178) -- 0:00:36
      422500 -- (-228.750) (-227.931) [-226.562] (-226.842) * (-229.188) (-228.708) (-227.229) [-228.940] -- 0:00:36
      423000 -- (-228.313) [-228.403] (-229.824) (-227.536) * (-228.847) (-228.618) (-228.636) [-230.865] -- 0:00:36
      423500 -- (-227.549) [-226.684] (-225.817) (-232.914) * [-226.137] (-229.655) (-228.800) (-226.513) -- 0:00:36
      424000 -- (-227.224) (-228.100) (-226.708) [-225.780] * (-229.115) [-229.029] (-227.535) (-227.255) -- 0:00:36
      424500 -- (-226.580) (-228.602) [-225.985] (-229.726) * [-230.102] (-227.594) (-227.974) (-231.729) -- 0:00:36
      425000 -- (-226.583) [-227.415] (-230.344) (-229.429) * (-226.479) (-228.632) [-228.299] (-230.782) -- 0:00:36

      Average standard deviation of split frequencies: 0.011977

      425500 -- (-227.899) [-227.770] (-226.829) (-231.219) * (-226.689) [-227.815] (-227.759) (-234.575) -- 0:00:37
      426000 -- [-226.864] (-229.282) (-228.212) (-226.218) * (-229.097) (-231.879) (-227.553) [-228.617] -- 0:00:37
      426500 -- (-228.840) (-227.946) [-228.057] (-228.759) * (-231.164) [-226.864] (-226.096) (-229.834) -- 0:00:37
      427000 -- [-228.394] (-231.221) (-229.185) (-227.996) * (-228.293) (-229.751) (-226.686) [-226.627] -- 0:00:37
      427500 -- (-226.741) [-228.753] (-228.283) (-227.447) * (-228.229) [-230.972] (-229.149) (-226.786) -- 0:00:37
      428000 -- (-226.053) [-228.257] (-226.527) (-227.643) * [-226.883] (-228.147) (-230.050) (-227.455) -- 0:00:37
      428500 -- [-226.261] (-227.863) (-226.732) (-229.368) * (-226.491) [-228.674] (-227.767) (-228.990) -- 0:00:37
      429000 -- [-226.669] (-228.519) (-226.249) (-227.508) * (-228.380) (-226.361) [-231.277] (-225.970) -- 0:00:37
      429500 -- (-228.962) [-226.798] (-228.795) (-226.090) * (-234.800) (-226.519) [-229.711] (-226.539) -- 0:00:37
      430000 -- [-227.734] (-225.901) (-230.530) (-226.841) * (-230.283) (-233.289) (-228.383) [-227.616] -- 0:00:37

      Average standard deviation of split frequencies: 0.012041

      430500 -- (-228.979) (-228.997) [-226.388] (-225.534) * (-229.920) (-230.126) (-230.994) [-228.264] -- 0:00:37
      431000 -- (-234.314) [-227.044] (-229.200) (-225.629) * (-226.463) [-226.688] (-227.911) (-229.413) -- 0:00:36
      431500 -- (-230.972) (-226.003) [-228.475] (-225.816) * (-228.678) (-229.623) (-227.391) [-229.120] -- 0:00:36
      432000 -- [-228.714] (-227.354) (-230.990) (-228.623) * (-227.888) [-231.146] (-225.711) (-232.604) -- 0:00:36
      432500 -- (-228.387) [-227.701] (-225.550) (-228.007) * (-228.914) (-228.061) [-228.088] (-227.450) -- 0:00:36
      433000 -- (-234.510) [-229.992] (-226.050) (-228.465) * [-229.459] (-234.242) (-230.164) (-229.075) -- 0:00:36
      433500 -- [-229.409] (-226.978) (-229.307) (-229.580) * (-231.625) (-232.963) (-226.061) [-226.201] -- 0:00:36
      434000 -- (-226.757) (-229.363) (-235.186) [-230.868] * [-226.472] (-231.194) (-230.749) (-226.263) -- 0:00:36
      434500 -- [-228.576] (-227.187) (-231.672) (-226.942) * (-227.497) (-230.847) [-226.875] (-229.864) -- 0:00:36
      435000 -- (-227.053) [-228.054] (-231.904) (-225.713) * [-228.520] (-226.685) (-228.192) (-227.129) -- 0:00:36

      Average standard deviation of split frequencies: 0.011893

      435500 -- [-226.966] (-227.179) (-227.827) (-226.049) * (-232.571) (-225.998) [-230.172] (-228.317) -- 0:00:36
      436000 -- [-227.144] (-227.800) (-229.504) (-226.366) * (-227.920) [-227.153] (-233.040) (-228.729) -- 0:00:36
      436500 -- (-227.480) [-227.347] (-229.265) (-232.408) * (-227.997) (-229.272) [-227.715] (-230.374) -- 0:00:36
      437000 -- (-227.553) (-226.706) [-226.107] (-228.076) * (-228.916) [-229.373] (-234.590) (-226.409) -- 0:00:36
      437500 -- (-227.596) (-231.597) [-227.556] (-227.982) * (-228.990) (-229.424) (-227.531) [-227.745] -- 0:00:36
      438000 -- (-232.201) (-230.090) [-226.832] (-228.880) * (-229.059) (-227.478) (-229.062) [-227.154] -- 0:00:35
      438500 -- (-228.605) (-226.745) (-226.973) [-228.116] * (-227.743) (-227.981) [-228.555] (-228.566) -- 0:00:35
      439000 -- (-228.665) (-231.081) [-227.196] (-228.103) * (-227.962) [-227.291] (-227.157) (-228.161) -- 0:00:35
      439500 -- (-230.633) [-226.947] (-226.252) (-227.676) * (-226.164) (-228.039) (-226.560) [-228.275] -- 0:00:35
      440000 -- (-232.004) (-226.759) (-230.593) [-227.761] * (-226.009) (-226.432) (-226.613) [-227.342] -- 0:00:35

      Average standard deviation of split frequencies: 0.012585

      440500 -- (-231.185) (-227.619) [-233.313] (-230.596) * (-226.235) (-226.508) (-226.642) [-229.071] -- 0:00:36
      441000 -- (-227.301) (-227.448) (-236.332) [-226.794] * (-226.673) (-226.640) [-227.520] (-230.986) -- 0:00:36
      441500 -- [-226.363] (-228.613) (-228.778) (-227.604) * [-232.022] (-230.355) (-226.531) (-226.995) -- 0:00:36
      442000 -- (-227.254) (-232.553) (-226.951) [-228.888] * (-226.829) (-227.502) [-226.226] (-226.857) -- 0:00:36
      442500 -- [-226.307] (-227.135) (-228.045) (-227.391) * (-227.232) [-228.215] (-229.163) (-230.412) -- 0:00:36
      443000 -- (-227.156) [-227.907] (-226.283) (-228.868) * (-226.244) [-228.817] (-228.234) (-228.361) -- 0:00:36
      443500 -- (-228.928) (-226.029) (-229.324) [-226.651] * (-229.903) [-227.995] (-226.636) (-227.985) -- 0:00:36
      444000 -- (-226.944) (-230.150) (-229.865) [-226.085] * (-232.211) [-228.035] (-226.780) (-230.453) -- 0:00:36
      444500 -- (-228.342) [-227.781] (-228.594) (-228.675) * (-230.486) (-229.243) [-226.119] (-233.857) -- 0:00:36
      445000 -- [-228.010] (-226.923) (-226.512) (-227.819) * (-230.171) (-227.250) [-226.900] (-227.192) -- 0:00:36

      Average standard deviation of split frequencies: 0.012124

      445500 -- (-229.376) [-228.155] (-227.872) (-227.185) * (-227.821) (-226.768) [-226.379] (-226.458) -- 0:00:36
      446000 -- (-232.266) (-228.009) (-228.811) [-228.350] * (-228.366) (-230.976) (-227.335) [-227.226] -- 0:00:36
      446500 -- (-227.982) [-229.193] (-226.486) (-225.966) * (-229.378) [-226.965] (-226.394) (-227.591) -- 0:00:35
      447000 -- (-225.893) (-226.208) [-229.866] (-225.800) * (-227.041) (-228.035) [-227.147] (-226.359) -- 0:00:35
      447500 -- (-227.587) (-227.938) [-229.449] (-227.386) * (-229.599) (-227.704) (-228.216) [-228.159] -- 0:00:35
      448000 -- (-229.533) (-228.931) (-230.295) [-229.162] * [-225.710] (-227.082) (-229.548) (-229.961) -- 0:00:35
      448500 -- (-226.647) (-229.634) [-227.776] (-231.930) * (-228.409) [-227.206] (-229.896) (-229.638) -- 0:00:35
      449000 -- (-227.618) (-231.103) [-225.598] (-227.333) * (-229.464) (-229.984) [-227.048] (-229.577) -- 0:00:35
      449500 -- [-227.382] (-230.604) (-225.804) (-228.943) * (-228.762) (-226.873) [-226.066] (-226.978) -- 0:00:35
      450000 -- (-226.018) [-229.535] (-227.911) (-229.541) * (-227.106) (-225.725) (-227.891) [-228.390] -- 0:00:35

      Average standard deviation of split frequencies: 0.012245

      450500 -- (-228.467) (-227.453) (-227.831) [-228.243] * (-230.078) [-229.447] (-227.221) (-230.329) -- 0:00:35
      451000 -- [-227.753] (-229.558) (-226.682) (-229.270) * (-229.327) [-227.384] (-230.277) (-231.084) -- 0:00:35
      451500 -- (-227.808) (-228.156) [-227.193] (-226.992) * (-227.890) (-234.386) (-226.136) [-227.703] -- 0:00:35
      452000 -- [-226.789] (-228.423) (-227.177) (-227.314) * (-227.436) (-235.660) (-230.118) [-228.522] -- 0:00:35
      452500 -- (-227.038) (-225.958) (-228.802) [-227.348] * [-228.717] (-234.826) (-227.522) (-231.477) -- 0:00:35
      453000 -- (-228.814) (-225.985) [-228.469] (-226.877) * (-228.708) (-227.892) [-229.790] (-227.414) -- 0:00:35
      453500 -- (-228.867) [-228.473] (-228.877) (-227.742) * (-231.202) (-228.455) (-232.132) [-228.075] -- 0:00:34
      454000 -- (-230.160) (-227.930) [-230.186] (-228.865) * (-233.812) (-228.408) (-227.918) [-226.481] -- 0:00:34
      454500 -- (-228.280) (-229.229) (-227.563) [-229.795] * (-227.994) (-226.703) (-226.552) [-230.929] -- 0:00:34
      455000 -- (-228.795) [-226.961] (-228.208) (-226.717) * (-230.672) (-226.872) (-227.139) [-230.845] -- 0:00:34

      Average standard deviation of split frequencies: 0.011980

      455500 -- [-228.498] (-229.118) (-227.457) (-226.363) * [-226.735] (-229.262) (-228.891) (-227.000) -- 0:00:35
      456000 -- (-232.162) (-228.184) (-228.085) [-227.788] * (-227.805) (-229.190) [-227.949] (-226.648) -- 0:00:35
      456500 -- (-226.390) [-226.739] (-230.724) (-228.575) * [-228.747] (-229.346) (-226.404) (-227.158) -- 0:00:35
      457000 -- (-228.760) [-228.687] (-226.296) (-234.445) * (-229.079) (-227.492) (-226.377) [-230.161] -- 0:00:35
      457500 -- (-229.830) (-233.472) [-228.895] (-233.697) * (-228.710) (-226.983) (-227.591) [-231.475] -- 0:00:35
      458000 -- [-227.540] (-229.956) (-227.938) (-227.517) * (-229.363) [-226.307] (-230.584) (-228.370) -- 0:00:35
      458500 -- [-227.365] (-228.840) (-231.096) (-225.978) * (-230.377) (-226.579) (-228.113) [-228.409] -- 0:00:35
      459000 -- (-229.319) (-231.212) (-230.625) [-227.975] * (-228.034) [-227.884] (-229.317) (-227.781) -- 0:00:35
      459500 -- (-234.940) (-230.785) [-232.714] (-226.071) * (-227.483) (-227.979) [-226.878] (-228.571) -- 0:00:35
      460000 -- (-227.069) (-226.275) (-229.102) [-226.572] * (-226.255) [-227.555] (-227.501) (-227.092) -- 0:00:35

      Average standard deviation of split frequencies: 0.012099

      460500 -- [-230.028] (-226.521) (-232.586) (-228.497) * (-228.066) [-227.995] (-228.613) (-232.493) -- 0:00:35
      461000 -- (-231.516) (-230.184) (-226.420) [-228.239] * [-227.997] (-227.359) (-226.561) (-226.094) -- 0:00:35
      461500 -- (-231.019) [-228.057] (-230.455) (-228.839) * [-228.123] (-230.057) (-227.199) (-228.868) -- 0:00:35
      462000 -- (-229.259) [-229.337] (-227.358) (-227.823) * (-226.378) (-227.738) (-227.135) [-231.372] -- 0:00:34
      462500 -- (-226.560) (-225.857) [-227.751] (-228.615) * [-225.943] (-227.426) (-227.140) (-225.865) -- 0:00:34
      463000 -- (-230.484) (-228.919) [-229.203] (-227.401) * (-225.943) (-233.425) [-230.389] (-228.455) -- 0:00:34
      463500 -- (-227.496) (-228.977) (-228.633) [-227.272] * (-228.740) [-226.420] (-228.848) (-230.237) -- 0:00:34
      464000 -- [-233.300] (-229.997) (-228.396) (-228.298) * [-226.151] (-235.066) (-226.834) (-229.023) -- 0:00:34
      464500 -- (-229.251) [-229.892] (-226.425) (-228.939) * [-228.163] (-227.375) (-226.294) (-227.645) -- 0:00:34
      465000 -- (-228.065) (-229.007) [-226.142] (-232.269) * [-229.577] (-229.812) (-227.213) (-228.708) -- 0:00:34

      Average standard deviation of split frequencies: 0.012199

      465500 -- (-226.531) (-226.255) [-226.080] (-226.256) * (-226.140) (-228.442) [-226.948] (-227.884) -- 0:00:34
      466000 -- [-227.512] (-232.639) (-226.041) (-227.681) * (-225.849) (-226.148) (-227.188) [-226.876] -- 0:00:34
      466500 -- [-227.073] (-235.228) (-229.305) (-229.126) * (-226.819) [-229.718] (-228.145) (-227.732) -- 0:00:34
      467000 -- (-228.096) (-233.531) (-227.604) [-228.701] * [-229.694] (-229.510) (-228.186) (-227.848) -- 0:00:34
      467500 -- (-228.077) (-226.735) [-226.183] (-227.954) * (-229.050) (-233.190) (-226.005) [-230.222] -- 0:00:34
      468000 -- (-228.928) (-231.914) (-228.166) [-226.911] * [-231.583] (-229.782) (-230.579) (-228.802) -- 0:00:34
      468500 -- (-228.259) (-227.778) [-226.293] (-229.863) * (-229.705) [-227.050] (-231.738) (-229.442) -- 0:00:34
      469000 -- (-227.490) (-227.706) [-228.124] (-227.268) * (-229.378) (-230.343) (-228.311) [-226.774] -- 0:00:33
      469500 -- (-228.611) (-227.289) (-229.711) [-226.350] * (-231.783) (-227.203) [-227.725] (-227.632) -- 0:00:33
      470000 -- [-227.273] (-226.689) (-229.454) (-227.578) * (-226.906) [-226.076] (-232.264) (-226.569) -- 0:00:33

      Average standard deviation of split frequencies: 0.012196

      470500 -- (-231.085) (-231.316) (-230.023) [-229.138] * [-228.246] (-227.227) (-236.241) (-226.522) -- 0:00:34
      471000 -- [-229.545] (-228.370) (-231.238) (-231.614) * [-230.980] (-227.737) (-229.464) (-225.998) -- 0:00:34
      471500 -- (-227.502) (-225.753) (-234.189) [-226.453] * (-232.804) (-226.196) [-229.022] (-227.546) -- 0:00:34
      472000 -- [-228.188] (-225.730) (-228.721) (-227.579) * (-232.673) [-226.877] (-229.483) (-227.279) -- 0:00:34
      472500 -- (-229.163) [-228.034] (-226.268) (-226.169) * (-230.092) (-227.365) [-228.559] (-227.119) -- 0:00:34
      473000 -- (-227.682) (-229.317) (-227.255) [-228.937] * [-231.153] (-229.580) (-236.669) (-228.366) -- 0:00:34
      473500 -- (-228.681) [-227.231] (-227.469) (-226.472) * (-226.659) (-231.498) [-228.388] (-227.348) -- 0:00:34
      474000 -- (-226.132) (-227.742) [-226.917] (-226.729) * (-226.404) (-230.067) (-227.920) [-227.979] -- 0:00:34
      474500 -- [-227.785] (-227.871) (-233.745) (-229.488) * (-227.504) (-226.404) [-225.952] (-227.417) -- 0:00:34
      475000 -- (-226.600) (-233.195) (-227.764) [-227.428] * [-227.931] (-227.002) (-232.365) (-229.524) -- 0:00:34

      Average standard deviation of split frequencies: 0.011884

      475500 -- (-227.343) (-228.971) (-228.624) [-226.515] * (-228.118) [-229.557] (-229.368) (-228.123) -- 0:00:34
      476000 -- (-227.329) [-228.746] (-230.456) (-230.993) * (-231.186) (-227.138) [-227.717] (-235.538) -- 0:00:34
      476500 -- (-226.713) [-227.860] (-226.780) (-227.979) * (-227.746) [-225.730] (-226.188) (-229.604) -- 0:00:34
      477000 -- (-229.765) [-226.783] (-227.297) (-228.428) * (-226.568) [-228.351] (-228.496) (-229.701) -- 0:00:33
      477500 -- (-228.463) (-229.977) (-227.562) [-227.745] * [-226.788] (-234.019) (-226.740) (-227.543) -- 0:00:33
      478000 -- (-231.370) (-227.460) (-229.105) [-229.195] * (-229.222) (-227.095) (-228.051) [-229.714] -- 0:00:33
      478500 -- [-229.150] (-227.751) (-227.193) (-226.521) * (-226.732) [-226.755] (-226.947) (-228.138) -- 0:00:33
      479000 -- (-237.772) [-228.312] (-228.656) (-228.184) * (-228.637) (-226.539) [-229.436] (-230.209) -- 0:00:33
      479500 -- (-225.920) [-227.408] (-226.125) (-226.712) * (-228.402) (-228.028) [-229.513] (-227.234) -- 0:00:33
      480000 -- (-233.281) (-227.330) [-226.164] (-228.754) * (-227.561) (-226.189) [-226.256] (-230.009) -- 0:00:33

      Average standard deviation of split frequencies: 0.009685

      480500 -- (-228.671) (-227.814) (-227.897) [-230.020] * (-229.051) [-229.033] (-227.786) (-226.315) -- 0:00:33
      481000 -- (-230.253) (-226.115) (-227.742) [-227.377] * (-227.879) (-232.491) (-228.449) [-229.530] -- 0:00:33
      481500 -- (-230.423) [-226.618] (-228.122) (-227.493) * (-226.486) (-226.511) (-228.142) [-229.650] -- 0:00:33
      482000 -- (-226.795) (-226.492) [-226.456] (-228.418) * (-228.018) (-228.485) (-227.293) [-227.070] -- 0:00:33
      482500 -- (-228.612) (-227.118) (-228.000) [-226.611] * (-227.217) (-227.265) (-233.496) [-227.727] -- 0:00:33
      483000 -- (-227.181) [-227.625] (-228.108) (-226.205) * (-228.123) (-225.909) (-231.435) [-228.661] -- 0:00:33
      483500 -- [-232.089] (-228.935) (-227.967) (-230.772) * [-227.205] (-228.902) (-229.056) (-228.788) -- 0:00:34
      484000 -- (-227.185) [-226.436] (-226.512) (-236.263) * [-228.484] (-232.170) (-229.671) (-230.804) -- 0:00:34
      484500 -- (-225.889) [-229.104] (-227.818) (-230.001) * (-226.673) [-226.265] (-227.985) (-228.222) -- 0:00:34
      485000 -- (-227.784) (-226.919) (-226.922) [-227.471] * (-227.924) [-226.018] (-229.441) (-226.952) -- 0:00:33

      Average standard deviation of split frequencies: 0.010613

      485500 -- (-228.364) [-230.903] (-227.342) (-228.614) * (-227.390) [-225.758] (-231.622) (-227.915) -- 0:00:33
      486000 -- [-227.907] (-226.650) (-228.031) (-229.789) * (-227.214) [-226.551] (-228.783) (-228.395) -- 0:00:33
      486500 -- (-228.131) (-227.103) [-227.438] (-226.557) * [-227.688] (-227.980) (-225.729) (-231.273) -- 0:00:33
      487000 -- [-228.679] (-227.928) (-232.368) (-228.076) * (-227.346) (-228.408) [-228.472] (-226.126) -- 0:00:33
      487500 -- (-226.549) (-227.706) [-229.535] (-228.631) * [-226.985] (-233.150) (-230.641) (-232.817) -- 0:00:33
      488000 -- (-228.382) (-230.847) [-228.167] (-233.175) * (-226.757) (-227.622) [-227.166] (-225.826) -- 0:00:33
      488500 -- (-230.215) (-232.378) [-228.025] (-227.695) * (-232.494) [-227.910] (-228.420) (-225.985) -- 0:00:33
      489000 -- (-228.300) (-227.311) [-226.917] (-227.460) * (-230.091) [-231.834] (-227.549) (-226.865) -- 0:00:33
      489500 -- (-231.727) [-227.888] (-226.778) (-226.870) * [-226.817] (-234.238) (-228.586) (-231.119) -- 0:00:33
      490000 -- (-227.437) (-228.201) [-227.630] (-230.038) * [-227.093] (-229.105) (-228.390) (-230.135) -- 0:00:33

      Average standard deviation of split frequencies: 0.010399

      490500 -- (-229.752) [-226.913] (-229.755) (-230.064) * (-229.375) (-230.031) (-227.589) [-226.573] -- 0:00:33
      491000 -- (-233.556) [-225.658] (-227.195) (-231.142) * [-228.171] (-227.832) (-228.905) (-227.070) -- 0:00:33
      491500 -- (-227.557) [-230.195] (-228.909) (-236.195) * (-228.241) (-229.542) (-231.221) [-230.236] -- 0:00:33
      492000 -- (-227.204) (-226.857) [-229.965] (-227.272) * (-227.460) [-228.508] (-227.703) (-226.648) -- 0:00:33
      492500 -- [-231.318] (-227.248) (-230.581) (-230.639) * (-233.302) [-228.030] (-227.803) (-226.433) -- 0:00:32
      493000 -- [-226.265] (-227.396) (-226.817) (-228.440) * (-231.649) [-226.459] (-228.545) (-226.518) -- 0:00:32
      493500 -- [-226.637] (-228.185) (-230.210) (-225.746) * (-230.601) [-228.046] (-228.947) (-228.848) -- 0:00:32
      494000 -- (-227.334) (-227.022) (-231.672) [-225.812] * (-228.159) (-226.031) (-228.408) [-226.015] -- 0:00:32
      494500 -- (-226.573) (-228.868) (-227.263) [-226.668] * (-227.868) (-231.457) [-228.915] (-227.986) -- 0:00:32
      495000 -- (-226.800) (-231.766) [-229.463] (-230.111) * (-227.830) [-226.524] (-227.482) (-227.040) -- 0:00:32

      Average standard deviation of split frequencies: 0.011349

      495500 -- (-226.272) (-227.354) (-230.917) [-228.913] * (-225.941) (-228.259) [-230.211] (-229.573) -- 0:00:32
      496000 -- (-226.588) (-230.136) [-227.751] (-227.446) * (-227.248) (-226.745) [-229.840] (-227.177) -- 0:00:32
      496500 -- (-231.290) (-227.444) [-227.337] (-227.213) * (-227.667) [-228.312] (-227.021) (-227.605) -- 0:00:32
      497000 -- (-227.440) [-226.036] (-228.431) (-231.559) * (-228.815) (-228.092) [-231.619] (-227.067) -- 0:00:32
      497500 -- (-227.941) (-226.964) (-226.234) [-226.594] * [-228.407] (-227.289) (-234.724) (-226.796) -- 0:00:32
      498000 -- [-226.736] (-229.649) (-226.974) (-231.852) * (-228.524) (-225.834) [-227.732] (-226.306) -- 0:00:33
      498500 -- (-226.030) [-229.916] (-232.225) (-229.788) * [-227.554] (-230.034) (-228.095) (-227.677) -- 0:00:33
      499000 -- (-228.903) (-226.785) (-231.422) [-226.970] * (-226.671) (-231.917) [-226.067] (-226.300) -- 0:00:33
      499500 -- (-227.866) [-229.331] (-234.854) (-227.959) * (-229.223) (-228.150) (-227.229) [-225.516] -- 0:00:33
      500000 -- (-227.105) (-227.623) [-226.173] (-228.178) * (-227.869) (-231.005) (-230.521) [-227.213] -- 0:00:33

      Average standard deviation of split frequencies: 0.011354

      500500 -- [-227.213] (-227.411) (-226.867) (-228.105) * [-225.898] (-226.963) (-227.638) (-227.473) -- 0:00:32
      501000 -- (-228.003) (-226.265) (-227.079) [-225.609] * [-231.307] (-228.844) (-227.451) (-226.350) -- 0:00:32
      501500 -- (-225.769) (-228.626) (-228.926) [-228.483] * (-234.163) (-230.685) [-225.609] (-226.979) -- 0:00:32
      502000 -- (-229.089) (-228.126) (-227.305) [-228.075] * (-231.605) [-226.503] (-228.184) (-227.923) -- 0:00:32
      502500 -- (-230.564) (-231.772) [-227.038] (-231.930) * (-229.564) (-226.599) [-227.879] (-230.097) -- 0:00:32
      503000 -- (-230.547) (-226.092) [-226.322] (-229.083) * (-232.105) (-226.886) [-226.666] (-231.284) -- 0:00:32
      503500 -- (-228.449) [-227.013] (-227.026) (-226.527) * (-233.254) [-226.211] (-225.614) (-226.435) -- 0:00:32
      504000 -- (-230.178) [-226.792] (-227.751) (-227.649) * (-231.790) [-226.987] (-232.170) (-232.855) -- 0:00:32
      504500 -- [-226.584] (-226.330) (-227.706) (-227.592) * [-226.653] (-227.484) (-228.344) (-227.362) -- 0:00:32
      505000 -- (-228.549) [-227.387] (-228.457) (-227.485) * (-228.328) (-228.668) (-226.926) [-230.771] -- 0:00:32

      Average standard deviation of split frequencies: 0.011180

      505500 -- (-231.104) (-227.294) (-229.399) [-227.999] * (-228.766) (-226.603) (-226.018) [-237.909] -- 0:00:32
      506000 -- [-227.259] (-234.772) (-227.870) (-227.225) * (-227.901) (-226.158) (-227.384) [-228.235] -- 0:00:32
      506500 -- (-229.986) [-227.690] (-227.146) (-227.217) * (-228.145) (-230.409) (-229.033) [-230.512] -- 0:00:32
      507000 -- (-229.145) (-230.836) (-228.205) [-229.985] * (-226.761) (-230.374) [-228.254] (-225.839) -- 0:00:32
      507500 -- (-228.705) (-229.717) [-227.415] (-227.977) * [-226.674] (-230.505) (-229.546) (-229.070) -- 0:00:32
      508000 -- (-227.075) (-228.076) (-227.917) [-228.689] * (-230.884) [-227.679] (-228.836) (-227.301) -- 0:00:31
      508500 -- [-228.254] (-227.414) (-228.563) (-229.621) * [-228.537] (-228.741) (-226.872) (-227.839) -- 0:00:31
      509000 -- (-229.830) (-227.347) (-226.304) [-227.211] * [-227.816] (-226.242) (-228.930) (-228.692) -- 0:00:31
      509500 -- (-228.954) (-225.671) (-227.006) [-229.246] * (-227.134) (-228.583) [-229.404] (-226.892) -- 0:00:31
      510000 -- (-228.748) (-227.631) [-231.478] (-226.314) * [-230.227] (-226.738) (-227.168) (-228.315) -- 0:00:31

      Average standard deviation of split frequencies: 0.010752

      510500 -- (-230.366) [-226.198] (-234.271) (-229.056) * [-230.325] (-225.900) (-228.346) (-228.337) -- 0:00:31
      511000 -- (-227.850) (-227.864) [-228.787] (-227.319) * (-228.940) [-226.301] (-228.253) (-231.164) -- 0:00:31
      511500 -- (-229.641) [-226.883] (-227.934) (-234.463) * (-228.668) (-231.356) [-226.969] (-226.619) -- 0:00:31
      512000 -- (-227.693) (-226.503) [-225.971] (-227.213) * [-229.638] (-228.608) (-227.919) (-228.519) -- 0:00:31
      512500 -- (-227.662) [-229.440] (-227.212) (-226.901) * (-227.375) (-226.670) (-225.877) [-228.099] -- 0:00:31
      513000 -- (-228.964) [-227.588] (-227.132) (-227.525) * [-226.698] (-226.817) (-226.996) (-227.199) -- 0:00:31
      513500 -- [-228.217] (-226.369) (-230.722) (-227.178) * (-229.293) (-227.114) [-226.239] (-226.977) -- 0:00:32
      514000 -- (-230.527) (-227.579) (-228.977) [-226.685] * [-229.686] (-228.614) (-225.621) (-229.396) -- 0:00:32
      514500 -- (-227.534) (-231.433) (-229.704) [-227.088] * [-228.183] (-228.115) (-226.864) (-230.466) -- 0:00:32
      515000 -- [-227.886] (-227.732) (-229.651) (-228.767) * (-226.975) (-227.436) (-228.138) [-229.963] -- 0:00:32

      Average standard deviation of split frequencies: 0.010221

      515500 -- [-228.258] (-227.210) (-229.366) (-228.046) * (-226.397) [-227.807] (-229.090) (-229.007) -- 0:00:31
      516000 -- (-226.036) (-226.360) (-229.287) [-226.114] * (-226.506) (-228.258) [-226.746] (-226.409) -- 0:00:31
      516500 -- [-226.372] (-228.587) (-228.226) (-226.755) * [-226.900] (-226.118) (-230.439) (-226.069) -- 0:00:31
      517000 -- (-229.102) [-228.756] (-228.619) (-228.208) * [-228.788] (-228.545) (-228.764) (-226.070) -- 0:00:31
      517500 -- (-234.066) [-230.975] (-226.203) (-228.926) * [-226.585] (-228.575) (-228.460) (-230.604) -- 0:00:31
      518000 -- [-228.112] (-227.754) (-228.073) (-228.892) * (-226.305) [-228.393] (-228.156) (-228.643) -- 0:00:31
      518500 -- (-226.767) (-230.544) [-226.418] (-226.308) * [-225.802] (-229.033) (-226.769) (-229.948) -- 0:00:31
      519000 -- [-227.413] (-226.923) (-227.359) (-227.177) * (-226.860) [-227.730] (-229.853) (-227.688) -- 0:00:31
      519500 -- (-227.384) (-226.727) [-227.956] (-228.564) * (-229.484) (-226.103) (-226.737) [-227.065] -- 0:00:31
      520000 -- (-227.506) [-228.832] (-228.892) (-227.613) * (-229.529) (-229.860) (-227.427) [-226.877] -- 0:00:31

      Average standard deviation of split frequencies: 0.009676

      520500 -- (-229.076) (-226.593) [-228.757] (-227.762) * [-227.607] (-238.272) (-227.952) (-225.604) -- 0:00:31
      521000 -- [-227.917] (-227.293) (-227.819) (-226.173) * (-227.351) (-228.258) (-228.063) [-226.155] -- 0:00:31
      521500 -- [-227.879] (-227.342) (-228.000) (-226.422) * (-228.879) (-228.834) (-226.839) [-227.719] -- 0:00:31
      522000 -- [-226.452] (-227.615) (-226.542) (-228.401) * (-229.027) (-230.353) (-225.612) [-226.334] -- 0:00:31
      522500 -- [-228.706] (-230.881) (-227.617) (-227.933) * (-228.848) [-226.847] (-230.048) (-227.330) -- 0:00:31
      523000 -- (-226.438) (-228.616) (-228.050) [-227.648] * [-229.144] (-228.762) (-228.016) (-225.954) -- 0:00:31
      523500 -- [-226.611] (-227.660) (-232.680) (-228.748) * [-227.688] (-228.068) (-227.242) (-228.116) -- 0:00:30
      524000 -- [-226.638] (-226.929) (-227.656) (-226.857) * (-229.909) [-227.413] (-225.608) (-226.945) -- 0:00:30
      524500 -- (-230.939) (-226.996) (-226.576) [-227.035] * (-232.851) (-228.139) (-229.286) [-229.070] -- 0:00:30
      525000 -- [-227.341] (-229.016) (-230.081) (-227.500) * (-228.096) [-226.056] (-228.732) (-226.659) -- 0:00:30

      Average standard deviation of split frequencies: 0.009858

      525500 -- [-229.602] (-226.962) (-229.212) (-232.111) * (-233.380) (-227.790) [-225.968] (-226.038) -- 0:00:30
      526000 -- [-227.633] (-227.227) (-228.604) (-230.227) * (-229.868) [-228.464] (-226.318) (-227.343) -- 0:00:30
      526500 -- (-226.066) (-228.086) [-232.090] (-226.831) * [-227.601] (-230.988) (-226.554) (-225.850) -- 0:00:30
      527000 -- [-226.437] (-230.664) (-228.197) (-227.957) * (-227.046) [-230.122] (-227.075) (-226.787) -- 0:00:30
      527500 -- (-230.939) (-228.403) (-226.953) [-230.397] * (-226.373) (-229.930) [-227.050] (-227.921) -- 0:00:30
      528000 -- (-230.972) (-228.249) [-230.770] (-231.926) * (-228.152) [-226.137] (-229.235) (-235.648) -- 0:00:30
      528500 -- (-228.336) [-228.237] (-225.812) (-227.716) * (-226.432) (-226.233) [-231.148] (-231.011) -- 0:00:30
      529000 -- (-228.281) (-231.062) [-231.513] (-227.148) * (-231.939) (-229.409) [-229.928] (-227.846) -- 0:00:30
      529500 -- (-227.860) [-227.000] (-229.984) (-229.226) * (-229.284) (-226.110) [-227.564] (-228.470) -- 0:00:30
      530000 -- (-226.336) (-228.168) [-227.072] (-228.697) * [-226.371] (-225.974) (-227.659) (-231.056) -- 0:00:30

      Average standard deviation of split frequencies: 0.009716

      530500 -- (-226.686) (-228.240) [-227.020] (-226.128) * (-227.910) (-231.625) [-225.823] (-229.546) -- 0:00:30
      531000 -- [-227.667] (-227.611) (-226.427) (-228.229) * (-227.674) (-227.564) [-226.553] (-228.272) -- 0:00:30
      531500 -- [-232.693] (-230.032) (-231.894) (-232.163) * (-228.477) (-229.430) [-228.004] (-227.889) -- 0:00:30
      532000 -- (-229.020) [-227.827] (-228.034) (-229.229) * [-226.000] (-227.458) (-228.424) (-228.385) -- 0:00:30
      532500 -- (-229.278) [-228.130] (-230.939) (-226.458) * [-226.637] (-230.451) (-229.356) (-226.686) -- 0:00:30
      533000 -- (-227.759) [-230.505] (-228.247) (-225.908) * (-225.946) [-228.704] (-229.025) (-227.151) -- 0:00:30
      533500 -- (-227.672) (-231.167) (-226.038) [-225.709] * (-226.838) (-226.511) [-225.920] (-226.897) -- 0:00:30
      534000 -- [-228.248] (-228.032) (-227.577) (-227.140) * [-230.294] (-228.353) (-225.848) (-231.238) -- 0:00:30
      534500 -- (-228.216) (-230.142) (-226.765) [-226.848] * (-230.098) (-229.907) (-226.728) [-225.801] -- 0:00:30
      535000 -- (-225.962) (-228.047) (-227.520) [-226.467] * (-227.931) [-227.393] (-227.752) (-227.816) -- 0:00:30

      Average standard deviation of split frequencies: 0.008905

      535500 -- [-227.807] (-228.518) (-227.529) (-230.735) * (-228.360) [-227.972] (-227.520) (-227.595) -- 0:00:30
      536000 -- (-229.343) (-228.490) (-230.699) [-226.612] * [-229.258] (-230.691) (-226.361) (-230.707) -- 0:00:30
      536500 -- (-228.096) (-227.277) [-228.734] (-226.709) * (-229.729) (-228.700) [-227.326] (-229.583) -- 0:00:30
      537000 -- (-229.122) (-226.852) [-225.946] (-227.701) * (-227.811) [-226.927] (-230.642) (-230.630) -- 0:00:30
      537500 -- (-226.944) (-227.775) (-226.894) [-228.896] * (-228.046) (-231.289) (-227.104) [-227.214] -- 0:00:30
      538000 -- (-226.764) [-228.859] (-229.868) (-227.048) * (-228.196) [-227.854] (-227.306) (-231.154) -- 0:00:30
      538500 -- [-226.534] (-227.973) (-226.519) (-228.499) * [-227.307] (-226.837) (-226.242) (-228.666) -- 0:00:29
      539000 -- (-227.340) [-228.818] (-225.709) (-227.706) * (-228.528) [-227.410] (-226.368) (-228.824) -- 0:00:29
      539500 -- (-228.107) [-228.069] (-228.916) (-229.348) * (-231.720) (-227.161) (-227.935) [-227.762] -- 0:00:29
      540000 -- [-226.840] (-225.783) (-230.865) (-226.833) * (-225.852) [-228.256] (-231.381) (-227.541) -- 0:00:29

      Average standard deviation of split frequencies: 0.008882

      540500 -- [-226.149] (-226.365) (-228.227) (-226.055) * [-226.602] (-226.677) (-232.662) (-227.192) -- 0:00:29
      541000 -- (-226.959) (-227.583) (-229.129) [-228.879] * (-226.260) (-226.108) [-229.933] (-225.841) -- 0:00:29
      541500 -- (-226.216) (-229.533) (-226.711) [-226.218] * (-228.651) [-227.859] (-234.258) (-227.296) -- 0:00:29
      542000 -- (-226.759) [-228.979] (-227.121) (-227.432) * (-230.644) (-229.295) (-229.299) [-227.728] -- 0:00:29
      542500 -- [-228.395] (-228.339) (-228.471) (-231.244) * (-229.402) (-226.213) (-227.744) [-226.589] -- 0:00:29
      543000 -- (-228.702) (-225.903) [-228.186] (-232.316) * [-228.773] (-227.863) (-227.567) (-230.793) -- 0:00:29
      543500 -- [-229.090] (-229.085) (-229.354) (-232.161) * (-228.847) (-227.835) (-227.458) [-227.511] -- 0:00:29
      544000 -- (-229.248) (-225.995) [-227.621] (-227.469) * [-230.075] (-227.119) (-226.191) (-228.143) -- 0:00:29
      544500 -- (-229.816) (-226.469) [-227.120] (-228.758) * (-229.548) (-227.001) [-231.025] (-229.979) -- 0:00:29
      545000 -- (-233.342) (-228.287) (-227.596) [-227.390] * (-227.576) (-227.284) (-227.250) [-226.970] -- 0:00:29

      Average standard deviation of split frequencies: 0.009012

      545500 -- (-228.379) (-227.900) (-227.781) [-226.338] * (-227.036) (-225.699) [-231.331] (-229.336) -- 0:00:29
      546000 -- (-231.779) [-230.158] (-229.638) (-227.565) * (-227.675) (-227.401) [-225.938] (-230.037) -- 0:00:29
      546500 -- [-227.762] (-227.597) (-227.259) (-227.673) * (-227.112) [-225.835] (-229.274) (-226.871) -- 0:00:29
      547000 -- (-231.235) (-226.889) (-226.581) [-231.054] * (-226.764) [-228.875] (-228.302) (-226.802) -- 0:00:29
      547500 -- (-229.085) (-228.062) [-227.942] (-228.758) * (-227.083) [-230.951] (-228.431) (-226.721) -- 0:00:29
      548000 -- (-227.950) (-229.259) [-229.671] (-225.936) * (-230.696) [-228.367] (-226.282) (-227.899) -- 0:00:29
      548500 -- (-230.172) (-229.966) [-228.896] (-227.244) * [-229.324] (-227.856) (-229.206) (-227.666) -- 0:00:29
      549000 -- (-227.841) (-231.842) [-230.032] (-229.784) * (-227.286) [-228.273] (-227.074) (-226.876) -- 0:00:29
      549500 -- [-226.543] (-229.016) (-226.640) (-229.753) * (-228.260) (-228.042) (-228.307) [-226.882] -- 0:00:29
      550000 -- (-227.947) [-227.158] (-228.390) (-225.774) * (-228.242) (-226.643) [-228.295] (-227.108) -- 0:00:29

      Average standard deviation of split frequencies: 0.008614

      550500 -- (-231.539) [-226.554] (-227.404) (-229.027) * (-229.963) [-227.670] (-227.622) (-228.448) -- 0:00:29
      551000 -- (-229.846) [-226.543] (-227.614) (-229.136) * (-232.230) (-229.440) [-225.923] (-227.785) -- 0:00:29
      551500 -- [-230.582] (-227.504) (-228.378) (-228.347) * (-227.531) [-228.000] (-227.865) (-226.616) -- 0:00:29
      552000 -- [-229.314] (-230.130) (-230.687) (-229.046) * (-228.893) (-226.576) (-227.030) [-226.305] -- 0:00:29
      552500 -- (-227.371) (-230.047) [-231.298] (-227.432) * [-228.568] (-230.217) (-228.407) (-228.567) -- 0:00:29
      553000 -- (-227.109) (-226.482) (-237.831) [-227.053] * [-226.660] (-229.807) (-231.289) (-230.753) -- 0:00:29
      553500 -- (-227.647) (-226.746) [-226.971] (-227.966) * (-230.838) (-225.858) [-231.417] (-230.916) -- 0:00:29
      554000 -- (-228.472) [-226.544] (-227.287) (-227.182) * (-226.930) (-228.303) [-227.334] (-231.103) -- 0:00:28
      554500 -- [-227.176] (-228.397) (-227.189) (-230.576) * (-230.815) [-226.637] (-228.232) (-230.114) -- 0:00:28
      555000 -- (-227.945) (-229.331) [-228.476] (-230.467) * (-225.890) (-225.976) (-225.953) [-228.513] -- 0:00:28

      Average standard deviation of split frequencies: 0.008030

      555500 -- [-226.649] (-225.714) (-229.103) (-228.335) * (-226.449) [-226.849] (-231.275) (-225.736) -- 0:00:28
      556000 -- (-234.464) (-227.917) (-228.014) [-229.215] * (-228.784) [-227.184] (-228.228) (-228.974) -- 0:00:28
      556500 -- (-228.270) [-227.392] (-227.006) (-229.266) * (-228.023) [-227.526] (-228.953) (-228.984) -- 0:00:28
      557000 -- (-228.590) (-227.522) (-227.161) [-227.845] * (-227.015) (-228.784) (-227.746) [-228.608] -- 0:00:28
      557500 -- [-226.641] (-227.341) (-227.105) (-226.628) * (-229.499) (-226.594) (-229.858) [-228.636] -- 0:00:28
      558000 -- (-228.847) (-229.744) (-228.436) [-227.685] * (-227.916) (-229.756) (-226.739) [-228.311] -- 0:00:28
      558500 -- (-228.382) [-231.719] (-228.435) (-227.234) * [-226.762] (-226.095) (-231.166) (-228.507) -- 0:00:28
      559000 -- (-228.651) [-226.478] (-227.524) (-227.839) * (-225.983) [-225.695] (-226.588) (-227.896) -- 0:00:28
      559500 -- (-225.940) [-227.608] (-226.173) (-226.047) * (-230.467) (-226.822) [-226.058] (-227.000) -- 0:00:28
      560000 -- (-228.549) (-227.694) (-227.558) [-229.445] * [-228.174] (-226.272) (-228.822) (-226.498) -- 0:00:28

      Average standard deviation of split frequencies: 0.007617

      560500 -- (-227.371) [-229.768] (-227.388) (-230.107) * [-227.236] (-227.447) (-226.036) (-230.952) -- 0:00:28
      561000 -- (-232.613) [-226.970] (-226.985) (-226.947) * (-226.440) (-233.907) [-226.742] (-228.786) -- 0:00:28
      561500 -- (-226.956) (-228.726) [-231.228] (-229.402) * (-228.942) [-229.373] (-226.325) (-230.374) -- 0:00:28
      562000 -- (-227.446) [-229.995] (-229.731) (-229.217) * (-227.299) [-226.751] (-226.783) (-226.899) -- 0:00:28
      562500 -- [-226.884] (-227.785) (-230.931) (-230.608) * (-227.686) [-232.974] (-226.260) (-227.682) -- 0:00:28
      563000 -- (-230.718) (-228.395) (-230.217) [-226.231] * (-227.120) [-229.586] (-225.883) (-225.572) -- 0:00:28
      563500 -- (-228.593) (-228.723) (-232.774) [-232.219] * [-229.287] (-236.483) (-226.660) (-226.013) -- 0:00:28
      564000 -- (-227.369) (-228.228) [-228.051] (-227.004) * [-227.982] (-226.351) (-227.345) (-225.849) -- 0:00:28
      564500 -- (-227.397) [-226.361] (-226.821) (-228.249) * [-228.238] (-226.225) (-227.397) (-227.311) -- 0:00:28
      565000 -- (-231.340) (-230.102) [-226.207] (-229.928) * (-229.278) (-228.421) [-228.746] (-225.777) -- 0:00:28

      Average standard deviation of split frequencies: 0.007692

      565500 -- (-227.046) [-226.715] (-226.561) (-230.917) * [-228.827] (-229.643) (-229.483) (-226.354) -- 0:00:28
      566000 -- (-229.382) (-227.216) [-226.451] (-229.651) * [-227.750] (-226.740) (-226.506) (-225.677) -- 0:00:28
      566500 -- [-226.322] (-228.263) (-228.764) (-228.360) * [-226.018] (-226.083) (-228.777) (-227.086) -- 0:00:28
      567000 -- (-227.381) (-228.273) (-227.380) [-231.562] * (-227.718) (-226.843) (-231.819) [-227.940] -- 0:00:28
      567500 -- (-228.286) (-228.771) (-229.768) [-228.404] * (-228.730) [-226.818] (-227.763) (-236.707) -- 0:00:28
      568000 -- (-229.249) (-228.990) (-227.656) [-227.839] * (-229.512) (-232.343) (-229.317) [-226.622] -- 0:00:28
      568500 -- (-226.364) (-226.502) [-226.013] (-229.522) * (-227.480) (-230.208) [-228.154] (-230.127) -- 0:00:28
      569000 -- [-227.915] (-229.814) (-225.900) (-227.614) * (-226.529) [-229.142] (-227.275) (-232.319) -- 0:00:28
      569500 -- (-227.398) (-225.967) (-225.880) [-228.837] * (-226.407) (-228.559) (-228.518) [-226.800] -- 0:00:27
      570000 -- (-228.026) (-228.671) [-228.273] (-226.572) * (-227.845) (-227.325) (-228.504) [-225.853] -- 0:00:27

      Average standard deviation of split frequencies: 0.007228

      570500 -- (-235.071) (-226.926) [-226.124] (-227.024) * (-229.751) (-227.033) (-228.281) [-226.492] -- 0:00:27
      571000 -- (-228.187) (-231.684) [-228.030] (-228.748) * (-231.022) (-227.918) (-227.520) [-226.518] -- 0:00:27
      571500 -- (-226.326) (-231.579) (-228.782) [-228.539] * [-232.462] (-228.684) (-228.640) (-226.466) -- 0:00:27
      572000 -- (-228.135) (-229.854) [-226.805] (-228.863) * (-226.686) [-226.074] (-225.789) (-227.302) -- 0:00:27
      572500 -- [-231.507] (-226.720) (-226.355) (-228.512) * (-226.354) (-227.402) [-226.923] (-227.246) -- 0:00:27
      573000 -- (-227.495) [-227.880] (-225.627) (-228.688) * [-226.699] (-228.786) (-226.998) (-227.776) -- 0:00:27
      573500 -- (-227.886) [-226.959] (-226.083) (-233.526) * (-227.646) (-227.385) [-227.002] (-229.261) -- 0:00:27
      574000 -- (-228.448) [-227.119] (-230.403) (-227.317) * (-226.917) (-227.387) [-228.764] (-229.098) -- 0:00:27
      574500 -- [-229.222] (-228.386) (-226.390) (-229.882) * (-228.484) (-226.868) [-229.904] (-230.925) -- 0:00:28
      575000 -- (-228.556) (-227.578) [-226.353] (-227.629) * [-228.494] (-226.422) (-226.812) (-228.463) -- 0:00:28

      Average standard deviation of split frequencies: 0.007468

      575500 -- (-226.272) [-225.631] (-231.133) (-229.189) * (-226.154) (-229.362) [-230.670] (-229.599) -- 0:00:28
      576000 -- (-227.133) (-227.983) (-227.495) [-230.020] * (-226.193) (-232.458) (-228.605) [-227.694] -- 0:00:27
      576500 -- (-226.427) [-228.650] (-227.789) (-228.626) * [-226.329] (-227.375) (-229.049) (-232.738) -- 0:00:27
      577000 -- (-226.391) [-230.043] (-227.302) (-229.186) * [-228.715] (-227.535) (-227.599) (-226.573) -- 0:00:27
      577500 -- (-228.358) (-230.343) [-226.935] (-229.661) * [-227.861] (-232.905) (-230.035) (-226.867) -- 0:00:27
      578000 -- (-228.965) (-229.427) [-226.190] (-229.141) * (-227.533) (-228.728) [-228.954] (-225.833) -- 0:00:27
      578500 -- [-227.250] (-226.380) (-226.732) (-227.088) * [-227.300] (-226.746) (-226.739) (-227.468) -- 0:00:27
      579000 -- [-227.036] (-227.935) (-227.130) (-226.152) * (-227.076) (-226.750) [-226.819] (-228.889) -- 0:00:27
      579500 -- [-228.439] (-226.855) (-228.050) (-227.601) * (-227.162) (-227.760) [-227.597] (-229.563) -- 0:00:27
      580000 -- (-226.932) (-226.417) (-227.424) [-225.722] * [-226.305] (-240.331) (-227.103) (-227.232) -- 0:00:27

      Average standard deviation of split frequencies: 0.007104

      580500 -- [-226.956] (-226.831) (-228.268) (-227.072) * [-227.348] (-230.225) (-227.844) (-229.125) -- 0:00:27
      581000 -- (-226.884) (-231.350) (-226.305) [-229.633] * (-227.048) (-229.337) (-228.191) [-226.657] -- 0:00:27
      581500 -- [-229.535] (-233.076) (-231.361) (-227.227) * (-225.814) (-229.642) (-230.657) [-228.245] -- 0:00:27
      582000 -- (-226.660) (-233.444) (-230.267) [-228.907] * (-227.607) [-232.272] (-228.450) (-232.609) -- 0:00:27
      582500 -- (-230.472) [-226.643] (-226.850) (-228.430) * (-234.879) (-229.760) (-228.620) [-228.050] -- 0:00:27
      583000 -- (-231.951) (-230.314) [-229.222] (-227.803) * (-226.597) (-226.294) (-230.346) [-226.419] -- 0:00:27
      583500 -- (-228.745) [-228.777] (-229.659) (-228.199) * (-226.108) (-230.329) (-226.476) [-227.134] -- 0:00:27
      584000 -- (-226.801) [-226.334] (-225.585) (-226.717) * (-229.676) (-228.211) [-228.321] (-228.570) -- 0:00:27
      584500 -- (-228.632) (-225.955) (-228.070) [-227.318] * (-226.398) (-226.895) [-228.022] (-227.734) -- 0:00:27
      585000 -- (-226.277) [-226.934] (-229.563) (-228.886) * (-226.881) [-227.623] (-228.917) (-228.887) -- 0:00:26

      Average standard deviation of split frequencies: 0.006719

      585500 -- (-228.298) (-227.331) (-229.494) [-227.206] * [-228.762] (-230.275) (-227.865) (-226.565) -- 0:00:26
      586000 -- [-231.726] (-227.317) (-228.108) (-226.562) * (-226.933) (-228.634) (-226.098) [-226.689] -- 0:00:26
      586500 -- (-227.592) (-226.058) (-227.782) [-226.190] * (-226.051) (-232.339) [-227.032] (-227.670) -- 0:00:26
      587000 -- (-230.160) (-226.802) [-227.297] (-226.941) * (-227.346) (-228.566) (-228.189) [-227.036] -- 0:00:26
      587500 -- (-227.498) (-230.868) [-227.862] (-227.640) * (-227.214) [-229.424] (-227.967) (-229.296) -- 0:00:26
      588000 -- (-228.804) (-227.915) (-226.167) [-228.168] * (-226.727) (-226.962) (-230.441) [-226.193] -- 0:00:26
      588500 -- (-228.696) (-227.994) [-226.820] (-226.997) * (-228.018) (-226.716) (-229.224) [-226.746] -- 0:00:26
      589000 -- (-226.966) (-227.008) [-227.368] (-227.355) * (-230.568) [-227.585] (-228.619) (-229.341) -- 0:00:26
      589500 -- [-227.333] (-228.616) (-227.842) (-227.232) * (-228.255) [-227.271] (-230.439) (-225.658) -- 0:00:27
      590000 -- (-228.604) [-226.115] (-227.423) (-225.841) * [-230.050] (-227.437) (-229.844) (-227.407) -- 0:00:27

      Average standard deviation of split frequencies: 0.008380

      590500 -- (-230.163) (-230.112) [-225.810] (-227.682) * (-229.268) (-227.820) (-228.029) [-227.492] -- 0:00:27
      591000 -- (-229.684) (-228.256) [-229.557] (-227.427) * (-229.300) [-228.096] (-229.058) (-226.025) -- 0:00:26
      591500 -- (-228.459) (-227.588) [-226.756] (-228.099) * (-228.471) (-229.789) (-228.198) [-226.571] -- 0:00:26
      592000 -- (-232.402) (-228.446) [-228.318] (-226.931) * [-227.801] (-228.162) (-228.130) (-233.772) -- 0:00:26
      592500 -- (-228.596) [-228.417] (-232.981) (-227.696) * (-227.245) (-234.529) (-227.098) [-228.360] -- 0:00:26
      593000 -- (-229.438) (-227.765) (-227.866) [-227.081] * (-228.182) [-229.722] (-230.528) (-228.614) -- 0:00:26
      593500 -- [-226.721] (-230.700) (-226.269) (-230.202) * [-226.591] (-227.034) (-226.010) (-227.785) -- 0:00:26
      594000 -- [-227.790] (-234.768) (-228.836) (-228.465) * (-226.643) [-227.679] (-227.329) (-228.474) -- 0:00:26
      594500 -- (-227.344) (-234.747) [-226.071] (-232.068) * (-225.984) (-229.274) (-229.685) [-227.303] -- 0:00:26
      595000 -- [-228.194] (-227.296) (-226.345) (-228.333) * (-227.118) [-228.969] (-233.938) (-227.580) -- 0:00:26

      Average standard deviation of split frequencies: 0.009145

      595500 -- [-231.157] (-227.754) (-226.591) (-232.816) * (-229.190) (-228.085) (-228.556) [-228.035] -- 0:00:26
      596000 -- (-233.606) [-226.485] (-227.551) (-228.763) * (-231.956) (-226.565) (-226.462) [-227.351] -- 0:00:26
      596500 -- (-229.876) [-226.216] (-227.684) (-228.704) * (-232.054) (-228.897) [-228.201] (-229.262) -- 0:00:26
      597000 -- (-236.710) (-228.757) (-227.542) [-227.419] * [-229.010] (-227.559) (-228.404) (-229.221) -- 0:00:26
      597500 -- (-226.924) (-231.590) [-226.425] (-228.014) * (-227.419) (-226.322) (-227.099) [-226.138] -- 0:00:26
      598000 -- [-227.689] (-229.060) (-227.635) (-230.049) * (-227.361) [-226.061] (-226.950) (-230.953) -- 0:00:26
      598500 -- (-227.630) [-229.233] (-227.183) (-226.324) * (-228.103) (-226.804) [-226.072] (-229.685) -- 0:00:26
      599000 -- (-227.749) (-230.493) [-227.180] (-228.286) * (-227.442) (-226.346) [-226.276] (-230.012) -- 0:00:26
      599500 -- (-228.026) [-227.776] (-226.117) (-226.248) * (-227.600) [-225.698] (-226.275) (-226.922) -- 0:00:26
      600000 -- [-227.411] (-232.575) (-227.257) (-230.681) * (-227.058) [-228.043] (-226.486) (-226.685) -- 0:00:25

      Average standard deviation of split frequencies: 0.008976

      600500 -- (-226.897) (-229.023) [-227.400] (-228.525) * (-227.329) (-226.020) (-228.577) [-227.486] -- 0:00:25
      601000 -- (-227.234) (-228.997) [-229.167] (-232.176) * [-226.656] (-226.614) (-226.785) (-226.530) -- 0:00:25
      601500 -- (-232.649) (-227.807) (-232.994) [-226.987] * (-229.443) [-226.826] (-227.984) (-232.762) -- 0:00:25
      602000 -- (-229.722) (-228.340) [-227.278] (-226.822) * (-228.007) (-226.789) [-226.673] (-226.879) -- 0:00:25
      602500 -- (-227.897) (-227.312) (-226.450) [-226.282] * (-230.396) [-226.585] (-227.886) (-230.349) -- 0:00:25
      603000 -- (-229.514) [-231.531] (-226.222) (-226.380) * (-228.892) [-227.174] (-232.144) (-228.521) -- 0:00:25
      603500 -- (-226.067) (-230.662) [-227.413] (-227.449) * (-227.342) (-226.668) [-230.707] (-230.385) -- 0:00:25
      604000 -- (-226.211) (-229.122) [-226.428] (-229.641) * (-226.628) (-232.140) (-231.687) [-229.812] -- 0:00:25
      604500 -- [-228.274] (-227.140) (-229.682) (-226.421) * (-227.132) (-228.236) (-226.207) [-227.837] -- 0:00:25
      605000 -- (-227.774) (-228.407) (-230.827) [-230.391] * (-227.004) (-229.513) (-227.598) [-226.995] -- 0:00:25

      Average standard deviation of split frequencies: 0.008557

      605500 -- (-226.667) (-227.410) [-227.322] (-226.341) * (-229.228) [-229.894] (-228.018) (-228.292) -- 0:00:25
      606000 -- (-227.223) (-229.030) (-227.714) [-226.299] * [-227.238] (-227.927) (-228.504) (-227.659) -- 0:00:26
      606500 -- (-226.078) [-228.130] (-226.474) (-225.825) * (-225.561) (-227.235) [-227.199] (-226.053) -- 0:00:25
      607000 -- (-226.697) [-227.777] (-227.972) (-226.440) * (-225.896) (-226.960) [-226.533] (-226.489) -- 0:00:25
      607500 -- (-227.678) (-226.867) (-225.672) [-225.984] * (-228.867) (-230.793) (-226.360) [-226.438] -- 0:00:25
      608000 -- (-228.904) (-228.141) (-229.042) [-227.533] * (-228.752) (-227.563) (-228.152) [-225.948] -- 0:00:25
      608500 -- (-227.784) (-227.256) (-227.256) [-227.998] * (-227.451) [-229.441] (-229.492) (-227.676) -- 0:00:25
      609000 -- (-226.635) (-227.845) [-230.123] (-230.192) * (-227.077) [-228.812] (-231.229) (-229.030) -- 0:00:25
      609500 -- (-226.483) (-231.102) [-228.018] (-227.778) * (-228.372) (-230.811) [-228.554] (-228.809) -- 0:00:25
      610000 -- (-227.199) (-229.404) [-227.915] (-226.177) * (-228.278) (-226.067) [-228.062] (-231.584) -- 0:00:25

      Average standard deviation of split frequencies: 0.008781

      610500 -- [-230.845] (-227.910) (-228.602) (-227.004) * [-225.948] (-227.153) (-226.609) (-228.476) -- 0:00:25
      611000 -- (-228.510) [-227.545] (-229.247) (-227.457) * (-227.833) [-228.256] (-228.518) (-226.993) -- 0:00:25
      611500 -- (-227.391) [-227.081] (-227.456) (-227.992) * (-231.878) (-227.819) (-226.426) [-228.295] -- 0:00:25
      612000 -- (-228.402) (-228.731) (-226.620) [-229.082] * (-234.658) (-226.726) (-226.171) [-226.857] -- 0:00:25
      612500 -- [-226.262] (-228.739) (-226.963) (-227.045) * (-231.860) [-226.616] (-226.938) (-226.874) -- 0:00:25
      613000 -- (-228.389) (-229.471) (-227.108) [-226.450] * (-226.848) (-226.400) [-229.934] (-227.287) -- 0:00:25
      613500 -- (-227.861) (-228.462) [-227.660] (-225.735) * (-228.324) (-226.747) [-227.699] (-228.422) -- 0:00:25
      614000 -- (-231.877) (-226.361) (-226.655) [-228.424] * (-234.125) (-228.702) [-228.269] (-227.144) -- 0:00:25
      614500 -- (-227.743) [-226.454] (-226.217) (-226.684) * [-226.793] (-227.377) (-230.110) (-232.393) -- 0:00:25
      615000 -- (-231.881) (-231.401) [-227.663] (-227.437) * (-227.511) [-225.898] (-230.691) (-226.928) -- 0:00:25

      Average standard deviation of split frequencies: 0.009088

      615500 -- (-233.316) [-228.817] (-230.360) (-229.213) * [-229.410] (-226.394) (-230.705) (-227.578) -- 0:00:24
      616000 -- [-229.764] (-227.404) (-227.265) (-227.319) * (-227.434) (-228.816) [-231.683] (-232.280) -- 0:00:24
      616500 -- (-226.799) (-226.588) (-229.414) [-226.533] * [-229.503] (-228.328) (-231.228) (-227.544) -- 0:00:24
      617000 -- (-225.961) (-225.548) [-230.738] (-227.509) * (-226.553) (-226.918) [-227.932] (-227.589) -- 0:00:24
      617500 -- (-228.401) [-226.573] (-233.417) (-227.966) * (-229.655) (-226.186) (-228.565) [-227.058] -- 0:00:24
      618000 -- (-227.006) (-228.126) (-227.689) [-226.153] * (-227.555) (-228.692) [-229.674] (-226.661) -- 0:00:24
      618500 -- (-228.828) [-225.760] (-230.328) (-227.212) * (-226.962) [-228.941] (-228.707) (-227.378) -- 0:00:24
      619000 -- (-228.901) (-226.800) (-232.898) [-230.908] * (-227.642) (-229.573) (-228.364) [-226.996] -- 0:00:24
      619500 -- (-227.586) (-226.748) [-226.491] (-226.203) * (-228.821) [-228.215] (-227.419) (-226.064) -- 0:00:24
      620000 -- (-229.350) (-230.945) (-228.941) [-227.448] * [-226.225] (-230.516) (-227.165) (-225.804) -- 0:00:24

      Average standard deviation of split frequencies: 0.009114

      620500 -- (-228.864) (-226.869) [-228.109] (-227.446) * (-230.655) (-226.638) [-228.431] (-226.192) -- 0:00:25
      621000 -- (-229.179) (-227.185) [-227.099] (-229.906) * (-229.607) [-226.149] (-228.325) (-226.442) -- 0:00:25
      621500 -- (-227.947) [-226.233] (-226.111) (-227.828) * (-228.657) (-227.728) (-228.194) [-229.342] -- 0:00:24
      622000 -- (-228.393) (-228.918) [-226.912] (-226.151) * (-229.708) (-229.133) [-230.008] (-226.378) -- 0:00:24
      622500 -- [-226.043] (-228.982) (-226.627) (-226.530) * (-232.359) (-230.596) [-228.500] (-230.139) -- 0:00:24
      623000 -- (-226.823) (-229.663) (-230.183) [-228.305] * (-226.234) [-230.790] (-227.882) (-229.161) -- 0:00:24
      623500 -- (-226.735) (-229.659) (-228.639) [-228.770] * (-226.340) (-228.735) [-227.074] (-227.981) -- 0:00:24
      624000 -- (-229.354) [-228.058] (-228.213) (-229.277) * (-227.233) (-233.053) [-228.112] (-230.415) -- 0:00:24
      624500 -- [-229.642] (-231.203) (-228.462) (-226.578) * (-227.317) (-233.393) (-228.528) [-228.388] -- 0:00:24
      625000 -- (-226.989) (-226.525) (-228.918) [-228.881] * (-226.262) (-227.634) (-231.488) [-230.322] -- 0:00:24

      Average standard deviation of split frequencies: 0.008989

      625500 -- (-227.367) [-228.153] (-231.620) (-233.863) * (-226.011) (-227.718) [-227.561] (-233.245) -- 0:00:24
      626000 -- (-226.677) [-226.058] (-229.935) (-228.168) * [-226.823] (-227.902) (-227.057) (-226.570) -- 0:00:24
      626500 -- (-227.329) (-225.672) [-226.995] (-226.918) * (-226.162) (-227.339) (-229.582) [-226.777] -- 0:00:24
      627000 -- (-227.716) [-231.007] (-227.589) (-227.222) * [-227.028] (-227.827) (-226.765) (-228.502) -- 0:00:24
      627500 -- (-230.416) [-229.946] (-228.727) (-227.803) * [-226.671] (-227.022) (-226.047) (-227.535) -- 0:00:24
      628000 -- (-227.564) (-227.021) (-231.227) [-225.765] * (-228.296) (-227.522) [-228.924] (-228.662) -- 0:00:24
      628500 -- [-229.903] (-226.145) (-234.349) (-225.777) * (-230.323) (-226.777) (-231.178) [-226.601] -- 0:00:24
      629000 -- (-226.633) (-226.370) (-226.981) [-226.374] * (-229.849) [-228.141] (-232.817) (-227.289) -- 0:00:24
      629500 -- (-227.557) (-234.139) (-227.067) [-228.124] * (-227.058) (-229.882) (-227.925) [-228.326] -- 0:00:24
      630000 -- (-228.220) (-229.379) (-229.028) [-226.606] * [-226.068] (-229.622) (-232.441) (-225.738) -- 0:00:24

      Average standard deviation of split frequencies: 0.009110

      630500 -- [-226.180] (-229.387) (-226.491) (-231.214) * [-225.968] (-229.817) (-228.670) (-226.477) -- 0:00:24
      631000 -- [-227.878] (-228.713) (-226.781) (-234.139) * [-227.057] (-226.438) (-228.085) (-229.645) -- 0:00:23
      631500 -- [-229.574] (-228.359) (-228.507) (-229.666) * (-226.084) (-227.365) (-227.513) [-226.104] -- 0:00:23
      632000 -- (-229.063) (-227.330) [-226.777] (-227.397) * (-228.936) (-226.735) (-228.715) [-228.272] -- 0:00:23
      632500 -- (-228.448) (-229.086) (-228.565) [-225.519] * [-231.696] (-227.526) (-229.995) (-227.498) -- 0:00:23
      633000 -- (-227.569) [-228.493] (-227.449) (-227.020) * [-232.603] (-230.203) (-227.352) (-226.438) -- 0:00:23
      633500 -- (-228.816) [-233.279] (-226.051) (-226.713) * (-231.871) (-230.381) [-227.758] (-226.138) -- 0:00:24
      634000 -- (-229.164) (-229.225) (-226.539) [-226.108] * (-231.869) (-226.498) (-226.405) [-226.308] -- 0:00:24
      634500 -- (-228.600) (-230.649) [-226.809] (-230.344) * (-233.881) (-226.625) [-227.039] (-228.118) -- 0:00:24
      635000 -- (-230.980) [-230.718] (-228.242) (-234.322) * (-234.204) (-228.215) (-228.736) [-229.449] -- 0:00:24

      Average standard deviation of split frequencies: 0.009404

      635500 -- (-226.513) [-229.072] (-227.649) (-233.145) * (-228.671) [-227.310] (-227.222) (-229.261) -- 0:00:24
      636000 -- (-228.405) [-225.838] (-227.304) (-229.084) * (-232.369) (-230.656) (-227.497) [-227.401] -- 0:00:24
      636500 -- (-228.426) (-228.217) (-230.652) [-230.592] * (-227.819) (-233.590) (-226.479) [-228.695] -- 0:00:23
      637000 -- [-230.057] (-228.566) (-229.691) (-230.535) * (-231.150) [-227.522] (-226.958) (-232.761) -- 0:00:23
      637500 -- (-227.255) (-229.894) (-226.010) [-226.174] * (-232.881) (-230.000) (-226.369) [-229.227] -- 0:00:23
      638000 -- [-227.704] (-229.788) (-226.471) (-225.940) * (-229.579) (-230.510) (-232.987) [-227.627] -- 0:00:23
      638500 -- [-226.251] (-229.640) (-227.186) (-225.952) * (-229.040) (-229.062) [-228.975] (-229.597) -- 0:00:23
      639000 -- [-228.035] (-229.285) (-227.396) (-227.058) * (-228.351) (-229.254) (-230.107) [-230.373] -- 0:00:23
      639500 -- [-229.472] (-228.784) (-228.880) (-228.610) * (-226.657) [-227.354] (-230.900) (-226.641) -- 0:00:23
      640000 -- (-230.218) (-225.427) [-226.158] (-226.228) * (-228.469) (-229.918) [-225.769] (-228.250) -- 0:00:23

      Average standard deviation of split frequencies: 0.009381

      640500 -- (-228.441) (-228.416) (-228.211) [-228.030] * [-229.628] (-230.361) (-227.205) (-227.459) -- 0:00:23
      641000 -- (-229.269) (-226.471) [-227.307] (-226.035) * (-231.811) [-227.060] (-226.517) (-228.503) -- 0:00:23
      641500 -- (-230.039) [-226.835] (-230.192) (-225.928) * (-226.606) (-226.631) (-229.446) [-229.308] -- 0:00:23
      642000 -- (-227.091) (-227.586) [-227.664] (-225.928) * (-226.050) (-227.303) (-225.685) [-227.477] -- 0:00:23
      642500 -- (-228.742) [-229.707] (-229.026) (-228.253) * (-230.518) [-227.038] (-226.762) (-229.633) -- 0:00:23
      643000 -- [-227.524] (-229.815) (-228.899) (-226.405) * (-229.622) (-226.757) [-228.476] (-228.741) -- 0:00:23
      643500 -- (-226.988) (-231.038) (-231.743) [-227.924] * (-229.009) [-226.791] (-229.445) (-228.899) -- 0:00:23
      644000 -- (-226.470) (-229.324) (-229.670) [-225.580] * (-227.451) (-227.517) (-229.618) [-226.590] -- 0:00:23
      644500 -- [-227.332] (-226.381) (-227.895) (-228.130) * (-227.720) (-225.933) (-230.843) [-227.453] -- 0:00:23
      645000 -- (-228.460) (-227.113) (-230.186) [-227.283] * (-226.067) (-226.451) (-225.871) [-230.059] -- 0:00:23

      Average standard deviation of split frequencies: 0.008757

      645500 -- (-229.354) (-231.475) (-228.082) [-226.497] * [-226.041] (-230.497) (-230.926) (-228.541) -- 0:00:23
      646000 -- (-231.156) (-227.446) (-227.892) [-227.457] * (-227.172) (-227.574) (-237.019) [-228.854] -- 0:00:23
      646500 -- (-228.940) (-232.852) (-227.700) [-227.276] * (-226.881) [-227.433] (-233.020) (-231.248) -- 0:00:23
      647000 -- (-226.456) [-231.213] (-225.521) (-226.844) * (-229.531) (-227.304) [-230.660] (-233.811) -- 0:00:23
      647500 -- [-225.495] (-227.088) (-226.126) (-231.996) * (-229.073) (-227.386) [-231.476] (-231.453) -- 0:00:23
      648000 -- [-225.656] (-226.982) (-226.976) (-225.783) * (-227.577) (-226.353) (-232.768) [-229.088] -- 0:00:23
      648500 -- [-227.041] (-229.170) (-229.493) (-226.395) * (-226.237) (-231.454) (-229.224) [-228.172] -- 0:00:23
      649000 -- [-226.356] (-229.905) (-227.701) (-227.568) * (-228.672) (-228.840) (-235.898) [-226.137] -- 0:00:23
      649500 -- (-230.235) [-227.841] (-227.491) (-228.750) * (-226.641) (-227.040) (-228.959) [-227.356] -- 0:00:23
      650000 -- (-231.238) (-227.333) [-227.832] (-227.516) * (-226.071) (-227.575) (-228.598) [-227.772] -- 0:00:23

      Average standard deviation of split frequencies: 0.008694

      650500 -- [-227.764] (-229.262) (-227.560) (-225.708) * (-227.588) (-230.430) (-226.087) [-229.284] -- 0:00:23
      651000 -- (-229.260) [-227.479] (-225.674) (-228.233) * (-227.847) (-229.443) (-227.479) [-229.509] -- 0:00:23
      651500 -- [-228.024] (-227.435) (-226.908) (-228.812) * [-230.773] (-229.415) (-227.035) (-228.191) -- 0:00:23
      652000 -- (-227.174) (-229.752) (-225.979) [-227.363] * (-229.423) [-227.069] (-227.475) (-228.406) -- 0:00:22
      652500 -- [-225.659] (-227.862) (-227.022) (-230.396) * [-227.298] (-230.207) (-227.369) (-226.171) -- 0:00:22
      653000 -- (-227.004) [-229.209] (-227.381) (-232.092) * [-226.158] (-227.979) (-230.122) (-228.750) -- 0:00:22
      653500 -- (-228.266) (-232.838) [-226.412] (-230.209) * (-226.058) (-227.428) (-232.645) [-226.030] -- 0:00:22
      654000 -- (-227.271) (-227.569) (-228.257) [-230.132] * (-228.398) [-228.344] (-228.316) (-226.606) -- 0:00:22
      654500 -- (-229.016) (-231.039) [-226.307] (-226.072) * (-232.336) [-230.357] (-230.020) (-229.419) -- 0:00:22
      655000 -- (-226.255) (-226.997) [-226.070] (-227.397) * (-229.523) (-231.335) [-227.668] (-230.045) -- 0:00:22

      Average standard deviation of split frequencies: 0.007521

      655500 -- (-229.787) [-227.283] (-229.867) (-226.118) * (-226.844) (-228.711) (-227.601) [-227.864] -- 0:00:22
      656000 -- (-235.222) (-230.538) (-225.764) [-229.208] * (-227.187) [-228.453] (-229.668) (-226.893) -- 0:00:22
      656500 -- [-230.110] (-225.897) (-229.892) (-229.100) * (-230.255) (-231.448) [-229.947] (-226.896) -- 0:00:22
      657000 -- (-230.348) [-226.858] (-228.500) (-229.466) * [-227.696] (-226.001) (-228.699) (-226.472) -- 0:00:22
      657500 -- [-226.346] (-225.976) (-230.438) (-227.310) * [-229.987] (-233.858) (-226.540) (-226.190) -- 0:00:22
      658000 -- (-226.395) (-230.630) (-229.181) [-229.248] * [-230.162] (-229.316) (-226.540) (-226.614) -- 0:00:22
      658500 -- (-226.354) [-229.181] (-231.450) (-227.583) * (-226.994) (-227.654) (-231.712) [-226.896] -- 0:00:22
      659000 -- (-228.976) (-227.376) (-227.961) [-232.936] * (-229.684) (-227.058) (-226.434) [-226.423] -- 0:00:22
      659500 -- (-228.816) (-226.963) [-230.812] (-235.074) * [-231.545] (-226.252) (-226.866) (-226.123) -- 0:00:22
      660000 -- (-227.016) [-227.096] (-226.352) (-231.186) * (-229.545) [-228.081] (-230.156) (-227.123) -- 0:00:22

      Average standard deviation of split frequencies: 0.007563

      660500 -- (-227.816) (-227.721) [-230.744] (-231.106) * (-226.543) (-227.813) (-228.570) [-227.303] -- 0:00:22
      661000 -- (-227.998) (-233.615) (-227.801) [-227.880] * (-230.738) (-227.438) (-226.184) [-229.008] -- 0:00:22
      661500 -- [-226.734] (-227.279) (-228.772) (-231.765) * (-228.051) (-229.829) (-229.457) [-227.281] -- 0:00:22
      662000 -- (-227.737) (-226.951) (-227.316) [-228.772] * (-225.710) (-226.191) (-227.550) [-226.395] -- 0:00:22
      662500 -- (-229.910) (-225.916) [-229.057] (-226.256) * (-229.999) (-228.594) [-226.438] (-227.226) -- 0:00:22
      663000 -- (-227.779) (-232.149) (-226.828) [-226.421] * (-227.109) (-225.903) [-227.584] (-229.339) -- 0:00:22
      663500 -- (-228.135) [-226.868] (-226.763) (-227.338) * (-231.948) (-226.345) (-228.117) [-227.384] -- 0:00:22
      664000 -- (-228.348) (-229.515) [-227.743] (-227.557) * (-227.246) (-227.455) (-226.509) [-227.322] -- 0:00:22
      664500 -- (-226.410) (-233.548) [-227.872] (-226.191) * (-225.899) (-227.428) [-227.142] (-230.110) -- 0:00:22
      665000 -- (-228.283) [-226.490] (-228.067) (-229.258) * (-226.575) (-231.951) [-227.500] (-232.044) -- 0:00:22

      Average standard deviation of split frequencies: 0.007388

      665500 -- (-231.293) (-225.727) [-230.524] (-227.024) * [-226.807] (-230.377) (-226.337) (-228.132) -- 0:00:22
      666000 -- (-227.357) [-228.910] (-228.082) (-227.018) * (-227.577) (-226.654) (-229.702) [-227.917] -- 0:00:22
      666500 -- (-226.099) (-226.690) (-226.827) [-232.089] * (-228.311) (-227.069) [-232.649] (-227.972) -- 0:00:22
      667000 -- (-227.588) (-228.543) (-229.650) [-227.093] * (-227.449) (-227.702) (-226.134) [-227.947] -- 0:00:21
      667500 -- [-228.428] (-230.840) (-228.672) (-229.585) * [-225.493] (-229.366) (-226.762) (-225.890) -- 0:00:21
      668000 -- (-228.444) (-230.495) [-228.090] (-228.839) * (-229.610) (-230.167) (-226.357) [-226.169] -- 0:00:21
      668500 -- (-227.414) (-228.948) (-232.415) [-227.773] * (-228.835) (-225.825) [-231.924] (-228.392) -- 0:00:21
      669000 -- [-227.398] (-228.290) (-225.882) (-227.390) * (-227.329) [-227.777] (-225.887) (-230.940) -- 0:00:21
      669500 -- (-227.328) [-228.171] (-226.229) (-227.084) * (-229.915) (-228.514) (-229.219) [-228.344] -- 0:00:21
      670000 -- (-228.174) (-226.069) (-233.821) [-230.529] * (-226.475) (-227.218) [-228.999] (-226.715) -- 0:00:21

      Average standard deviation of split frequencies: 0.007380

      670500 -- (-227.348) [-227.003] (-226.438) (-228.482) * (-228.321) (-228.280) (-226.130) [-227.051] -- 0:00:21
      671000 -- [-227.117] (-228.330) (-228.119) (-229.605) * (-234.174) [-229.639] (-227.917) (-229.614) -- 0:00:21
      671500 -- (-226.463) (-230.494) (-231.073) [-226.747] * (-227.857) (-227.946) (-227.193) [-227.162] -- 0:00:21
      672000 -- (-231.016) [-227.421] (-228.812) (-227.456) * (-231.336) [-226.754] (-227.278) (-233.868) -- 0:00:21
      672500 -- (-227.375) [-228.912] (-229.268) (-231.003) * (-229.304) [-227.111] (-226.820) (-228.924) -- 0:00:21
      673000 -- (-230.580) [-227.461] (-229.314) (-227.324) * (-227.894) (-228.138) [-227.567] (-228.437) -- 0:00:21
      673500 -- (-231.174) (-229.881) [-226.386] (-227.154) * (-228.563) (-228.563) (-229.570) [-229.229] -- 0:00:21
      674000 -- (-226.289) (-229.328) (-227.135) [-229.897] * (-227.334) (-230.411) (-226.719) [-227.461] -- 0:00:21
      674500 -- (-226.844) [-226.227] (-228.724) (-229.155) * (-228.335) (-226.860) [-228.385] (-231.950) -- 0:00:21
      675000 -- (-227.307) [-230.577] (-227.110) (-227.986) * (-229.881) (-229.321) [-228.920] (-225.886) -- 0:00:21

      Average standard deviation of split frequencies: 0.007584

      675500 -- (-227.798) (-227.472) [-228.177] (-230.148) * (-227.540) (-230.071) [-226.332] (-228.015) -- 0:00:21
      676000 -- (-232.420) [-227.469] (-233.816) (-231.656) * [-227.776] (-229.996) (-228.622) (-228.112) -- 0:00:21
      676500 -- (-229.232) [-227.529] (-229.092) (-229.009) * (-229.767) (-227.512) [-226.753] (-226.816) -- 0:00:21
      677000 -- (-231.164) (-227.373) [-230.844] (-228.954) * (-230.703) (-226.272) [-228.112] (-226.318) -- 0:00:21
      677500 -- (-230.668) (-226.567) (-227.199) [-227.485] * (-227.790) [-226.498] (-227.988) (-228.531) -- 0:00:21
      678000 -- (-226.534) (-227.382) [-227.253] (-227.677) * (-227.415) (-230.325) [-226.138] (-230.967) -- 0:00:21
      678500 -- (-231.476) (-227.939) (-225.992) [-226.626] * (-226.402) (-228.406) (-227.747) [-228.054] -- 0:00:21
      679000 -- (-233.318) [-228.412] (-225.718) (-228.879) * (-227.397) (-227.695) (-227.014) [-228.651] -- 0:00:21
      679500 -- [-226.585] (-228.262) (-229.404) (-226.966) * (-228.559) (-226.089) (-227.416) [-228.433] -- 0:00:21
      680000 -- (-227.372) [-228.198] (-227.460) (-225.888) * (-227.337) [-225.976] (-228.398) (-227.022) -- 0:00:21

      Average standard deviation of split frequencies: 0.007488

      680500 -- [-225.950] (-226.150) (-226.754) (-227.239) * (-226.890) (-227.394) [-229.655] (-228.683) -- 0:00:21
      681000 -- (-226.442) (-226.527) (-227.472) [-227.243] * (-228.391) [-227.143] (-228.866) (-227.578) -- 0:00:21
      681500 -- (-227.077) (-230.471) [-226.689] (-228.332) * (-233.355) (-226.218) [-226.612] (-230.415) -- 0:00:21
      682000 -- (-227.771) (-228.880) (-226.614) [-226.564] * (-228.290) (-227.102) (-227.370) [-228.747] -- 0:00:20
      682500 -- (-233.904) (-228.962) [-228.485] (-226.988) * (-228.069) [-227.459] (-226.373) (-226.999) -- 0:00:20
      683000 -- (-228.333) [-230.012] (-226.514) (-229.098) * [-227.073] (-228.879) (-227.023) (-227.449) -- 0:00:20
      683500 -- (-227.162) (-227.890) [-225.538] (-229.977) * (-227.909) (-227.640) (-229.809) [-227.024] -- 0:00:20
      684000 -- (-234.497) (-229.726) (-226.149) [-229.624] * (-226.485) [-230.059] (-230.927) (-226.964) -- 0:00:20
      684500 -- (-227.049) (-229.178) (-227.760) [-229.400] * (-225.767) [-233.513] (-229.623) (-228.536) -- 0:00:20
      685000 -- (-234.753) [-226.739] (-230.851) (-229.810) * (-227.625) (-227.952) (-227.452) [-228.093] -- 0:00:20

      Average standard deviation of split frequencies: 0.007344

      685500 -- (-230.439) (-228.314) [-231.205] (-227.461) * (-229.013) (-226.940) [-227.019] (-229.437) -- 0:00:20
      686000 -- (-227.970) (-229.401) (-228.941) [-230.146] * (-227.060) (-232.542) (-227.843) [-226.962] -- 0:00:20
      686500 -- (-233.604) (-232.645) (-227.509) [-227.256] * (-226.161) [-227.740] (-227.369) (-229.853) -- 0:00:20
      687000 -- [-229.770] (-226.678) (-227.382) (-227.064) * (-226.158) (-227.004) [-228.850] (-225.993) -- 0:00:20
      687500 -- (-227.205) (-229.305) (-232.473) [-230.659] * (-226.548) (-228.084) [-230.767] (-227.233) -- 0:00:20
      688000 -- (-228.639) [-227.476] (-233.205) (-225.438) * [-226.942] (-231.472) (-229.429) (-231.731) -- 0:00:20
      688500 -- (-229.475) [-229.141] (-228.669) (-226.898) * (-228.879) (-230.972) [-226.544] (-227.916) -- 0:00:20
      689000 -- (-233.453) (-226.564) [-226.676] (-226.515) * [-226.817] (-227.485) (-231.274) (-227.201) -- 0:00:20
      689500 -- (-233.007) (-225.552) [-226.289] (-227.251) * [-227.283] (-230.187) (-225.781) (-230.792) -- 0:00:20
      690000 -- (-229.053) (-226.191) (-228.660) [-226.707] * (-230.863) (-228.325) [-228.398] (-226.544) -- 0:00:20

      Average standard deviation of split frequencies: 0.007892

      690500 -- [-229.058] (-226.258) (-226.920) (-228.140) * (-227.238) [-228.232] (-226.811) (-228.941) -- 0:00:20
      691000 -- (-229.426) [-225.844] (-226.246) (-228.452) * [-227.838] (-227.997) (-227.193) (-231.492) -- 0:00:20
      691500 -- (-231.308) (-228.814) [-226.967] (-226.429) * (-227.155) [-228.288] (-228.596) (-226.643) -- 0:00:20
      692000 -- (-227.351) [-226.536] (-227.856) (-226.685) * (-232.163) [-228.161] (-228.798) (-228.548) -- 0:00:20
      692500 -- (-229.371) [-226.552] (-226.554) (-228.849) * (-226.870) (-226.840) [-229.813] (-231.149) -- 0:00:20
      693000 -- (-227.183) (-233.205) [-226.905] (-228.473) * [-227.422] (-226.383) (-230.980) (-229.321) -- 0:00:20
      693500 -- [-229.161] (-230.941) (-227.065) (-228.116) * (-229.984) (-228.104) (-225.657) [-228.003] -- 0:00:20
      694000 -- (-228.274) [-227.116] (-227.617) (-226.530) * (-227.153) (-227.102) (-230.840) [-228.327] -- 0:00:20
      694500 -- (-228.936) (-226.182) (-232.566) [-226.156] * (-228.355) (-226.727) [-227.750] (-228.123) -- 0:00:20
      695000 -- (-226.393) (-229.334) (-227.272) [-227.318] * (-226.736) (-228.073) [-227.028] (-229.106) -- 0:00:20

      Average standard deviation of split frequencies: 0.007831

      695500 -- [-225.899] (-229.691) (-226.534) (-226.331) * [-227.297] (-229.383) (-226.536) (-228.618) -- 0:00:20
      696000 -- (-227.454) (-230.183) [-226.952] (-227.129) * [-230.736] (-228.168) (-227.758) (-227.844) -- 0:00:20
      696500 -- [-227.090] (-227.162) (-226.924) (-229.263) * [-232.825] (-230.003) (-227.810) (-228.716) -- 0:00:20
      697000 -- (-226.382) (-226.952) (-228.239) [-228.836] * (-227.820) (-230.240) (-227.350) [-233.878] -- 0:00:19
      697500 -- (-229.284) (-229.030) [-227.593] (-227.392) * [-229.073] (-228.008) (-230.134) (-231.524) -- 0:00:19
      698000 -- (-230.167) [-226.480] (-229.874) (-226.908) * (-226.711) [-225.835] (-233.611) (-227.697) -- 0:00:19
      698500 -- (-232.736) (-230.157) [-227.241] (-225.928) * (-228.302) (-226.861) (-227.353) [-228.112] -- 0:00:19
      699000 -- (-229.032) (-227.881) (-227.851) [-226.490] * (-226.107) (-228.775) [-226.448] (-230.838) -- 0:00:19
      699500 -- (-230.870) [-229.244] (-226.169) (-228.773) * [-228.954] (-226.519) (-228.214) (-229.024) -- 0:00:19
      700000 -- (-226.629) [-228.204] (-226.501) (-226.125) * [-229.186] (-226.271) (-234.161) (-229.234) -- 0:00:19

      Average standard deviation of split frequencies: 0.008116

      700500 -- [-227.300] (-228.879) (-227.059) (-231.499) * (-228.396) [-227.974] (-229.101) (-227.515) -- 0:00:19
      701000 -- (-227.598) [-226.207] (-226.822) (-233.089) * (-227.206) (-226.690) [-227.474] (-229.252) -- 0:00:19
      701500 -- [-227.085] (-228.204) (-228.162) (-229.536) * [-230.095] (-227.762) (-227.203) (-226.870) -- 0:00:19
      702000 -- (-231.487) [-229.332] (-228.171) (-231.790) * (-227.731) (-226.864) (-231.095) [-230.041] -- 0:00:19
      702500 -- (-230.325) (-226.665) (-228.129) [-228.599] * (-228.080) (-227.965) [-228.822] (-229.889) -- 0:00:19
      703000 -- (-229.720) (-226.704) (-232.780) [-227.381] * [-227.099] (-229.713) (-226.916) (-229.962) -- 0:00:19
      703500 -- (-227.776) [-228.820] (-228.809) (-226.711) * (-228.802) (-228.971) [-226.476] (-228.745) -- 0:00:19
      704000 -- (-225.621) (-230.368) [-226.299] (-226.857) * [-227.179] (-229.052) (-226.760) (-228.658) -- 0:00:19
      704500 -- (-227.493) (-232.905) [-225.653] (-228.706) * (-228.625) [-226.298] (-225.804) (-231.821) -- 0:00:19
      705000 -- [-227.735] (-226.370) (-230.677) (-230.067) * [-229.884] (-226.004) (-226.970) (-226.101) -- 0:00:19

      Average standard deviation of split frequencies: 0.008013

      705500 -- [-227.724] (-225.866) (-231.089) (-229.785) * [-227.362] (-228.969) (-225.849) (-231.247) -- 0:00:19
      706000 -- (-227.400) [-227.467] (-227.735) (-227.550) * (-227.291) (-228.626) (-226.742) [-229.355] -- 0:00:19
      706500 -- (-226.816) [-227.378] (-226.999) (-226.183) * (-226.365) [-227.819] (-227.502) (-231.821) -- 0:00:19
      707000 -- (-228.638) (-230.454) (-226.818) [-228.582] * (-229.709) (-228.859) [-227.226] (-230.964) -- 0:00:19
      707500 -- (-228.103) (-229.233) [-227.926] (-229.640) * (-231.212) (-229.933) (-227.295) [-228.012] -- 0:00:19
      708000 -- (-233.837) (-227.127) [-228.117] (-232.338) * (-226.888) (-226.048) [-227.427] (-231.387) -- 0:00:19
      708500 -- (-233.433) [-227.392] (-226.805) (-228.253) * (-228.640) [-226.108] (-227.791) (-229.210) -- 0:00:19
      709000 -- (-229.820) [-226.041] (-226.304) (-229.407) * (-228.367) [-229.831] (-226.750) (-227.410) -- 0:00:19
      709500 -- (-229.848) (-228.104) [-227.569] (-228.356) * (-231.888) (-229.172) (-227.609) [-229.860] -- 0:00:19
      710000 -- (-228.677) (-228.650) (-228.903) [-226.884] * (-229.765) [-230.068] (-231.276) (-228.121) -- 0:00:19

      Average standard deviation of split frequencies: 0.008292

      710500 -- (-228.846) [-228.177] (-229.468) (-229.971) * [-226.897] (-228.938) (-227.188) (-229.063) -- 0:00:19
      711000 -- [-227.511] (-227.142) (-226.008) (-227.323) * (-227.789) (-228.929) (-226.469) [-227.914] -- 0:00:19
      711500 -- (-227.541) [-227.804] (-226.220) (-227.076) * [-231.112] (-233.433) (-226.511) (-228.264) -- 0:00:19
      712000 -- (-228.377) (-230.869) [-229.031] (-226.485) * (-226.501) (-233.466) (-230.626) [-229.832] -- 0:00:19
      712500 -- (-232.582) [-228.438] (-228.719) (-227.217) * (-228.145) (-228.816) (-228.359) [-232.203] -- 0:00:18
      713000 -- [-229.169] (-229.574) (-230.665) (-227.347) * (-230.773) (-226.377) (-227.645) [-227.147] -- 0:00:18
      713500 -- (-227.989) [-227.915] (-226.850) (-227.503) * (-226.975) [-235.910] (-232.867) (-229.756) -- 0:00:18
      714000 -- (-225.867) (-228.206) (-229.216) [-228.182] * [-227.548] (-226.923) (-235.289) (-227.820) -- 0:00:18
      714500 -- (-228.569) [-229.524] (-229.840) (-228.888) * (-227.951) [-230.178] (-225.921) (-226.512) -- 0:00:18
      715000 -- (-226.484) (-228.734) (-234.279) [-230.281] * (-226.761) (-227.311) (-226.896) [-228.060] -- 0:00:18

      Average standard deviation of split frequencies: 0.008520

      715500 -- [-228.854] (-228.314) (-228.586) (-230.143) * (-231.575) [-226.099] (-227.495) (-227.452) -- 0:00:18
      716000 -- (-229.395) (-228.353) (-227.207) [-228.147] * [-230.074] (-227.126) (-229.899) (-231.197) -- 0:00:18
      716500 -- (-225.997) (-231.465) (-225.924) [-227.052] * [-232.000] (-227.237) (-226.889) (-229.324) -- 0:00:18
      717000 -- (-227.360) [-226.512] (-227.023) (-226.048) * (-227.061) [-227.815] (-229.884) (-232.070) -- 0:00:18
      717500 -- (-228.246) (-226.783) [-228.518] (-230.366) * (-225.926) (-227.849) (-227.685) [-227.929] -- 0:00:18
      718000 -- (-228.290) (-229.953) [-227.702] (-227.172) * (-228.039) [-227.958] (-228.140) (-229.727) -- 0:00:18
      718500 -- (-230.765) (-229.540) (-227.033) [-226.695] * [-227.928] (-226.736) (-230.172) (-227.235) -- 0:00:18
      719000 -- [-228.443] (-227.078) (-229.467) (-226.755) * [-227.971] (-232.554) (-227.792) (-228.855) -- 0:00:18
      719500 -- [-226.547] (-227.543) (-227.077) (-226.549) * (-227.776) (-232.177) (-228.958) [-227.604] -- 0:00:18
      720000 -- (-225.908) [-228.306] (-226.567) (-229.373) * [-226.598] (-231.359) (-227.809) (-228.235) -- 0:00:18

      Average standard deviation of split frequencies: 0.009004

      720500 -- [-229.937] (-226.914) (-225.945) (-227.998) * [-226.387] (-226.476) (-229.723) (-232.250) -- 0:00:18
      721000 -- (-225.609) [-227.185] (-225.807) (-228.218) * (-230.360) (-228.447) (-227.282) [-227.601] -- 0:00:18
      721500 -- (-226.255) (-227.414) (-228.081) [-228.713] * (-228.298) (-227.162) [-226.888] (-228.961) -- 0:00:18
      722000 -- [-227.241] (-226.199) (-227.632) (-227.320) * (-227.616) [-227.137] (-229.005) (-228.289) -- 0:00:18
      722500 -- (-226.142) [-228.403] (-225.899) (-228.348) * (-226.836) (-230.211) [-226.145] (-228.120) -- 0:00:18
      723000 -- (-227.058) [-227.527] (-229.654) (-226.666) * (-226.536) (-235.743) [-227.230] (-228.895) -- 0:00:18
      723500 -- (-227.613) [-229.150] (-228.810) (-226.614) * (-226.553) [-227.095] (-230.275) (-229.966) -- 0:00:18
      724000 -- (-228.813) (-227.383) (-228.146) [-227.067] * (-227.369) [-226.614] (-226.964) (-227.287) -- 0:00:18
      724500 -- (-227.120) [-227.192] (-226.505) (-227.052) * (-230.495) (-229.906) [-227.808] (-228.014) -- 0:00:18
      725000 -- (-226.716) (-228.730) (-228.515) [-228.379] * (-229.483) (-227.990) [-230.614] (-226.311) -- 0:00:18

      Average standard deviation of split frequencies: 0.008747

      725500 -- (-226.673) (-226.563) [-227.639] (-229.326) * (-227.369) (-227.619) [-226.596] (-227.696) -- 0:00:18
      726000 -- (-227.672) (-233.397) (-227.287) [-226.525] * (-227.040) (-228.451) (-227.370) [-226.775] -- 0:00:18
      726500 -- (-226.686) (-228.272) [-228.463] (-226.948) * [-227.825] (-229.000) (-228.023) (-226.738) -- 0:00:18
      727000 -- [-226.970] (-227.818) (-232.429) (-230.153) * [-226.473] (-229.835) (-228.891) (-228.471) -- 0:00:18
      727500 -- (-227.014) [-232.114] (-226.968) (-229.290) * (-233.697) (-228.724) [-226.105] (-229.599) -- 0:00:17
      728000 -- (-228.791) [-227.419] (-228.556) (-225.788) * (-231.860) (-227.052) [-227.335] (-226.888) -- 0:00:17
      728500 -- [-226.630] (-227.124) (-230.561) (-226.996) * (-231.415) (-226.609) [-229.990] (-226.786) -- 0:00:17
      729000 -- [-226.300] (-227.669) (-227.121) (-227.134) * [-229.907] (-228.526) (-226.275) (-228.782) -- 0:00:17
      729500 -- [-230.315] (-227.457) (-231.301) (-228.146) * (-226.681) (-225.857) (-226.842) [-226.782] -- 0:00:17
      730000 -- (-228.906) [-227.416] (-229.751) (-234.471) * [-227.042] (-227.879) (-231.021) (-229.710) -- 0:00:17

      Average standard deviation of split frequencies: 0.008805

      730500 -- (-227.760) (-227.924) [-226.961] (-226.994) * [-227.548] (-227.847) (-229.313) (-229.413) -- 0:00:17
      731000 -- (-226.318) (-229.418) (-227.384) [-228.402] * (-227.093) (-226.020) [-228.301] (-227.304) -- 0:00:17
      731500 -- (-227.118) (-228.743) (-229.558) [-230.732] * (-225.639) (-228.779) (-227.876) [-226.674] -- 0:00:17
      732000 -- (-228.853) (-227.267) [-226.405] (-228.154) * (-229.506) [-226.486] (-230.682) (-228.697) -- 0:00:17
      732500 -- [-230.655] (-230.659) (-227.206) (-226.623) * (-226.295) (-230.642) [-225.942] (-229.991) -- 0:00:17
      733000 -- [-232.085] (-228.611) (-226.544) (-226.800) * (-226.544) [-226.383] (-230.025) (-227.006) -- 0:00:17
      733500 -- [-229.631] (-227.292) (-231.905) (-226.558) * (-228.059) (-228.674) (-226.892) [-227.818] -- 0:00:17
      734000 -- (-226.823) (-228.328) (-229.438) [-228.428] * [-227.456] (-227.551) (-230.303) (-232.492) -- 0:00:17
      734500 -- (-229.963) (-226.399) (-228.106) [-226.681] * (-227.601) (-228.720) (-226.921) [-229.053] -- 0:00:17
      735000 -- (-228.686) (-229.490) (-227.251) [-226.457] * (-228.265) (-227.681) (-231.920) [-227.345] -- 0:00:17

      Average standard deviation of split frequencies: 0.009042

      735500 -- (-229.114) [-228.992] (-228.299) (-229.475) * (-228.670) (-228.571) (-227.808) [-230.017] -- 0:00:17
      736000 -- [-225.583] (-227.319) (-225.888) (-228.908) * (-234.178) (-227.024) (-225.947) [-226.382] -- 0:00:17
      736500 -- (-226.892) [-226.776] (-226.472) (-227.201) * (-231.509) [-225.935] (-227.516) (-227.457) -- 0:00:17
      737000 -- (-226.650) (-228.902) [-230.302] (-226.607) * [-229.757] (-227.389) (-226.252) (-227.924) -- 0:00:17
      737500 -- (-229.546) (-229.187) [-228.122] (-228.384) * (-227.236) (-227.402) [-226.372] (-229.276) -- 0:00:17
      738000 -- (-229.536) [-226.268] (-226.475) (-228.626) * (-226.149) (-232.447) (-226.663) [-229.273] -- 0:00:17
      738500 -- (-227.322) (-229.362) (-227.711) [-226.305] * (-227.793) [-228.691] (-226.872) (-230.646) -- 0:00:16
      739000 -- (-230.478) [-226.701] (-226.891) (-231.021) * (-226.570) (-228.544) (-228.564) [-226.478] -- 0:00:16
      739500 -- [-227.461] (-227.939) (-225.900) (-228.821) * (-228.042) [-227.546] (-229.216) (-228.112) -- 0:00:17
      740000 -- (-227.104) (-229.260) [-227.968] (-228.774) * [-228.717] (-233.554) (-227.179) (-227.490) -- 0:00:17

      Average standard deviation of split frequencies: 0.008723

      740500 -- (-226.224) (-229.119) (-226.525) [-229.407] * (-235.129) [-231.169] (-226.900) (-230.556) -- 0:00:17
      741000 -- (-225.943) (-229.858) [-227.441] (-231.663) * (-229.224) [-227.580] (-226.848) (-227.063) -- 0:00:17
      741500 -- (-226.444) (-228.657) (-225.891) [-229.238] * (-228.619) (-227.441) (-226.376) [-228.265] -- 0:00:17
      742000 -- (-230.220) (-226.168) [-228.691] (-230.417) * [-229.593] (-230.375) (-229.498) (-232.507) -- 0:00:17
      742500 -- [-229.289] (-226.713) (-226.631) (-228.187) * (-227.846) [-228.499] (-227.180) (-230.130) -- 0:00:16
      743000 -- (-229.148) (-230.244) (-225.894) [-227.147] * (-228.058) [-225.959] (-227.669) (-230.705) -- 0:00:16
      743500 -- [-227.759] (-228.257) (-227.659) (-230.004) * (-231.368) (-229.996) [-227.911] (-231.962) -- 0:00:16
      744000 -- [-226.296] (-228.359) (-228.270) (-230.513) * [-228.316] (-226.123) (-226.772) (-228.091) -- 0:00:16
      744500 -- (-229.401) (-226.463) [-227.757] (-227.979) * (-232.081) [-226.968] (-226.281) (-227.442) -- 0:00:16
      745000 -- (-225.884) (-227.647) (-228.144) [-227.216] * [-229.913] (-229.376) (-226.193) (-227.725) -- 0:00:16

      Average standard deviation of split frequencies: 0.009330

      745500 -- (-230.207) (-226.959) [-228.750] (-226.474) * (-227.367) [-226.605] (-226.802) (-230.014) -- 0:00:16
      746000 -- (-227.643) [-227.001] (-229.414) (-226.297) * (-228.441) (-226.280) (-228.219) [-227.717] -- 0:00:16
      746500 -- (-227.189) [-226.710] (-228.560) (-229.273) * (-226.647) (-226.630) (-231.195) [-226.964] -- 0:00:16
      747000 -- (-228.198) [-226.292] (-227.335) (-232.735) * (-226.707) [-227.768] (-227.335) (-232.785) -- 0:00:16
      747500 -- (-228.749) (-227.423) (-231.115) [-227.803] * (-228.751) [-230.531] (-231.615) (-228.597) -- 0:00:16
      748000 -- (-226.406) (-226.849) [-226.865] (-232.467) * (-229.436) (-226.859) (-227.343) [-225.669] -- 0:00:16
      748500 -- (-226.136) (-231.923) [-227.847] (-232.312) * (-227.587) (-229.547) (-232.061) [-226.337] -- 0:00:16
      749000 -- (-229.119) (-230.862) [-225.563] (-227.382) * (-227.488) [-225.656] (-228.922) (-226.979) -- 0:00:16
      749500 -- [-226.630] (-227.603) (-234.173) (-226.981) * (-226.726) (-228.589) (-228.793) [-226.195] -- 0:00:16
      750000 -- (-227.496) [-226.125] (-228.182) (-227.363) * (-227.325) [-226.800] (-232.880) (-225.739) -- 0:00:16

      Average standard deviation of split frequencies: 0.008866

      750500 -- (-233.270) [-227.540] (-227.134) (-228.819) * (-229.460) (-229.514) [-227.744] (-229.341) -- 0:00:16
      751000 -- [-230.203] (-227.963) (-226.854) (-226.963) * (-229.137) (-228.354) (-227.341) [-227.878] -- 0:00:16
      751500 -- [-232.264] (-228.621) (-226.382) (-226.536) * [-230.040] (-227.310) (-228.915) (-236.343) -- 0:00:16
      752000 -- (-227.134) [-228.149] (-226.395) (-227.364) * [-228.412] (-228.645) (-227.548) (-226.721) -- 0:00:16
      752500 -- (-229.645) (-232.048) (-226.410) [-227.098] * (-232.338) [-225.831] (-227.331) (-229.128) -- 0:00:16
      753000 -- (-233.009) (-226.715) (-226.864) [-229.108] * (-227.480) (-226.865) [-231.213] (-228.540) -- 0:00:16
      753500 -- (-228.707) (-233.823) (-227.129) [-226.691] * (-227.562) [-227.200] (-227.716) (-227.394) -- 0:00:16
      754000 -- (-227.729) (-228.368) [-226.689] (-229.591) * (-228.642) [-227.385] (-227.028) (-227.625) -- 0:00:15
      754500 -- [-227.568] (-230.748) (-231.394) (-226.757) * (-227.774) (-230.835) [-227.947] (-227.598) -- 0:00:15
      755000 -- (-227.427) [-230.368] (-228.110) (-228.447) * (-227.280) (-231.399) (-227.045) [-226.644] -- 0:00:15

      Average standard deviation of split frequencies: 0.007981

      755500 -- [-227.255] (-227.011) (-225.545) (-231.029) * [-229.494] (-230.706) (-229.377) (-228.865) -- 0:00:16
      756000 -- (-226.924) [-228.562] (-228.878) (-229.493) * [-227.909] (-228.458) (-229.805) (-231.148) -- 0:00:16
      756500 -- (-227.587) (-227.015) (-228.159) [-228.968] * (-230.944) (-226.519) (-228.061) [-229.778] -- 0:00:16
      757000 -- (-230.728) (-227.747) (-228.376) [-226.860] * [-231.024] (-228.857) (-230.958) (-227.329) -- 0:00:16
      757500 -- (-231.325) (-229.033) [-226.740] (-228.742) * (-228.920) (-228.026) [-227.877] (-230.837) -- 0:00:16
      758000 -- (-230.112) (-230.914) (-230.990) [-229.501] * [-227.110] (-227.823) (-227.772) (-227.962) -- 0:00:15
      758500 -- (-228.161) [-227.761] (-227.503) (-229.980) * (-225.982) (-227.259) (-226.972) [-227.430] -- 0:00:15
      759000 -- (-225.764) (-226.882) [-226.066] (-227.753) * (-226.281) (-228.298) (-229.631) [-229.376] -- 0:00:15
      759500 -- [-226.550] (-225.711) (-227.369) (-226.595) * (-225.815) (-228.460) (-231.058) [-226.683] -- 0:00:15
      760000 -- (-233.582) (-226.325) [-226.791] (-226.995) * (-227.502) [-227.025] (-234.141) (-227.748) -- 0:00:15

      Average standard deviation of split frequencies: 0.008637

      760500 -- (-228.826) (-226.840) (-225.954) [-227.175] * (-227.186) (-232.901) [-226.555] (-226.414) -- 0:00:15
      761000 -- [-228.905] (-227.476) (-227.003) (-228.363) * [-226.712] (-229.271) (-227.725) (-231.371) -- 0:00:15
      761500 -- (-227.766) (-228.334) [-228.535] (-227.198) * (-226.661) (-226.135) [-229.095] (-227.109) -- 0:00:15
      762000 -- (-226.463) (-228.506) (-226.236) [-226.508] * [-230.820] (-226.164) (-232.705) (-227.194) -- 0:00:15
      762500 -- [-227.909] (-227.450) (-228.037) (-226.236) * (-229.768) (-232.099) (-232.852) [-226.165] -- 0:00:15
      763000 -- (-227.145) (-227.266) [-227.066] (-229.703) * (-231.587) (-226.435) (-232.696) [-228.673] -- 0:00:15
      763500 -- [-227.603] (-226.038) (-228.451) (-233.303) * [-228.810] (-231.014) (-229.146) (-229.338) -- 0:00:15
      764000 -- (-227.700) (-231.024) [-228.894] (-229.629) * (-226.923) [-231.144] (-228.509) (-227.907) -- 0:00:15
      764500 -- [-230.259] (-229.198) (-231.378) (-226.732) * (-230.179) (-232.197) [-227.555] (-228.687) -- 0:00:15
      765000 -- [-228.598] (-228.018) (-226.648) (-226.610) * (-226.728) (-228.927) (-226.560) [-229.060] -- 0:00:15

      Average standard deviation of split frequencies: 0.008347

      765500 -- [-227.305] (-227.101) (-227.694) (-227.780) * (-226.989) (-228.524) [-227.202] (-230.020) -- 0:00:15
      766000 -- (-229.445) [-230.771] (-227.174) (-229.469) * (-226.039) (-231.966) (-230.715) [-228.787] -- 0:00:15
      766500 -- (-230.190) (-227.203) (-229.483) [-226.481] * (-226.456) (-230.911) (-226.495) [-226.279] -- 0:00:15
      767000 -- (-229.230) (-228.391) (-230.229) [-227.360] * (-226.709) [-228.200] (-227.305) (-229.147) -- 0:00:15
      767500 -- [-227.979] (-229.379) (-229.163) (-228.099) * (-229.422) (-226.635) [-226.558] (-232.384) -- 0:00:15
      768000 -- [-230.131] (-226.738) (-227.096) (-226.654) * (-228.214) (-227.574) [-227.412] (-228.180) -- 0:00:15
      768500 -- [-228.987] (-227.039) (-226.840) (-229.097) * [-227.750] (-226.484) (-231.133) (-230.823) -- 0:00:15
      769000 -- (-227.490) (-228.968) (-233.150) [-227.174] * [-228.299] (-227.444) (-226.690) (-230.281) -- 0:00:15
      769500 -- (-226.805) [-226.249] (-230.916) (-227.327) * [-229.577] (-226.789) (-228.528) (-225.688) -- 0:00:14
      770000 -- (-227.283) [-226.382] (-226.899) (-231.519) * (-228.098) [-225.903] (-227.608) (-226.928) -- 0:00:14

      Average standard deviation of split frequencies: 0.008640

      770500 -- (-231.055) [-229.095] (-229.425) (-231.213) * (-228.924) (-227.480) (-227.678) [-226.639] -- 0:00:14
      771000 -- (-230.553) [-226.785] (-227.114) (-226.725) * [-232.837] (-226.937) (-228.172) (-228.110) -- 0:00:15
      771500 -- (-227.336) (-225.939) (-228.179) [-228.804] * [-227.365] (-226.280) (-230.335) (-227.623) -- 0:00:15
      772000 -- (-234.775) (-232.724) (-229.193) [-228.306] * (-231.066) (-226.175) [-230.146] (-227.082) -- 0:00:15
      772500 -- (-227.498) (-228.438) (-226.497) [-226.249] * (-228.748) (-226.178) (-230.792) [-226.470] -- 0:00:15
      773000 -- (-227.762) [-225.991] (-227.313) (-230.437) * (-229.266) (-226.650) [-230.424] (-227.253) -- 0:00:14
      773500 -- (-229.366) (-231.876) [-225.749] (-228.429) * (-226.339) (-226.363) [-229.216] (-230.088) -- 0:00:14
      774000 -- (-228.520) (-226.883) (-226.044) [-227.680] * (-225.868) (-228.454) (-227.539) [-227.337] -- 0:00:14
      774500 -- (-230.649) (-227.566) [-227.433] (-227.662) * [-226.722] (-229.084) (-233.092) (-230.510) -- 0:00:14
      775000 -- (-228.790) (-231.766) (-226.490) [-225.471] * (-227.303) (-227.727) (-227.366) [-227.124] -- 0:00:14

      Average standard deviation of split frequencies: 0.008049

      775500 -- (-229.377) [-227.120] (-226.277) (-229.047) * (-230.005) [-228.047] (-228.121) (-227.090) -- 0:00:14
      776000 -- [-232.401] (-226.606) (-226.741) (-226.727) * (-226.441) [-228.133] (-228.486) (-225.721) -- 0:00:14
      776500 -- [-229.767] (-229.126) (-228.690) (-228.686) * (-227.189) (-228.024) (-227.584) [-227.122] -- 0:00:14
      777000 -- (-229.072) [-228.666] (-227.637) (-226.793) * (-228.748) (-228.088) [-228.718] (-227.243) -- 0:00:14
      777500 -- (-227.283) (-227.573) (-230.857) [-227.299] * (-228.834) [-226.190] (-229.989) (-226.583) -- 0:00:14
      778000 -- (-225.908) [-228.091] (-228.025) (-228.099) * (-228.367) [-226.194] (-227.329) (-230.869) -- 0:00:14
      778500 -- [-226.544] (-229.853) (-234.705) (-227.737) * (-229.915) [-225.647] (-226.243) (-230.753) -- 0:00:14
      779000 -- (-225.966) (-230.373) [-229.007] (-228.404) * (-227.032) [-226.403] (-229.125) (-230.103) -- 0:00:14
      779500 -- [-227.518] (-229.524) (-228.216) (-226.705) * (-227.634) [-226.558] (-231.002) (-227.838) -- 0:00:14
      780000 -- (-228.284) (-227.569) [-226.483] (-227.162) * (-228.789) (-226.515) [-226.958] (-228.599) -- 0:00:14

      Average standard deviation of split frequencies: 0.007737

      780500 -- (-228.499) (-226.957) [-226.742] (-230.030) * (-229.099) (-228.228) (-226.214) [-228.071] -- 0:00:14
      781000 -- (-229.667) (-226.338) [-227.010] (-231.635) * [-226.135] (-229.922) (-226.511) (-227.745) -- 0:00:14
      781500 -- (-231.884) [-229.228] (-228.688) (-226.813) * (-227.984) (-232.571) (-227.096) [-226.288] -- 0:00:14
      782000 -- (-229.969) [-227.039] (-227.583) (-226.165) * (-232.032) (-234.615) (-232.073) [-226.470] -- 0:00:14
      782500 -- (-228.798) [-227.199] (-227.384) (-227.868) * (-229.496) (-228.229) [-230.814] (-228.677) -- 0:00:14
      783000 -- (-226.188) (-228.297) (-228.212) [-226.199] * [-229.742] (-228.777) (-226.227) (-231.250) -- 0:00:14
      783500 -- (-226.317) (-228.657) (-227.558) [-228.029] * (-226.014) (-227.620) [-227.503] (-230.072) -- 0:00:14
      784000 -- [-229.669] (-227.214) (-227.795) (-226.694) * (-228.129) (-230.509) (-231.819) [-227.197] -- 0:00:14
      784500 -- [-228.219] (-228.999) (-227.223) (-226.951) * [-227.110] (-235.046) (-230.616) (-228.438) -- 0:00:14
      785000 -- (-226.621) [-228.653] (-227.566) (-227.423) * [-226.913] (-230.442) (-228.708) (-229.515) -- 0:00:13

      Average standard deviation of split frequencies: 0.007459

      785500 -- (-234.362) [-232.655] (-228.178) (-226.080) * [-227.356] (-226.013) (-227.563) (-226.177) -- 0:00:14
      786000 -- (-229.831) (-226.668) (-227.489) [-225.955] * (-227.275) (-227.367) (-227.730) [-226.675] -- 0:00:14
      786500 -- (-227.417) (-225.805) [-229.974] (-228.370) * (-227.695) (-226.032) (-232.218) [-225.991] -- 0:00:14
      787000 -- (-229.305) (-225.955) (-227.179) [-227.901] * [-225.980] (-227.494) (-229.914) (-228.479) -- 0:00:14
      787500 -- (-229.145) [-226.797] (-228.309) (-229.557) * (-226.572) (-226.561) (-226.789) [-226.864] -- 0:00:14
      788000 -- [-231.550] (-229.107) (-229.479) (-226.268) * [-227.681] (-228.900) (-232.980) (-231.499) -- 0:00:13
      788500 -- (-230.751) (-225.835) [-227.884] (-228.043) * (-226.789) (-228.510) [-229.960] (-231.541) -- 0:00:13
      789000 -- (-229.089) (-225.655) (-227.236) [-227.151] * (-228.803) (-227.169) (-234.694) [-226.764] -- 0:00:13
      789500 -- [-226.537] (-225.907) (-229.176) (-226.872) * (-226.713) (-229.530) (-226.978) [-229.254] -- 0:00:13
      790000 -- (-229.000) (-227.341) [-226.209] (-229.467) * (-230.525) [-226.930] (-227.295) (-227.146) -- 0:00:13

      Average standard deviation of split frequencies: 0.007229

      790500 -- [-227.470] (-232.021) (-228.099) (-229.586) * (-226.565) [-228.010] (-227.014) (-228.531) -- 0:00:13
      791000 -- (-230.262) [-230.954] (-226.561) (-227.085) * [-226.804] (-228.706) (-228.723) (-228.391) -- 0:00:13
      791500 -- (-228.182) [-228.834] (-232.385) (-227.805) * [-226.578] (-229.551) (-228.239) (-229.700) -- 0:00:13
      792000 -- (-227.574) (-227.240) (-232.996) [-225.749] * (-226.459) [-226.341] (-230.822) (-230.874) -- 0:00:13
      792500 -- (-227.018) [-230.977] (-233.117) (-229.672) * (-226.912) (-226.907) [-229.384] (-228.500) -- 0:00:13
      793000 -- [-227.224] (-228.218) (-231.183) (-226.914) * (-227.735) [-228.427] (-228.253) (-230.172) -- 0:00:13
      793500 -- [-230.566] (-227.561) (-228.718) (-227.706) * (-226.750) [-226.196] (-231.999) (-235.023) -- 0:00:13
      794000 -- (-226.550) (-233.345) (-228.693) [-228.163] * (-232.239) (-225.805) (-227.481) [-227.629] -- 0:00:13
      794500 -- [-228.754] (-227.849) (-230.466) (-225.764) * (-228.986) (-231.076) (-230.915) [-227.046] -- 0:00:13
      795000 -- (-229.154) (-226.386) [-228.788] (-226.348) * (-226.891) (-226.312) [-226.804] (-230.022) -- 0:00:13

      Average standard deviation of split frequencies: 0.006810

      795500 -- (-227.973) (-227.074) [-228.315] (-227.748) * [-229.069] (-226.269) (-231.762) (-226.196) -- 0:00:13
      796000 -- (-229.803) (-227.344) (-231.864) [-230.515] * [-225.808] (-230.041) (-233.095) (-226.633) -- 0:00:13
      796500 -- (-230.797) (-228.234) [-229.834] (-231.891) * (-225.858) (-232.257) (-226.771) [-227.184] -- 0:00:13
      797000 -- (-231.011) [-226.208] (-229.308) (-229.328) * (-229.311) (-229.206) [-226.004] (-226.566) -- 0:00:13
      797500 -- [-226.091] (-226.764) (-226.282) (-228.472) * (-226.461) [-233.491] (-226.705) (-226.659) -- 0:00:13
      798000 -- (-230.261) [-226.625] (-226.752) (-227.458) * (-227.059) (-231.254) [-226.213] (-228.242) -- 0:00:13
      798500 -- (-228.137) [-228.337] (-228.260) (-225.825) * (-226.233) [-228.634] (-225.875) (-227.076) -- 0:00:13
      799000 -- (-229.332) (-228.287) (-228.623) [-226.870] * (-226.919) (-228.772) (-231.778) [-226.809] -- 0:00:13
      799500 -- [-228.821] (-227.099) (-230.267) (-225.517) * (-228.777) [-228.817] (-228.871) (-226.632) -- 0:00:13
      800000 -- [-229.091] (-226.868) (-228.878) (-226.666) * (-226.861) (-233.510) (-228.569) [-226.653] -- 0:00:12

      Average standard deviation of split frequencies: 0.007139

      800500 -- (-229.994) (-226.068) (-228.580) [-226.490] * (-227.418) [-227.507] (-227.401) (-227.053) -- 0:00:13
      801000 -- (-226.627) [-226.198] (-227.748) (-228.393) * (-230.486) [-228.323] (-227.620) (-229.059) -- 0:00:13
      801500 -- (-226.101) (-228.517) (-230.520) [-226.874] * (-227.303) (-227.822) (-227.333) [-227.551] -- 0:00:13
      802000 -- [-227.291] (-226.336) (-234.355) (-226.291) * (-226.613) (-226.678) [-231.114] (-227.518) -- 0:00:13
      802500 -- [-226.718] (-227.784) (-231.414) (-228.241) * (-227.763) (-228.311) [-231.635] (-230.291) -- 0:00:13
      803000 -- [-228.047] (-227.433) (-226.841) (-235.289) * (-227.998) [-226.915] (-226.696) (-226.410) -- 0:00:13
      803500 -- [-229.201] (-229.625) (-228.910) (-232.884) * (-226.438) [-227.989] (-227.593) (-225.949) -- 0:00:12
      804000 -- (-231.727) [-229.876] (-228.560) (-234.050) * (-229.704) (-226.668) (-228.175) [-226.458] -- 0:00:12
      804500 -- (-228.641) [-228.256] (-225.710) (-229.303) * (-226.948) (-226.960) (-230.595) [-227.129] -- 0:00:12
      805000 -- (-230.346) (-226.292) (-226.305) [-225.568] * (-227.083) [-228.425] (-227.843) (-226.997) -- 0:00:12

      Average standard deviation of split frequencies: 0.007092

      805500 -- (-230.322) (-228.159) [-226.363] (-225.512) * (-229.175) (-227.022) [-228.182] (-230.772) -- 0:00:12
      806000 -- [-227.122] (-227.551) (-228.754) (-227.029) * [-229.546] (-230.856) (-228.143) (-234.992) -- 0:00:12
      806500 -- (-228.446) (-226.752) [-227.938] (-226.923) * (-230.417) [-227.732] (-231.666) (-230.295) -- 0:00:12
      807000 -- (-226.282) [-227.904] (-226.045) (-227.657) * [-229.565] (-227.372) (-235.156) (-232.025) -- 0:00:12
      807500 -- [-225.853] (-226.766) (-227.278) (-227.602) * [-228.990] (-229.463) (-227.698) (-229.314) -- 0:00:12
      808000 -- (-229.083) (-226.139) (-228.111) [-229.252] * (-227.840) [-227.894] (-228.648) (-229.406) -- 0:00:12
      808500 -- (-227.881) (-231.490) [-229.309] (-226.387) * (-227.687) (-226.775) [-225.600] (-228.267) -- 0:00:12
      809000 -- (-229.121) (-227.036) [-227.943] (-226.089) * (-226.559) [-226.095] (-227.436) (-226.309) -- 0:00:12
      809500 -- (-231.827) (-226.809) (-226.279) [-226.206] * (-229.694) [-227.162] (-226.303) (-228.597) -- 0:00:12
      810000 -- (-230.305) (-226.009) [-226.409] (-226.983) * [-228.123] (-228.431) (-227.122) (-226.415) -- 0:00:12

      Average standard deviation of split frequencies: 0.007123

      810500 -- (-228.225) (-232.391) [-227.598] (-227.454) * [-228.999] (-228.013) (-227.410) (-227.988) -- 0:00:12
      811000 -- [-225.926] (-230.036) (-228.525) (-231.452) * (-227.807) (-228.041) (-227.812) [-229.104] -- 0:00:12
      811500 -- [-227.477] (-232.463) (-228.069) (-229.549) * (-225.848) (-226.397) [-226.691] (-227.937) -- 0:00:12
      812000 -- (-228.219) [-226.486] (-228.370) (-231.236) * (-226.380) (-227.480) [-226.505] (-226.414) -- 0:00:12
      812500 -- (-226.653) (-228.312) (-229.454) [-228.149] * [-227.657] (-236.019) (-227.170) (-226.381) -- 0:00:12
      813000 -- (-231.027) (-231.336) (-228.144) [-227.384] * (-230.950) [-227.265] (-228.070) (-226.992) -- 0:00:12
      813500 -- (-231.436) (-231.584) (-227.401) [-227.951] * (-228.864) (-228.368) [-227.273] (-228.419) -- 0:00:12
      814000 -- (-228.014) (-228.573) (-227.572) [-226.985] * (-225.908) [-228.966] (-228.708) (-234.328) -- 0:00:12
      814500 -- (-228.225) (-233.315) (-227.083) [-231.178] * [-227.965] (-228.351) (-228.888) (-230.519) -- 0:00:12
      815000 -- (-227.674) [-226.275] (-226.154) (-226.780) * (-226.399) (-230.222) (-228.675) [-231.453]