--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:03:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpmG/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -227.15 -229.62
2 -227.20 -231.14
--------------------------------------
TOTAL -227.17 -230.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892980 0.094100 0.330173 1.474825 0.853939 1461.17 1481.09 1.000
r(A<->C){all} 0.164989 0.019142 0.000112 0.447357 0.128372 142.30 178.66 1.009
r(A<->G){all} 0.172423 0.022049 0.000428 0.473967 0.130686 143.39 224.24 1.003
r(A<->T){all} 0.171906 0.022366 0.000032 0.470901 0.131355 160.81 182.31 1.001
r(C<->G){all} 0.163079 0.018251 0.000045 0.426252 0.130941 241.82 345.73 1.000
r(C<->T){all} 0.166965 0.021293 0.000006 0.466400 0.124651 219.34 231.46 1.001
r(G<->T){all} 0.160637 0.019943 0.000048 0.454216 0.121588 116.71 197.72 1.003
pi(A){all} 0.295803 0.001178 0.229516 0.360310 0.295775 934.07 1162.52 1.000
pi(C){all} 0.254050 0.001150 0.192112 0.323018 0.252813 1257.45 1332.76 1.000
pi(G){all} 0.278570 0.001191 0.210810 0.343265 0.277271 1456.97 1457.79 1.000
pi(T){all} 0.171577 0.000803 0.119293 0.227825 0.169780 1271.78 1315.37 1.000
alpha{1,2} 0.400242 0.220805 0.000128 1.373620 0.238755 1142.97 1202.50 1.000
alpha{3} 0.452634 0.243734 0.000379 1.458966 0.291037 1142.43 1321.71 1.000
pinvar{all} 0.988966 0.000184 0.964666 0.999996 0.993128 1074.42 1222.35 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -214.842638
Model 2: PositiveSelection -214.842658
Model 0: one-ratio -214.842634
Model 7: beta -214.842655
Model 8: beta&w>1 -214.842612
Model 0 vs 1 7.999999979801942E-6
Model 2 vs 1 4.0000000012696546E-5
Model 8 vs 7 8.600000001024455E-5
>C1
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C2
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C3
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C4
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C5
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C6
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=55
C1 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C2 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C3 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C4 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C5 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C6 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
**************************************************
C1 HRETR
C2 HRETR
C3 HRETR
C4 HRETR
C5 HRETR
C6 HRETR
*****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 55 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 55 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1650]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [1650]--->[1650]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.442 Mb, Max= 30.571 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C2 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C3 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C4 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C5 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
C6 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
**************************************************
C1 HRETR
C2 HRETR
C3 HRETR
C4 HRETR
C5 HRETR
C6 HRETR
*****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
C2 ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
C3 ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
C4 ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
C5 ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
C6 ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
**************************************************
C1 GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
C2 GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
C3 GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
C4 GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
C5 GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
C6 GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
**************************************************
C1 ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
C2 ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
C3 ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
C4 ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
C5 ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
C6 ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
**************************************************
C1 CATCGTGAGACACGG
C2 CATCGTGAGACACGG
C3 CATCGTGAGACACGG
C4 CATCGTGAGACACGG
C5 CATCGTGAGACACGG
C6 CATCGTGAGACACGG
***************
>C1
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C2
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C3
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C4
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C5
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C6
ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT
GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG
ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC
CATCGTGAGACACGG
>C1
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C2
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C3
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C4
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C5
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
>C6
MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
HRETR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 165 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791730
Setting output file names to "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1419920897
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0813676410
Seed = 847060396
Swapseed = 1579791730
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -369.277912 -- -24.965149
Chain 2 -- -369.277891 -- -24.965149
Chain 3 -- -369.277912 -- -24.965149
Chain 4 -- -369.277855 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -369.277891 -- -24.965149
Chain 2 -- -369.277912 -- -24.965149
Chain 3 -- -369.277912 -- -24.965149
Chain 4 -- -369.277855 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-369.278] (-369.278) (-369.278) (-369.278) * [-369.278] (-369.278) (-369.278) (-369.278)
500 -- (-237.297) (-234.759) [-235.421] (-247.011) * [-232.089] (-238.544) (-239.553) (-244.843) -- 0:00:00
1000 -- (-241.289) [-236.770] (-234.337) (-237.145) * (-244.146) (-236.853) (-237.401) [-237.629] -- 0:00:00
1500 -- (-235.183) [-233.916] (-239.234) (-239.037) * [-234.280] (-233.729) (-237.038) (-234.317) -- 0:00:00
2000 -- (-237.852) (-238.463) [-239.651] (-235.984) * (-240.256) [-237.846] (-234.291) (-240.515) -- 0:00:00
2500 -- (-240.021) (-237.948) [-237.768] (-244.472) * (-240.941) (-239.247) (-237.328) [-234.634] -- 0:00:00
3000 -- [-235.164] (-237.818) (-230.299) (-249.944) * [-233.863] (-235.690) (-231.538) (-232.143) -- 0:00:00
3500 -- (-234.619) (-237.837) [-234.418] (-247.373) * (-233.551) [-233.627] (-241.387) (-243.527) -- 0:00:00
4000 -- (-234.735) (-236.485) (-235.513) [-232.090] * (-240.745) [-234.347] (-233.911) (-239.159) -- 0:00:00
4500 -- (-234.273) (-234.119) [-236.520] (-235.007) * (-236.662) (-236.362) (-244.077) [-235.488] -- 0:00:00
5000 -- (-238.987) [-232.963] (-236.071) (-237.996) * [-236.180] (-238.291) (-233.676) (-242.512) -- 0:00:00
Average standard deviation of split frequencies: 0.055459
5500 -- (-237.590) (-235.802) (-242.217) [-234.125] * (-237.258) (-239.003) [-231.847] (-244.336) -- 0:00:00
6000 -- (-244.657) (-243.023) [-234.385] (-234.856) * (-243.257) (-230.159) (-234.391) [-238.678] -- 0:00:00
6500 -- [-234.747] (-238.105) (-237.893) (-237.993) * (-247.574) [-238.454] (-232.025) (-244.439) -- 0:00:00
7000 -- (-238.812) (-239.073) [-234.577] (-238.809) * (-244.946) [-236.213] (-243.979) (-257.730) -- 0:00:00
7500 -- [-233.103] (-233.408) (-233.688) (-248.272) * (-247.003) (-239.047) [-238.844] (-251.146) -- 0:00:00
8000 -- (-238.261) [-237.294] (-243.939) (-237.898) * (-246.586) [-233.535] (-237.165) (-242.483) -- 0:00:00
8500 -- (-230.087) (-239.093) (-245.076) [-234.419] * (-239.844) (-230.663) (-238.148) [-249.239] -- 0:00:00
9000 -- (-241.123) (-237.405) (-234.105) [-233.212] * (-232.143) [-238.249] (-238.384) (-241.652) -- 0:00:00
9500 -- (-242.900) (-241.655) [-235.570] (-227.508) * [-228.491] (-252.115) (-240.097) (-238.737) -- 0:00:00
10000 -- (-242.336) (-237.499) (-238.576) [-227.522] * (-226.986) (-237.855) (-240.932) [-235.519] -- 0:00:00
Average standard deviation of split frequencies: 0.066291
10500 -- (-245.111) (-235.067) (-239.733) [-226.520] * [-225.861] (-239.844) (-250.122) (-233.655) -- 0:00:00
11000 -- (-244.298) [-235.320] (-237.205) (-227.176) * [-227.756] (-246.237) (-248.043) (-227.796) -- 0:00:00
11500 -- (-244.182) (-237.653) (-236.584) [-226.289] * (-227.886) (-242.772) (-241.701) [-226.831] -- 0:00:00
12000 -- (-234.982) (-237.910) (-239.222) [-231.680] * [-227.743] (-238.831) (-228.704) (-228.135) -- 0:00:00
12500 -- (-227.080) (-242.330) (-240.097) [-226.666] * (-227.652) (-239.550) (-229.786) [-232.499] -- 0:00:00
13000 -- [-229.048] (-249.118) (-236.848) (-227.932) * [-227.131] (-239.574) (-231.421) (-228.557) -- 0:00:00
13500 -- [-228.133] (-245.196) (-237.208) (-228.382) * [-225.748] (-244.717) (-227.161) (-228.910) -- 0:00:00
14000 -- [-227.731] (-246.181) (-241.583) (-228.392) * [-226.376] (-256.969) (-229.129) (-227.796) -- 0:00:00
14500 -- (-228.374) (-236.678) [-244.373] (-226.339) * (-232.768) (-245.616) [-229.332] (-229.111) -- 0:00:00
15000 -- [-227.806] (-230.602) (-247.020) (-225.734) * (-230.144) (-241.819) (-228.970) [-229.703] -- 0:00:00
Average standard deviation of split frequencies: 0.058926
15500 -- (-225.930) (-230.323) [-237.995] (-230.188) * (-230.402) (-243.273) (-232.943) [-228.214] -- 0:00:00
16000 -- (-226.224) (-227.045) [-235.816] (-229.084) * (-228.928) (-235.839) (-227.543) [-229.270] -- 0:01:01
16500 -- (-228.657) (-229.476) (-238.863) [-227.355] * [-227.278] (-231.483) (-228.972) (-227.820) -- 0:00:59
17000 -- (-227.617) [-227.161] (-247.969) (-227.174) * (-229.081) [-233.288] (-228.638) (-228.861) -- 0:00:57
17500 -- (-228.406) [-230.871] (-245.994) (-228.528) * (-227.143) (-227.068) [-227.730] (-226.978) -- 0:00:56
18000 -- (-232.521) (-227.171) (-239.550) [-230.021] * (-227.481) (-229.309) (-227.333) [-226.816] -- 0:00:54
18500 -- (-225.841) (-226.609) [-229.741] (-226.805) * (-229.812) (-226.915) [-226.228] (-227.869) -- 0:00:53
19000 -- (-227.645) (-226.498) [-236.339] (-228.022) * [-230.288] (-226.902) (-228.096) (-228.136) -- 0:00:51
19500 -- (-230.629) [-228.100] (-241.819) (-228.080) * (-226.346) (-228.919) [-227.037] (-226.412) -- 0:00:50
20000 -- [-233.019] (-229.196) (-248.086) (-228.008) * [-229.115] (-225.689) (-226.221) (-228.461) -- 0:00:49
Average standard deviation of split frequencies: 0.061721
20500 -- (-229.418) (-229.958) (-241.568) [-227.577] * [-231.208] (-226.004) (-229.781) (-227.730) -- 0:00:47
21000 -- [-228.166] (-228.291) (-235.645) (-227.571) * (-226.607) (-228.353) [-227.732] (-234.441) -- 0:00:46
21500 -- (-227.229) (-228.650) (-227.193) [-226.984] * [-226.548] (-232.381) (-231.633) (-230.488) -- 0:00:45
22000 -- (-229.636) [-227.729] (-228.301) (-226.303) * (-231.042) [-227.113] (-229.325) (-229.161) -- 0:00:44
22500 -- (-228.537) [-228.379] (-226.435) (-227.794) * (-229.174) [-226.376] (-226.532) (-226.686) -- 0:00:43
23000 -- (-226.494) [-226.129] (-228.110) (-228.035) * (-226.263) (-226.926) (-229.079) [-228.529] -- 0:00:42
23500 -- (-227.187) [-226.984] (-229.100) (-227.216) * [-225.868] (-228.296) (-228.225) (-228.012) -- 0:00:41
24000 -- (-234.337) (-230.129) [-228.595] (-226.761) * (-227.101) [-226.367] (-227.458) (-228.462) -- 0:00:40
24500 -- (-230.154) (-225.988) (-228.503) [-228.476] * [-227.403] (-225.534) (-227.946) (-228.956) -- 0:00:39
25000 -- (-230.371) [-227.547] (-229.046) (-230.337) * (-229.985) (-228.493) (-230.366) [-228.792] -- 0:00:39
Average standard deviation of split frequencies: 0.046976
25500 -- (-230.208) (-227.837) (-232.092) [-229.674] * (-227.080) (-229.338) [-230.899] (-227.852) -- 0:00:38
26000 -- (-230.177) (-231.543) [-227.839] (-229.550) * (-228.831) [-228.674] (-227.378) (-226.102) -- 0:00:37
26500 -- (-226.931) (-232.593) (-228.617) [-226.150] * (-227.148) [-230.149] (-230.557) (-226.228) -- 0:00:36
27000 -- (-229.535) (-232.599) (-226.971) [-231.899] * (-229.460) [-230.100] (-229.219) (-229.308) -- 0:00:36
27500 -- [-228.707] (-226.043) (-225.842) (-231.174) * (-230.424) [-228.007] (-226.877) (-227.077) -- 0:00:35
28000 -- (-232.569) (-227.784) (-227.657) [-229.290] * (-226.206) (-227.698) [-226.264] (-226.749) -- 0:00:34
28500 -- (-231.137) (-226.981) [-226.285] (-226.803) * (-226.778) (-229.370) (-226.429) [-226.732] -- 0:00:34
29000 -- [-228.351] (-230.164) (-229.491) (-228.179) * (-225.790) (-226.998) [-226.177] (-229.471) -- 0:00:33
29500 -- (-229.656) (-231.731) (-227.590) [-228.862] * (-225.860) [-227.456] (-226.476) (-228.256) -- 0:00:32
30000 -- (-229.354) (-228.790) [-229.691] (-226.120) * (-227.602) [-229.231] (-227.534) (-234.007) -- 0:00:32
Average standard deviation of split frequencies: 0.046116
30500 -- (-230.560) (-229.102) (-227.786) [-228.636] * (-229.939) [-226.141] (-228.065) (-228.233) -- 0:00:31
31000 -- [-226.528] (-230.653) (-228.581) (-227.514) * [-226.941] (-231.829) (-228.498) (-227.321) -- 0:00:31
31500 -- (-227.710) (-228.765) (-229.913) [-226.239] * (-233.290) (-228.076) [-232.535] (-227.829) -- 0:00:30
32000 -- (-227.501) (-229.804) [-227.501] (-230.444) * (-230.066) (-230.208) (-229.225) [-227.769] -- 0:00:30
32500 -- [-227.810] (-229.187) (-229.920) (-226.877) * [-229.183] (-230.628) (-227.034) (-226.367) -- 0:00:29
33000 -- (-226.951) (-228.550) [-227.244] (-232.050) * (-226.766) (-227.398) (-230.675) [-226.693] -- 0:00:58
33500 -- (-228.463) [-227.928] (-226.128) (-226.875) * (-227.170) (-229.200) (-226.286) [-227.843] -- 0:00:57
34000 -- (-225.800) (-228.518) [-228.952] (-228.827) * (-226.217) [-228.171] (-227.439) (-227.199) -- 0:00:56
34500 -- [-229.238] (-230.421) (-227.240) (-229.227) * [-226.428] (-230.161) (-226.627) (-227.903) -- 0:00:55
35000 -- [-226.121] (-227.332) (-227.984) (-228.230) * (-227.500) [-225.939] (-227.381) (-230.195) -- 0:00:55
Average standard deviation of split frequencies: 0.036010
35500 -- [-226.038] (-227.824) (-229.010) (-226.720) * (-227.377) [-229.547] (-228.730) (-227.279) -- 0:00:54
36000 -- (-226.131) (-227.755) [-227.492] (-226.262) * [-226.044] (-230.104) (-228.882) (-227.435) -- 0:00:53
36500 -- [-227.735] (-229.402) (-226.523) (-227.876) * (-226.505) [-228.886] (-231.415) (-228.018) -- 0:00:52
37000 -- [-227.145] (-227.655) (-230.012) (-227.626) * (-229.024) (-226.102) [-226.325] (-228.820) -- 0:00:52
37500 -- (-226.598) (-227.401) (-227.277) [-227.362] * (-227.638) (-225.828) [-226.492] (-232.405) -- 0:00:51
38000 -- (-227.725) [-228.602] (-228.937) (-226.867) * (-228.313) (-225.993) [-227.546] (-237.398) -- 0:00:50
38500 -- (-226.718) (-225.896) (-226.082) [-227.594] * [-229.863] (-228.266) (-228.322) (-231.540) -- 0:00:49
39000 -- (-227.317) (-227.560) (-226.294) [-226.200] * (-230.499) (-228.848) [-227.216] (-227.305) -- 0:00:49
39500 -- (-229.211) (-226.900) (-231.215) [-226.617] * [-228.400] (-232.142) (-227.231) (-228.262) -- 0:00:48
40000 -- (-226.928) [-226.296] (-226.368) (-227.062) * [-228.928] (-229.557) (-229.735) (-226.766) -- 0:00:48
Average standard deviation of split frequencies: 0.035355
40500 -- (-229.367) (-225.941) [-226.001] (-226.515) * (-232.737) (-231.485) [-227.254] (-227.515) -- 0:00:47
41000 -- [-227.625] (-226.901) (-229.329) (-229.468) * (-237.542) (-229.841) [-228.544] (-227.119) -- 0:00:46
41500 -- (-226.428) [-226.299] (-226.954) (-228.795) * (-226.421) (-231.431) (-231.752) [-229.697] -- 0:00:46
42000 -- [-226.198] (-226.103) (-226.999) (-231.464) * (-226.840) [-232.618] (-226.006) (-228.268) -- 0:00:45
42500 -- (-225.954) (-228.082) [-227.045] (-226.171) * (-226.082) (-227.247) [-229.141] (-229.301) -- 0:00:45
43000 -- (-225.862) (-228.069) [-226.723] (-226.477) * (-228.207) [-226.131] (-228.387) (-228.370) -- 0:00:44
43500 -- [-227.739] (-227.099) (-230.172) (-228.762) * (-228.653) (-229.045) (-227.696) [-229.711] -- 0:00:43
44000 -- (-228.794) [-229.167] (-229.454) (-227.649) * (-228.519) [-226.558] (-229.242) (-227.538) -- 0:00:43
44500 -- (-228.964) (-227.667) (-226.898) [-229.114] * (-228.721) (-230.184) (-227.117) [-226.789] -- 0:00:42
45000 -- (-227.936) [-227.588] (-226.691) (-229.849) * [-225.829] (-227.640) (-227.091) (-227.350) -- 0:00:42
Average standard deviation of split frequencies: 0.029346
45500 -- (-229.719) (-227.520) [-226.324] (-226.642) * (-226.936) (-227.074) [-228.002] (-230.207) -- 0:00:41
46000 -- [-226.930] (-229.231) (-230.703) (-228.681) * (-227.077) [-227.567] (-228.417) (-233.103) -- 0:00:41
46500 -- (-226.919) [-227.048] (-225.636) (-228.262) * [-228.149] (-227.296) (-227.866) (-229.713) -- 0:00:41
47000 -- (-229.215) [-227.251] (-229.915) (-228.484) * (-226.984) (-228.213) [-226.908] (-230.001) -- 0:00:40
47500 -- [-228.384] (-229.745) (-229.311) (-226.006) * (-230.286) (-231.069) (-228.411) [-230.060] -- 0:00:40
48000 -- (-227.021) (-227.279) (-227.356) [-227.101] * (-227.261) (-228.016) (-227.748) [-226.402] -- 0:00:39
48500 -- (-227.080) [-227.704] (-226.962) (-226.626) * (-228.351) (-229.023) [-225.917] (-226.213) -- 0:00:39
49000 -- (-229.002) [-227.012] (-227.247) (-230.668) * (-229.158) [-226.072] (-225.945) (-229.280) -- 0:00:38
49500 -- (-229.998) [-226.431] (-228.525) (-229.036) * (-227.995) (-230.015) [-227.206] (-229.235) -- 0:00:38
50000 -- [-231.362] (-227.581) (-226.391) (-225.903) * (-231.094) (-228.262) [-227.579] (-227.097) -- 0:00:38
Average standard deviation of split frequencies: 0.033495
50500 -- (-229.444) (-226.934) (-227.027) [-226.919] * (-227.895) [-228.240] (-228.957) (-227.156) -- 0:00:56
51000 -- (-226.665) (-228.511) [-226.684] (-228.444) * (-228.069) [-227.459] (-228.671) (-226.495) -- 0:00:55
51500 -- (-227.081) (-227.134) (-227.050) [-226.597] * (-228.661) (-230.183) (-227.562) [-226.908] -- 0:00:55
52000 -- (-227.702) (-226.005) (-226.788) [-227.145] * (-236.165) (-229.286) (-229.328) [-227.945] -- 0:00:54
52500 -- (-226.488) (-228.185) [-230.066] (-229.126) * (-226.900) (-231.230) (-227.116) [-226.238] -- 0:00:54
53000 -- (-226.799) (-227.011) [-228.108] (-235.619) * [-227.667] (-232.314) (-228.308) (-228.461) -- 0:00:53
53500 -- (-227.001) (-228.025) [-229.863] (-229.583) * (-226.864) (-226.857) [-226.499] (-226.877) -- 0:00:53
54000 -- (-226.567) (-228.931) [-226.300] (-228.270) * [-226.674] (-227.164) (-226.877) (-227.302) -- 0:00:52
54500 -- [-225.850] (-228.215) (-227.083) (-228.215) * [-227.774] (-227.787) (-225.676) (-226.009) -- 0:00:52
55000 -- [-226.114] (-227.486) (-225.679) (-227.412) * (-230.302) [-227.533] (-226.256) (-226.254) -- 0:00:51
Average standard deviation of split frequencies: 0.034820
55500 -- [-225.679] (-227.921) (-231.551) (-226.247) * [-229.235] (-225.915) (-230.293) (-230.187) -- 0:00:51
56000 -- (-226.892) (-228.613) (-230.077) [-228.065] * [-226.114] (-228.390) (-228.997) (-229.765) -- 0:00:50
56500 -- [-228.512] (-231.571) (-227.932) (-230.419) * (-227.931) (-229.449) (-228.620) [-225.943] -- 0:00:50
57000 -- (-231.773) (-226.329) [-226.983] (-226.802) * [-228.365] (-230.660) (-226.952) (-227.620) -- 0:00:49
57500 -- (-229.555) (-227.312) [-227.107] (-229.706) * [-229.782] (-226.040) (-227.545) (-227.813) -- 0:00:49
58000 -- (-227.817) [-225.956] (-228.067) (-226.919) * (-230.823) [-227.891] (-228.780) (-231.217) -- 0:00:48
58500 -- (-227.038) (-226.029) (-229.766) [-227.872] * (-226.191) (-227.111) [-228.640] (-229.025) -- 0:00:48
59000 -- (-226.680) (-228.094) (-226.647) [-227.085] * (-228.051) (-226.805) [-228.984] (-226.765) -- 0:00:47
59500 -- (-228.460) (-227.839) [-226.653] (-228.838) * [-228.567] (-226.803) (-230.233) (-226.781) -- 0:00:47
60000 -- (-227.864) (-227.276) (-229.331) [-227.226] * (-227.842) (-227.931) (-226.801) [-226.958] -- 0:00:47
Average standard deviation of split frequencies: 0.035522
60500 -- (-227.791) (-227.937) [-230.967] (-226.916) * (-226.324) (-227.429) [-227.907] (-227.493) -- 0:00:46
61000 -- [-227.250] (-229.040) (-228.257) (-226.283) * (-227.448) (-226.041) [-228.546] (-231.176) -- 0:00:46
61500 -- (-227.224) (-226.314) (-228.185) [-227.504] * (-226.522) (-228.707) (-227.283) [-229.937] -- 0:00:45
62000 -- (-229.016) (-225.942) [-228.753] (-225.895) * (-226.590) [-228.768] (-226.521) (-228.027) -- 0:00:45
62500 -- (-233.190) (-227.692) (-229.058) [-227.113] * (-225.878) [-226.356] (-227.473) (-234.285) -- 0:00:45
63000 -- (-227.737) (-227.736) [-228.567] (-229.885) * (-229.800) (-227.486) [-227.051] (-227.272) -- 0:00:44
63500 -- (-228.762) (-227.373) [-226.993] (-227.605) * (-231.008) (-230.778) (-228.282) [-227.042] -- 0:00:44
64000 -- (-228.995) (-230.446) [-226.819] (-231.564) * (-227.939) (-228.474) [-226.798] (-230.191) -- 0:00:43
64500 -- (-230.820) (-229.880) (-229.597) [-227.766] * (-226.585) (-227.695) [-227.544] (-226.766) -- 0:00:43
65000 -- (-229.201) [-227.184] (-230.080) (-230.394) * (-227.588) [-227.544] (-226.874) (-227.052) -- 0:00:43
Average standard deviation of split frequencies: 0.039608
65500 -- [-226.441] (-228.705) (-228.820) (-229.192) * (-227.457) [-229.332] (-226.820) (-228.042) -- 0:00:42
66000 -- (-226.109) (-228.889) (-228.564) [-229.393] * [-227.468] (-226.664) (-226.358) (-235.103) -- 0:00:42
66500 -- (-226.798) (-229.215) [-228.626] (-228.709) * [-227.707] (-228.406) (-226.551) (-230.757) -- 0:00:42
67000 -- (-228.530) (-226.550) (-227.921) [-227.288] * [-228.344] (-228.616) (-229.062) (-229.555) -- 0:00:41
67500 -- (-230.327) (-228.951) (-228.253) [-228.348] * (-229.102) (-228.139) [-230.001] (-230.549) -- 0:00:55
68000 -- (-226.644) (-229.630) [-227.688] (-227.658) * (-231.072) (-226.923) [-228.320] (-227.610) -- 0:00:54
68500 -- (-225.759) (-229.719) [-226.876] (-228.837) * (-227.545) (-226.094) [-227.562] (-229.554) -- 0:00:54
69000 -- (-227.632) (-226.389) [-226.151] (-229.200) * (-228.013) (-226.267) (-227.277) [-228.121] -- 0:00:53
69500 -- [-227.454] (-226.168) (-229.525) (-227.731) * (-231.245) (-230.797) (-228.372) [-230.056] -- 0:00:53
70000 -- [-225.960] (-229.059) (-228.900) (-225.747) * [-227.027] (-232.399) (-227.640) (-227.516) -- 0:00:53
Average standard deviation of split frequencies: 0.038437
70500 -- (-226.210) [-227.496] (-226.791) (-228.455) * (-230.392) (-226.777) (-227.406) [-229.741] -- 0:00:52
71000 -- (-226.745) (-228.863) [-227.185] (-232.969) * (-230.837) (-228.456) (-225.761) [-230.554] -- 0:00:52
71500 -- (-226.353) (-228.632) (-232.067) [-226.583] * (-230.845) (-227.985) [-227.768] (-236.464) -- 0:00:51
72000 -- (-225.933) (-231.715) [-229.313] (-227.600) * [-233.976] (-226.252) (-228.593) (-230.697) -- 0:00:51
72500 -- (-227.701) (-226.671) [-228.718] (-225.853) * (-227.137) [-225.867] (-230.847) (-232.117) -- 0:00:51
73000 -- [-231.236] (-227.014) (-227.809) (-228.759) * [-226.542] (-227.569) (-229.432) (-228.933) -- 0:00:50
73500 -- (-228.677) (-230.087) [-229.791] (-226.363) * (-226.997) (-227.890) [-228.133] (-227.627) -- 0:00:50
74000 -- [-228.115] (-227.393) (-229.945) (-230.930) * [-227.635] (-226.843) (-230.582) (-227.617) -- 0:00:50
74500 -- (-226.467) [-227.949] (-226.925) (-228.392) * (-233.255) (-229.751) (-233.211) [-226.430] -- 0:00:49
75000 -- (-229.726) (-230.585) (-226.737) [-229.012] * (-230.533) (-226.820) [-228.102] (-226.992) -- 0:00:49
Average standard deviation of split frequencies: 0.033967
75500 -- [-229.016] (-233.535) (-229.609) (-226.776) * (-232.107) [-225.985] (-227.855) (-226.972) -- 0:00:48
76000 -- (-227.776) (-226.912) (-227.887) [-226.776] * (-229.995) (-226.594) (-226.119) [-226.894] -- 0:00:48
76500 -- (-226.892) [-227.092] (-230.660) (-227.061) * (-228.456) (-231.215) [-227.752] (-229.827) -- 0:00:48
77000 -- [-228.107] (-226.389) (-227.919) (-229.164) * [-225.907] (-226.848) (-230.358) (-228.438) -- 0:00:47
77500 -- (-228.502) (-230.273) (-226.227) [-227.974] * (-226.113) [-228.338] (-226.604) (-226.709) -- 0:00:47
78000 -- (-229.614) (-229.381) (-230.371) [-226.605] * (-231.004) (-226.501) (-227.343) [-228.048] -- 0:00:47
78500 -- [-231.200] (-225.939) (-231.485) (-227.098) * [-231.575] (-229.059) (-229.671) (-227.314) -- 0:00:46
79000 -- (-227.333) (-229.062) (-228.125) [-228.318] * (-228.976) (-228.524) [-226.585] (-229.765) -- 0:00:46
79500 -- (-226.543) (-228.557) [-226.631] (-231.451) * (-226.330) (-228.066) [-227.324] (-231.611) -- 0:00:46
80000 -- (-225.963) [-228.555] (-230.719) (-226.671) * (-226.307) [-227.779] (-226.803) (-228.787) -- 0:00:46
Average standard deviation of split frequencies: 0.038402
80500 -- (-230.308) (-229.532) (-226.758) [-228.600] * (-227.640) [-229.340] (-226.157) (-226.107) -- 0:00:45
81000 -- (-228.883) [-226.810] (-226.133) (-230.816) * (-226.889) (-229.480) (-227.849) [-225.903] -- 0:00:45
81500 -- [-227.736] (-229.753) (-227.356) (-229.510) * (-227.561) (-230.223) [-227.382] (-226.816) -- 0:00:45
82000 -- [-226.890] (-226.293) (-227.637) (-228.207) * [-226.134] (-227.093) (-226.469) (-227.849) -- 0:00:44
82500 -- (-227.102) [-226.109] (-227.996) (-230.319) * (-230.893) (-230.462) (-228.452) [-226.244] -- 0:00:44
83000 -- (-227.744) (-228.212) (-230.402) [-227.320] * (-233.385) (-228.644) (-227.851) [-225.738] -- 0:00:44
83500 -- (-228.212) [-227.867] (-227.304) (-229.107) * (-232.412) [-227.219] (-230.306) (-238.177) -- 0:00:43
84000 -- (-227.203) (-228.151) (-227.060) [-227.118] * (-228.740) [-228.631] (-229.412) (-230.850) -- 0:00:43
84500 -- (-229.249) (-226.921) (-226.168) [-228.039] * (-228.598) [-227.903] (-228.005) (-233.396) -- 0:00:43
85000 -- (-228.894) (-229.395) (-228.585) [-230.644] * [-228.149] (-227.051) (-229.728) (-227.676) -- 0:00:53
Average standard deviation of split frequencies: 0.035629
85500 -- (-228.009) (-228.753) (-229.824) [-229.851] * (-229.835) [-228.686] (-228.350) (-227.837) -- 0:00:53
86000 -- [-227.194] (-230.419) (-226.343) (-228.295) * (-227.831) (-226.692) [-229.158] (-227.011) -- 0:00:53
86500 -- (-226.121) (-235.208) [-227.802] (-226.142) * (-228.149) (-226.070) [-228.770] (-226.083) -- 0:00:52
87000 -- [-226.083] (-228.230) (-228.421) (-227.500) * [-226.451] (-227.774) (-226.500) (-228.100) -- 0:00:52
87500 -- (-228.732) (-229.508) [-230.042] (-225.699) * (-229.668) [-227.769] (-228.305) (-228.781) -- 0:00:52
88000 -- (-226.633) [-229.850] (-227.769) (-226.212) * (-226.548) [-226.187] (-232.194) (-229.694) -- 0:00:51
88500 -- [-227.613] (-230.990) (-227.868) (-229.953) * (-225.993) [-227.680] (-234.861) (-229.469) -- 0:00:51
89000 -- (-226.276) (-228.771) (-226.627) [-228.675] * [-226.005] (-228.479) (-230.683) (-227.953) -- 0:00:51
89500 -- [-226.818] (-229.555) (-229.512) (-226.587) * (-227.596) [-230.395] (-227.894) (-226.082) -- 0:00:50
90000 -- (-226.285) [-228.893] (-226.505) (-228.840) * (-226.867) (-227.986) [-227.935] (-229.894) -- 0:00:50
Average standard deviation of split frequencies: 0.027482
90500 -- (-228.258) (-226.406) [-225.888] (-228.655) * (-228.605) (-226.464) [-227.579] (-230.350) -- 0:00:50
91000 -- (-227.971) [-229.691] (-226.398) (-226.711) * [-226.402] (-228.641) (-229.755) (-227.623) -- 0:00:49
91500 -- [-227.103] (-229.826) (-228.004) (-226.457) * (-226.170) [-226.876] (-226.658) (-227.111) -- 0:00:49
92000 -- (-229.571) (-226.983) (-231.317) [-226.294] * (-226.133) [-227.715] (-229.706) (-227.302) -- 0:00:49
92500 -- (-226.793) (-227.762) [-226.427] (-226.134) * (-227.299) (-228.570) [-227.198] (-228.659) -- 0:00:49
93000 -- (-228.023) [-228.550] (-226.131) (-228.587) * (-229.683) (-229.079) (-226.640) [-226.658] -- 0:00:48
93500 -- (-230.459) (-229.379) (-228.760) [-226.275] * (-226.618) [-229.136] (-228.398) (-229.702) -- 0:00:48
94000 -- (-230.552) (-227.207) [-227.013] (-227.013) * (-227.490) (-227.990) [-227.534] (-227.587) -- 0:00:48
94500 -- [-227.621] (-231.879) (-229.078) (-234.803) * (-235.331) (-228.197) [-228.798] (-228.103) -- 0:00:47
95000 -- (-229.516) (-228.283) (-229.866) [-226.191] * (-232.060) (-228.985) (-227.337) [-228.614] -- 0:00:47
Average standard deviation of split frequencies: 0.029463
95500 -- (-231.291) (-228.816) [-226.727] (-228.650) * (-227.894) [-226.612] (-228.889) (-228.764) -- 0:00:47
96000 -- (-230.063) (-227.030) (-227.568) [-228.127] * (-227.097) (-229.364) [-235.334] (-226.454) -- 0:00:47
96500 -- [-229.624] (-230.484) (-225.423) (-226.880) * (-228.362) (-233.102) [-226.702] (-226.051) -- 0:00:46
97000 -- (-226.050) [-228.821] (-227.799) (-226.533) * (-230.407) (-227.571) [-227.523] (-227.551) -- 0:00:46
97500 -- (-229.219) [-228.155] (-229.655) (-229.081) * (-228.816) (-229.134) (-225.901) [-229.055] -- 0:00:46
98000 -- (-227.006) (-226.947) (-228.147) [-226.916] * [-227.249] (-227.163) (-227.250) (-227.857) -- 0:00:46
98500 -- [-225.795] (-227.634) (-234.236) (-229.385) * [-227.296] (-227.713) (-229.923) (-228.393) -- 0:00:45
99000 -- [-228.621] (-231.506) (-227.506) (-231.762) * (-229.854) (-228.701) [-229.805] (-226.917) -- 0:00:45
99500 -- (-229.735) (-228.715) (-227.604) [-228.655] * (-226.213) [-226.745] (-228.588) (-227.842) -- 0:00:45
100000 -- [-229.823] (-228.416) (-231.586) (-231.730) * [-226.440] (-226.662) (-227.790) (-229.044) -- 0:00:45
Average standard deviation of split frequencies: 0.027651
100500 -- (-227.975) [-226.646] (-232.948) (-229.447) * (-227.168) [-226.571] (-229.552) (-226.579) -- 0:00:44
101000 -- (-225.858) (-227.406) (-227.848) [-228.342] * (-227.486) (-227.869) (-228.767) [-229.217] -- 0:00:44
101500 -- (-226.991) (-226.764) [-229.615] (-230.151) * [-227.351] (-228.141) (-228.554) (-230.853) -- 0:00:53
102000 -- (-230.526) (-227.078) (-231.393) [-226.941] * [-226.052] (-227.819) (-228.175) (-230.796) -- 0:00:52
102500 -- (-228.987) [-227.597] (-234.963) (-231.208) * [-227.496] (-226.569) (-230.383) (-234.632) -- 0:00:52
103000 -- [-228.256] (-228.611) (-230.107) (-228.320) * (-225.887) (-227.309) (-231.464) [-226.312] -- 0:00:52
103500 -- (-226.405) [-227.675] (-228.579) (-228.405) * (-229.757) (-226.098) (-230.023) [-226.634] -- 0:00:51
104000 -- [-229.782] (-226.870) (-227.484) (-231.652) * (-227.583) (-231.593) (-227.808) [-227.109] -- 0:00:51
104500 -- (-231.770) (-230.263) (-227.380) [-227.075] * [-225.945] (-227.787) (-230.271) (-229.185) -- 0:00:51
105000 -- (-226.059) (-226.196) [-226.903] (-227.033) * [-226.465] (-229.248) (-229.567) (-229.635) -- 0:00:51
Average standard deviation of split frequencies: 0.025875
105500 -- (-228.728) (-228.699) [-226.829] (-229.912) * [-227.682] (-230.208) (-229.417) (-230.768) -- 0:00:50
106000 -- (-228.006) (-228.021) [-226.132] (-227.590) * [-226.963] (-229.744) (-228.369) (-227.298) -- 0:00:50
106500 -- (-227.887) (-226.640) [-227.437] (-228.056) * [-229.057] (-228.652) (-225.752) (-227.887) -- 0:00:50
107000 -- [-226.164] (-227.378) (-226.688) (-226.582) * [-226.953] (-227.613) (-229.840) (-226.392) -- 0:00:50
107500 -- (-226.770) [-227.718] (-227.937) (-226.715) * (-230.159) [-229.639] (-228.560) (-228.369) -- 0:00:49
108000 -- (-231.645) (-228.781) (-228.929) [-227.236] * (-226.378) [-230.185] (-228.418) (-236.933) -- 0:00:49
108500 -- [-230.056] (-226.292) (-227.986) (-226.034) * (-226.913) [-226.597] (-227.435) (-229.497) -- 0:00:49
109000 -- (-231.778) (-228.120) [-227.342] (-229.723) * (-227.652) (-225.757) [-229.622] (-226.136) -- 0:00:49
109500 -- (-228.887) (-229.250) [-227.824] (-233.890) * [-227.366] (-226.969) (-227.996) (-228.436) -- 0:00:48
110000 -- (-228.707) (-229.490) (-228.124) [-230.531] * (-227.218) (-226.261) [-226.560] (-227.543) -- 0:00:48
Average standard deviation of split frequencies: 0.023622
110500 -- (-229.062) [-225.974] (-231.191) (-227.782) * (-228.041) (-228.966) (-226.014) [-225.982] -- 0:00:48
111000 -- [-228.261] (-227.434) (-228.505) (-227.990) * (-227.296) (-228.104) (-226.426) [-225.967] -- 0:00:48
111500 -- (-229.100) (-226.477) (-226.185) [-227.145] * (-227.093) (-227.493) [-226.526] (-227.225) -- 0:00:47
112000 -- (-226.295) (-230.753) (-228.602) [-231.729] * [-227.693] (-229.435) (-226.777) (-228.242) -- 0:00:47
112500 -- (-229.222) [-229.363] (-228.821) (-231.949) * (-227.198) (-226.517) (-226.490) [-226.155] -- 0:00:47
113000 -- (-229.027) (-231.006) (-227.537) [-229.200] * (-226.145) (-227.018) [-226.443] (-226.121) -- 0:00:47
113500 -- (-227.957) (-227.262) [-226.450] (-228.601) * (-226.808) [-227.895] (-227.308) (-227.631) -- 0:00:46
114000 -- (-233.230) [-227.848] (-231.045) (-225.795) * (-228.131) (-229.679) [-226.144] (-226.527) -- 0:00:46
114500 -- (-227.461) (-230.856) [-230.980] (-228.938) * (-227.058) (-228.777) (-226.776) [-226.765] -- 0:00:46
115000 -- (-228.135) (-227.276) (-226.905) [-227.144] * (-226.965) [-225.785] (-229.807) (-229.741) -- 0:00:46
Average standard deviation of split frequencies: 0.022721
115500 -- (-227.714) (-228.664) [-229.576] (-227.049) * (-229.390) (-226.162) (-225.884) [-225.655] -- 0:00:45
116000 -- (-230.113) (-227.366) [-230.959] (-228.825) * (-227.666) (-229.432) (-228.158) [-226.356] -- 0:00:45
116500 -- [-226.737] (-235.964) (-229.752) (-231.262) * (-228.202) (-230.986) (-226.418) [-226.377] -- 0:00:45
117000 -- (-226.491) (-229.857) [-228.303] (-228.083) * (-227.940) (-227.658) (-225.972) [-229.278] -- 0:00:45
117500 -- (-229.092) (-228.339) [-228.484] (-227.358) * [-227.393] (-233.510) (-226.479) (-225.925) -- 0:00:45
118000 -- [-229.669] (-227.164) (-230.385) (-227.406) * (-229.753) [-227.443] (-225.824) (-226.429) -- 0:00:44
118500 -- (-228.193) (-233.483) (-228.293) [-227.389] * [-227.126] (-229.898) (-229.336) (-225.986) -- 0:00:44
119000 -- (-230.268) [-226.269] (-230.589) (-228.347) * [-227.809] (-227.327) (-227.557) (-226.455) -- 0:00:51
119500 -- (-228.116) [-230.547] (-228.790) (-226.844) * (-227.653) [-228.931] (-229.253) (-226.102) -- 0:00:51
120000 -- (-227.500) (-230.344) [-228.282] (-229.403) * (-228.565) [-227.220] (-229.112) (-227.933) -- 0:00:51
Average standard deviation of split frequencies: 0.021132
120500 -- (-227.119) (-228.868) (-226.129) [-226.976] * (-227.478) (-226.345) (-228.575) [-228.832] -- 0:00:51
121000 -- (-226.825) (-230.023) [-227.060] (-227.867) * (-229.301) [-228.562] (-229.335) (-228.816) -- 0:00:50
121500 -- (-225.950) [-229.015] (-227.887) (-228.711) * (-227.565) [-227.243] (-230.342) (-229.336) -- 0:00:50
122000 -- (-228.122) (-231.761) (-226.346) [-227.464] * [-229.691] (-229.094) (-229.899) (-226.061) -- 0:00:50
122500 -- (-227.935) [-228.914] (-227.714) (-226.003) * (-229.209) (-227.744) [-227.238] (-227.074) -- 0:00:50
123000 -- (-226.666) (-229.587) (-227.548) [-226.256] * (-226.127) (-226.679) [-229.109] (-232.150) -- 0:00:49
123500 -- [-226.094] (-229.674) (-231.969) (-228.608) * [-227.329] (-230.649) (-235.147) (-227.174) -- 0:00:49
124000 -- (-226.359) (-226.357) (-227.257) [-226.493] * (-226.846) (-231.726) [-227.677] (-229.964) -- 0:00:49
124500 -- (-234.120) (-227.992) [-229.486] (-227.772) * (-229.943) (-229.477) [-227.232] (-227.835) -- 0:00:49
125000 -- (-227.331) (-228.201) (-225.914) [-226.194] * (-228.361) (-230.265) (-227.312) [-226.897] -- 0:00:49
Average standard deviation of split frequencies: 0.020488
125500 -- [-230.655] (-226.031) (-228.180) (-231.410) * [-228.133] (-226.243) (-229.806) (-233.192) -- 0:00:48
126000 -- (-227.765) [-226.142] (-232.491) (-227.246) * [-227.039] (-226.736) (-228.000) (-227.587) -- 0:00:48
126500 -- (-226.238) (-228.200) [-227.881] (-227.314) * (-228.849) [-225.531] (-226.612) (-228.535) -- 0:00:48
127000 -- (-232.738) [-226.945] (-227.619) (-228.752) * (-225.925) (-229.275) (-229.072) [-227.558] -- 0:00:48
127500 -- (-229.113) (-226.636) [-228.033] (-228.659) * [-228.134] (-226.828) (-226.448) (-227.478) -- 0:00:47
128000 -- (-228.583) (-228.864) [-227.069] (-228.308) * (-227.620) (-225.551) (-226.487) [-226.600] -- 0:00:47
128500 -- (-231.922) (-228.485) [-227.828] (-229.033) * (-227.771) (-228.081) [-228.054] (-228.971) -- 0:00:47
129000 -- (-229.316) (-227.355) [-227.228] (-228.761) * [-234.034] (-226.691) (-228.738) (-226.350) -- 0:00:47
129500 -- (-231.033) (-231.102) (-227.715) [-229.660] * (-227.854) (-229.201) [-226.296] (-228.349) -- 0:00:47
130000 -- (-228.868) (-226.498) [-226.081] (-229.198) * (-228.849) [-226.155] (-230.221) (-235.533) -- 0:00:46
Average standard deviation of split frequencies: 0.020959
130500 -- (-227.042) (-230.265) [-228.377] (-228.776) * [-227.694] (-231.681) (-227.946) (-231.522) -- 0:00:46
131000 -- (-227.209) (-228.729) (-229.303) [-227.743] * (-226.392) (-226.515) (-230.689) [-228.863] -- 0:00:46
131500 -- (-226.324) (-228.747) [-226.908] (-227.230) * (-226.789) (-227.659) [-229.053] (-227.359) -- 0:00:46
132000 -- (-231.281) [-231.835] (-227.556) (-229.814) * [-229.656] (-226.237) (-232.652) (-227.857) -- 0:00:46
132500 -- (-228.608) [-225.841] (-227.306) (-227.389) * (-232.273) (-228.599) (-232.126) [-227.023] -- 0:00:45
133000 -- (-227.716) (-226.373) [-228.763] (-227.900) * [-229.710] (-226.446) (-234.068) (-226.015) -- 0:00:45
133500 -- [-229.360] (-228.051) (-232.320) (-227.897) * (-227.836) [-227.909] (-232.324) (-226.601) -- 0:00:45
134000 -- (-230.427) [-227.650] (-229.267) (-227.002) * (-229.625) (-233.469) [-228.766] (-228.559) -- 0:00:45
134500 -- (-227.401) [-229.073] (-226.377) (-227.933) * (-227.558) [-226.754] (-231.131) (-227.460) -- 0:00:45
135000 -- [-228.696] (-226.651) (-230.504) (-228.633) * (-226.480) [-229.126] (-230.096) (-227.857) -- 0:00:44
Average standard deviation of split frequencies: 0.021457
135500 -- [-229.166] (-226.758) (-228.282) (-227.983) * [-225.967] (-229.091) (-229.532) (-226.366) -- 0:00:44
136000 -- (-227.447) (-227.105) (-229.983) [-229.645] * [-226.516] (-230.278) (-233.199) (-226.374) -- 0:00:50
136500 -- (-230.827) (-226.829) (-228.139) [-227.492] * [-226.639] (-228.975) (-231.894) (-227.843) -- 0:00:50
137000 -- (-226.372) (-226.764) [-226.924] (-228.927) * (-226.623) (-227.480) [-230.927] (-228.010) -- 0:00:50
137500 -- (-226.122) [-226.043] (-227.343) (-233.307) * (-227.497) [-227.239] (-228.299) (-232.157) -- 0:00:50
138000 -- [-227.474] (-226.574) (-227.863) (-230.833) * (-227.140) (-229.815) (-230.740) [-231.508] -- 0:00:49
138500 -- (-225.760) (-226.389) [-226.233] (-227.263) * (-227.830) (-228.557) [-226.187] (-227.186) -- 0:00:49
139000 -- (-228.389) (-226.355) (-226.437) [-228.855] * (-227.426) (-230.827) [-226.491] (-228.011) -- 0:00:49
139500 -- (-227.351) (-234.852) (-226.364) [-228.681] * (-230.834) (-230.013) (-226.143) [-227.130] -- 0:00:49
140000 -- (-226.449) (-229.172) (-227.011) [-230.310] * (-228.828) (-225.612) [-227.958] (-228.016) -- 0:00:49
Average standard deviation of split frequencies: 0.021615
140500 -- [-226.849] (-228.005) (-226.940) (-228.836) * (-227.656) [-229.028] (-226.802) (-226.557) -- 0:00:48
141000 -- (-226.881) (-229.099) (-228.128) [-227.904] * [-225.894] (-228.145) (-227.738) (-226.978) -- 0:00:48
141500 -- (-231.235) [-226.249] (-226.767) (-228.795) * (-227.825) (-229.050) [-227.786] (-226.766) -- 0:00:48
142000 -- (-227.923) (-229.856) (-227.393) [-227.444] * (-231.364) [-226.609] (-227.702) (-228.513) -- 0:00:48
142500 -- [-227.331] (-226.256) (-226.725) (-228.938) * [-225.855] (-229.497) (-226.071) (-228.031) -- 0:00:48
143000 -- [-226.445] (-227.222) (-228.183) (-230.382) * (-226.225) (-226.604) (-228.437) [-226.584] -- 0:00:47
143500 -- (-226.101) (-226.552) (-228.153) [-227.902] * (-228.796) [-227.316] (-226.611) (-226.513) -- 0:00:47
144000 -- (-227.056) (-230.499) [-226.408] (-226.516) * (-227.894) [-226.754] (-226.119) (-227.800) -- 0:00:47
144500 -- (-230.631) (-227.140) [-227.351] (-227.686) * (-225.936) (-226.401) [-229.943] (-230.365) -- 0:00:47
145000 -- (-228.149) (-227.901) (-229.776) [-228.987] * (-226.844) (-228.057) (-227.988) [-228.737] -- 0:00:47
Average standard deviation of split frequencies: 0.021064
145500 -- (-229.068) [-228.092] (-228.953) (-227.118) * (-229.040) (-226.869) [-226.991] (-230.247) -- 0:00:46
146000 -- [-229.803] (-226.768) (-228.717) (-229.630) * (-228.017) (-231.913) [-230.374] (-230.550) -- 0:00:46
146500 -- (-226.339) (-229.066) [-227.722] (-227.607) * (-228.334) (-230.445) (-226.246) [-230.827] -- 0:00:46
147000 -- [-229.200] (-227.295) (-226.898) (-227.514) * [-227.689] (-227.392) (-225.637) (-230.509) -- 0:00:46
147500 -- (-227.097) (-229.691) (-231.493) [-227.726] * [-228.247] (-229.089) (-227.268) (-228.350) -- 0:00:46
148000 -- (-230.155) (-229.563) (-232.092) [-227.301] * (-230.003) [-231.586] (-226.203) (-230.838) -- 0:00:46
148500 -- (-226.390) (-231.618) [-227.453] (-226.943) * (-227.771) (-228.875) (-227.501) [-234.290] -- 0:00:45
149000 -- [-226.542] (-228.154) (-230.198) (-227.361) * (-227.433) (-226.489) (-229.980) [-228.419] -- 0:00:45
149500 -- (-226.009) [-228.893] (-227.533) (-227.918) * (-229.575) [-228.765] (-229.446) (-228.246) -- 0:00:45
150000 -- [-227.825] (-227.220) (-226.296) (-230.591) * (-231.804) (-227.332) [-226.752] (-227.217) -- 0:00:45
Average standard deviation of split frequencies: 0.019711
150500 -- [-228.614] (-228.098) (-228.344) (-227.471) * (-226.680) [-227.027] (-226.582) (-227.264) -- 0:00:45
151000 -- (-226.121) (-226.729) [-228.700] (-227.828) * (-227.246) (-227.079) (-229.791) [-227.312] -- 0:00:44
151500 -- (-226.960) (-233.161) (-228.929) [-226.378] * (-226.146) (-227.671) (-226.365) [-226.495] -- 0:00:50
152000 -- (-231.241) (-225.949) [-225.996] (-226.804) * (-226.868) (-228.858) (-226.086) [-227.947] -- 0:00:50
152500 -- (-230.126) (-225.634) (-228.997) [-226.352] * (-227.139) (-228.874) [-227.521] (-233.782) -- 0:00:50
153000 -- (-226.501) (-227.217) (-227.078) [-230.142] * (-226.429) (-229.139) [-230.466] (-226.518) -- 0:00:49
153500 -- [-226.342] (-230.217) (-228.282) (-228.846) * (-226.065) (-227.469) [-229.279] (-227.895) -- 0:00:49
154000 -- (-226.991) [-227.075] (-227.483) (-230.311) * (-225.631) (-228.224) (-226.287) [-226.706] -- 0:00:49
154500 -- [-225.748] (-225.721) (-227.831) (-227.132) * (-230.078) (-229.782) (-226.460) [-226.349] -- 0:00:49
155000 -- (-228.898) [-227.070] (-228.816) (-227.872) * [-230.774] (-230.486) (-227.569) (-226.650) -- 0:00:49
Average standard deviation of split frequencies: 0.020835
155500 -- (-233.514) [-227.756] (-230.262) (-226.992) * (-228.251) (-227.075) (-226.368) [-230.531] -- 0:00:48
156000 -- [-227.735] (-233.713) (-227.430) (-227.466) * (-229.660) (-228.713) [-225.905] (-231.559) -- 0:00:48
156500 -- [-227.669] (-229.247) (-230.158) (-229.205) * (-226.664) (-228.098) [-229.852] (-233.380) -- 0:00:48
157000 -- (-226.312) [-227.490] (-226.883) (-230.093) * (-226.541) [-226.453] (-229.078) (-227.204) -- 0:00:48
157500 -- (-228.614) (-228.286) [-226.550] (-229.289) * (-229.086) (-227.551) [-228.150] (-227.393) -- 0:00:48
158000 -- (-228.157) (-228.004) (-228.341) [-225.716] * (-237.124) [-225.636] (-228.065) (-227.960) -- 0:00:47
158500 -- [-226.906] (-228.142) (-228.428) (-230.695) * (-226.689) [-226.338] (-227.712) (-227.347) -- 0:00:47
159000 -- [-226.787] (-227.647) (-227.552) (-228.208) * (-227.731) (-227.950) [-229.273] (-227.469) -- 0:00:47
159500 -- (-227.533) (-227.429) (-226.958) [-226.678] * (-225.951) (-227.774) (-232.056) [-226.089] -- 0:00:47
160000 -- (-227.589) [-229.544] (-229.024) (-228.192) * [-228.130] (-227.799) (-228.957) (-227.598) -- 0:00:47
Average standard deviation of split frequencies: 0.020847
160500 -- (-228.253) (-228.903) [-227.077] (-229.555) * (-228.449) [-226.008] (-226.455) (-226.671) -- 0:00:47
161000 -- (-226.483) [-227.117] (-227.681) (-230.518) * (-233.617) (-226.241) [-229.534] (-227.654) -- 0:00:46
161500 -- (-226.658) [-227.146] (-226.200) (-227.764) * [-230.803] (-226.569) (-227.504) (-232.105) -- 0:00:46
162000 -- (-225.909) (-228.571) [-226.833] (-227.981) * (-227.049) (-226.249) (-232.486) [-228.397] -- 0:00:46
162500 -- (-229.055) [-227.279] (-228.904) (-227.941) * [-226.363] (-228.021) (-235.562) (-229.809) -- 0:00:46
163000 -- [-227.211] (-228.820) (-232.926) (-230.044) * [-226.488] (-229.625) (-242.519) (-227.725) -- 0:00:46
163500 -- (-229.116) (-228.170) (-230.184) [-229.906] * (-229.369) (-232.207) [-240.470] (-226.479) -- 0:00:46
164000 -- (-227.385) [-226.743] (-227.967) (-230.595) * (-230.406) (-230.672) (-237.030) [-226.250] -- 0:00:45
164500 -- (-228.894) (-228.753) (-226.289) [-230.451] * (-228.219) (-229.821) [-226.636] (-227.739) -- 0:00:45
165000 -- (-227.340) (-226.768) (-226.697) [-227.657] * (-231.609) (-227.120) [-227.104] (-229.789) -- 0:00:45
Average standard deviation of split frequencies: 0.019580
165500 -- (-227.657) (-226.648) (-227.560) [-227.016] * [-226.767] (-227.318) (-227.701) (-226.541) -- 0:00:45
166000 -- [-227.009] (-227.600) (-225.725) (-227.548) * (-227.529) [-226.932] (-232.025) (-226.241) -- 0:00:45
166500 -- [-226.899] (-227.355) (-226.335) (-227.363) * (-227.326) (-226.927) (-232.058) [-226.554] -- 0:00:45
167000 -- [-228.712] (-231.872) (-226.504) (-227.341) * [-227.638] (-229.357) (-229.451) (-226.672) -- 0:00:44
167500 -- (-225.748) (-228.776) (-229.383) [-226.414] * (-226.428) (-230.165) [-228.245] (-229.265) -- 0:00:44
168000 -- (-226.592) (-226.471) (-228.361) [-228.340] * (-233.768) (-226.727) [-227.607] (-228.221) -- 0:00:49
168500 -- (-229.659) [-226.494] (-225.709) (-230.107) * (-226.992) (-227.614) [-227.468] (-228.428) -- 0:00:49
169000 -- (-229.359) (-226.810) (-229.037) [-226.270] * (-229.541) (-228.286) (-228.435) [-225.804] -- 0:00:49
169500 -- (-227.012) [-226.452] (-227.523) (-229.418) * (-231.376) (-228.936) (-230.765) [-227.502] -- 0:00:48
170000 -- (-227.403) (-228.672) (-227.777) [-226.386] * (-227.887) (-227.259) (-228.168) [-226.871] -- 0:00:48
Average standard deviation of split frequencies: 0.021806
170500 -- (-228.496) (-232.759) [-227.050] (-227.026) * (-228.712) (-226.237) (-225.596) [-228.551] -- 0:00:48
171000 -- [-232.098] (-227.582) (-225.606) (-229.678) * (-227.748) (-228.024) [-226.509] (-228.761) -- 0:00:48
171500 -- (-226.494) (-227.928) (-227.993) [-228.639] * (-228.189) [-227.531] (-228.580) (-226.910) -- 0:00:48
172000 -- [-229.295] (-231.536) (-226.102) (-235.894) * (-229.589) (-232.210) [-226.797] (-228.347) -- 0:00:48
172500 -- (-230.584) [-229.853] (-229.231) (-230.698) * (-228.394) [-227.108] (-228.267) (-230.763) -- 0:00:47
173000 -- (-233.051) [-227.470] (-230.486) (-226.943) * (-226.824) (-229.061) [-226.970] (-226.965) -- 0:00:47
173500 -- (-226.478) (-230.919) [-227.819] (-227.823) * (-226.162) [-226.351] (-230.492) (-228.889) -- 0:00:47
174000 -- (-225.518) (-227.957) (-228.339) [-226.378] * (-226.921) [-227.627] (-226.097) (-225.899) -- 0:00:47
174500 -- (-226.933) (-225.721) [-230.571] (-228.528) * (-228.732) (-226.368) [-226.658] (-229.191) -- 0:00:47
175000 -- (-227.322) (-227.911) (-230.316) [-229.701] * (-228.090) (-227.021) (-230.153) [-226.611] -- 0:00:47
Average standard deviation of split frequencies: 0.020582
175500 -- (-227.250) [-226.605] (-226.402) (-228.359) * (-230.600) (-232.908) [-229.655] (-228.334) -- 0:00:46
176000 -- (-227.424) (-225.827) [-228.050] (-229.565) * (-226.969) (-232.008) [-226.030] (-229.789) -- 0:00:46
176500 -- (-228.191) (-227.326) [-227.682] (-232.369) * (-226.314) (-227.006) [-226.789] (-228.105) -- 0:00:46
177000 -- (-226.575) (-227.621) (-230.668) [-230.746] * (-228.869) (-226.136) [-226.332] (-226.729) -- 0:00:46
177500 -- (-228.588) [-228.722] (-228.759) (-230.283) * (-228.171) (-227.334) (-228.252) [-226.167] -- 0:00:46
178000 -- (-227.643) (-226.979) (-228.057) [-226.450] * (-227.262) (-227.828) (-227.253) [-228.403] -- 0:00:46
178500 -- (-230.130) (-230.146) (-230.334) [-229.559] * [-227.481] (-227.050) (-227.187) (-226.705) -- 0:00:46
179000 -- [-229.038] (-231.309) (-228.215) (-227.679) * (-228.347) (-226.364) [-228.670] (-230.341) -- 0:00:45
179500 -- (-231.769) (-228.072) [-227.983] (-229.838) * (-226.020) (-226.772) (-227.318) [-227.534] -- 0:00:45
180000 -- (-227.398) (-227.271) [-226.997] (-228.974) * (-226.276) (-228.434) (-226.902) [-226.990] -- 0:00:45
Average standard deviation of split frequencies: 0.019913
180500 -- (-226.580) [-226.113] (-228.044) (-231.084) * [-226.203] (-226.232) (-227.892) (-227.429) -- 0:00:45
181000 -- (-226.616) [-227.546] (-227.159) (-230.776) * [-228.320] (-230.797) (-227.624) (-225.934) -- 0:00:45
181500 -- [-228.581] (-228.092) (-228.712) (-226.295) * (-226.380) (-230.232) (-227.172) [-227.959] -- 0:00:45
182000 -- (-228.838) [-226.378] (-230.254) (-226.611) * [-227.219] (-231.002) (-227.145) (-232.801) -- 0:00:44
182500 -- [-226.760] (-226.328) (-227.053) (-226.386) * [-226.646] (-228.110) (-228.190) (-231.144) -- 0:00:44
183000 -- (-228.275) [-229.070] (-225.882) (-227.159) * [-227.328] (-227.030) (-230.418) (-229.031) -- 0:00:44
183500 -- (-230.644) (-228.819) [-227.038] (-228.957) * (-228.229) [-229.085] (-231.517) (-227.034) -- 0:00:48
184000 -- (-225.934) [-226.866] (-227.668) (-229.471) * (-230.525) [-228.061] (-231.826) (-229.817) -- 0:00:48
184500 -- (-229.789) (-226.502) [-227.815] (-231.536) * (-226.582) [-228.279] (-228.153) (-231.624) -- 0:00:48
185000 -- (-228.100) (-229.895) (-226.180) [-227.237] * [-225.635] (-228.903) (-231.513) (-233.604) -- 0:00:48
Average standard deviation of split frequencies: 0.018541
185500 -- (-228.654) (-230.016) (-229.232) [-229.059] * (-229.293) (-226.847) [-230.297] (-226.486) -- 0:00:48
186000 -- (-225.940) [-225.582] (-229.236) (-226.287) * [-228.932] (-229.074) (-230.224) (-227.763) -- 0:00:48
186500 -- (-227.575) [-226.782] (-229.359) (-227.256) * (-227.696) (-226.422) [-228.770] (-228.147) -- 0:00:47
187000 -- (-226.656) [-227.920] (-227.527) (-228.782) * (-231.434) [-230.910] (-227.772) (-228.492) -- 0:00:47
187500 -- [-227.278] (-227.652) (-226.425) (-227.480) * (-228.300) [-226.714] (-227.126) (-227.740) -- 0:00:47
188000 -- [-229.125] (-226.645) (-228.754) (-228.213) * (-229.739) (-230.678) [-228.725] (-228.414) -- 0:00:47
188500 -- (-227.754) (-226.042) [-227.977] (-225.605) * (-228.322) (-230.326) [-226.714] (-231.937) -- 0:00:47
189000 -- [-229.468] (-228.196) (-229.767) (-229.428) * [-227.174] (-227.434) (-228.707) (-225.995) -- 0:00:47
189500 -- (-227.776) (-226.845) (-227.100) [-227.375] * (-227.114) [-227.931] (-229.557) (-228.033) -- 0:00:47
190000 -- [-228.662] (-227.357) (-229.747) (-230.250) * (-227.735) (-230.024) (-228.027) [-228.262] -- 0:00:46
Average standard deviation of split frequencies: 0.015521
190500 -- (-227.482) (-227.222) (-226.593) [-230.402] * [-233.206] (-228.307) (-229.674) (-227.340) -- 0:00:46
191000 -- (-233.946) (-225.719) [-227.002] (-227.421) * (-226.181) (-227.064) [-230.265] (-229.206) -- 0:00:46
191500 -- (-228.414) (-228.709) (-228.847) [-227.624] * (-228.288) (-226.501) [-226.098] (-230.286) -- 0:00:46
192000 -- [-228.321] (-227.030) (-233.408) (-228.608) * [-225.713] (-227.346) (-228.601) (-232.136) -- 0:00:46
192500 -- (-229.470) [-228.265] (-225.673) (-230.194) * (-226.136) [-226.710] (-226.776) (-229.811) -- 0:00:46
193000 -- (-229.850) [-227.827] (-227.016) (-227.186) * (-227.337) [-226.233] (-226.303) (-226.311) -- 0:00:45
193500 -- (-229.233) (-234.980) [-229.810] (-227.179) * (-230.081) (-226.781) (-227.279) [-230.258] -- 0:00:45
194000 -- [-230.244] (-226.952) (-226.505) (-229.766) * (-229.788) (-226.627) (-228.403) [-229.925] -- 0:00:45
194500 -- (-227.568) (-226.998) [-226.522] (-233.455) * (-230.217) (-226.459) [-231.149] (-229.685) -- 0:00:45
195000 -- [-227.617] (-227.636) (-227.562) (-225.642) * (-230.706) (-225.727) (-226.353) [-225.988] -- 0:00:45
Average standard deviation of split frequencies: 0.015366
195500 -- (-227.854) [-227.716] (-227.100) (-225.573) * (-226.313) [-228.004] (-225.859) (-226.184) -- 0:00:45
196000 -- (-227.048) (-230.639) [-227.791] (-226.729) * [-226.764] (-229.220) (-227.370) (-226.089) -- 0:00:45
196500 -- [-229.194] (-226.348) (-236.094) (-227.088) * (-226.601) (-226.155) (-228.101) [-227.649] -- 0:00:44
197000 -- (-229.153) [-225.946] (-227.150) (-229.095) * [-228.744] (-226.868) (-227.194) (-227.380) -- 0:00:44
197500 -- (-226.061) [-228.824] (-230.676) (-228.598) * [-226.221] (-228.167) (-226.481) (-228.844) -- 0:00:44
198000 -- (-226.304) (-227.041) (-229.216) [-226.859] * (-227.795) (-230.548) [-226.893] (-228.382) -- 0:00:44
198500 -- (-230.814) (-226.837) [-227.642] (-226.526) * [-226.811] (-229.007) (-227.691) (-229.567) -- 0:00:44
199000 -- (-227.227) (-228.380) (-228.707) [-226.296] * (-226.588) (-226.283) (-228.813) [-228.723] -- 0:00:44
199500 -- (-225.878) [-226.722] (-226.050) (-228.472) * (-228.186) (-227.676) [-228.676] (-227.147) -- 0:00:48
200000 -- [-229.726] (-226.000) (-227.547) (-227.273) * [-226.417] (-231.703) (-226.701) (-228.868) -- 0:00:48
Average standard deviation of split frequencies: 0.013834
200500 -- [-229.413] (-226.531) (-227.378) (-226.937) * [-231.291] (-229.397) (-226.461) (-226.950) -- 0:00:47
201000 -- (-228.846) (-226.491) [-229.188] (-233.576) * (-230.322) (-228.710) [-226.591] (-230.005) -- 0:00:47
201500 -- [-228.875] (-228.569) (-226.076) (-226.114) * (-227.583) (-226.789) [-227.335] (-230.034) -- 0:00:47
202000 -- (-228.361) (-227.655) [-226.079] (-228.742) * [-230.280] (-226.872) (-227.267) (-226.313) -- 0:00:47
202500 -- [-226.736] (-230.602) (-227.602) (-226.107) * (-228.589) (-228.380) [-225.852] (-226.393) -- 0:00:47
203000 -- (-228.389) (-230.388) [-227.364] (-227.121) * (-227.184) (-227.001) (-226.854) [-227.730] -- 0:00:47
203500 -- [-227.095] (-234.500) (-227.765) (-226.839) * (-226.660) (-231.297) (-226.501) [-228.919] -- 0:00:46
204000 -- (-227.821) (-232.987) (-227.734) [-225.645] * (-226.842) (-226.106) [-227.708] (-226.593) -- 0:00:46
204500 -- (-227.791) [-233.091] (-231.876) (-227.721) * [-227.394] (-232.029) (-227.342) (-226.963) -- 0:00:46
205000 -- (-227.797) (-229.669) (-229.881) [-227.361] * (-228.168) [-227.990] (-226.254) (-228.047) -- 0:00:46
Average standard deviation of split frequencies: 0.013476
205500 -- (-230.335) [-227.730] (-231.592) (-226.797) * (-226.774) [-226.829] (-226.698) (-226.125) -- 0:00:46
206000 -- (-228.458) [-229.751] (-233.486) (-228.585) * (-226.576) (-229.007) (-226.428) [-227.006] -- 0:00:46
206500 -- (-228.054) [-227.330] (-227.083) (-226.350) * (-229.421) (-228.333) [-226.893] (-226.390) -- 0:00:46
207000 -- (-233.272) [-228.666] (-229.084) (-229.594) * (-228.131) (-229.891) [-226.263] (-227.176) -- 0:00:45
207500 -- (-227.179) (-227.367) [-229.715] (-227.453) * (-227.453) (-228.444) (-228.013) [-226.940] -- 0:00:45
208000 -- [-227.725] (-226.449) (-226.081) (-228.649) * (-229.940) [-227.712] (-229.474) (-226.323) -- 0:00:45
208500 -- (-226.583) [-227.214] (-226.024) (-231.395) * (-227.835) (-227.342) [-227.879] (-226.377) -- 0:00:45
209000 -- (-227.863) [-229.073] (-228.065) (-227.236) * [-226.274] (-226.291) (-228.378) (-229.226) -- 0:00:45
209500 -- (-229.781) (-231.312) (-232.356) [-228.007] * (-225.865) [-226.908] (-229.341) (-228.764) -- 0:00:45
210000 -- [-227.342] (-231.092) (-226.496) (-227.609) * (-227.943) [-227.748] (-227.721) (-231.563) -- 0:00:45
Average standard deviation of split frequencies: 0.011561
210500 -- (-231.015) (-227.357) (-229.466) [-229.966] * (-231.955) [-229.502] (-229.040) (-227.092) -- 0:00:45
211000 -- (-228.477) (-229.285) [-227.721] (-227.639) * (-229.541) [-227.882] (-231.582) (-229.176) -- 0:00:44
211500 -- (-230.546) (-232.333) (-227.545) [-226.626] * (-230.549) (-227.621) [-228.919] (-226.759) -- 0:00:44
212000 -- (-232.042) (-227.259) (-228.691) [-226.695] * (-231.254) (-227.397) (-228.234) [-227.182] -- 0:00:44
212500 -- (-232.180) (-228.913) [-227.741] (-227.978) * [-228.621] (-227.481) (-226.741) (-228.749) -- 0:00:44
213000 -- (-234.892) [-228.804] (-226.662) (-227.656) * [-226.371] (-228.779) (-226.240) (-227.680) -- 0:00:44
213500 -- [-228.644] (-226.442) (-227.507) (-228.721) * (-227.206) (-228.848) [-226.050] (-229.138) -- 0:00:44
214000 -- [-226.305] (-228.249) (-227.049) (-226.567) * (-227.722) (-227.082) [-228.326] (-228.711) -- 0:00:44
214500 -- (-230.134) [-230.268] (-228.422) (-227.642) * (-233.865) (-231.830) [-226.637] (-231.284) -- 0:00:43
215000 -- (-226.654) [-232.514] (-227.293) (-227.369) * (-227.352) (-229.534) [-226.784] (-229.222) -- 0:00:47
Average standard deviation of split frequencies: 0.009821
215500 -- [-227.476] (-229.069) (-226.268) (-227.453) * (-226.868) (-230.480) (-227.851) [-226.991] -- 0:00:47
216000 -- (-229.395) (-228.448) (-226.684) [-227.010] * (-234.116) (-226.359) [-227.831] (-232.206) -- 0:00:47
216500 -- [-232.416] (-230.739) (-228.122) (-229.616) * (-235.976) (-225.882) (-226.350) [-226.879] -- 0:00:47
217000 -- (-232.661) (-227.527) [-227.849] (-226.112) * (-226.272) (-228.606) (-228.150) [-226.305] -- 0:00:46
217500 -- (-227.671) (-226.847) [-227.205] (-226.290) * (-226.479) (-226.599) [-230.125] (-227.343) -- 0:00:46
218000 -- (-225.913) (-227.256) [-227.759] (-227.617) * (-226.344) [-232.006] (-228.467) (-228.708) -- 0:00:46
218500 -- [-229.072] (-228.727) (-227.476) (-228.839) * (-227.321) (-226.660) [-229.297] (-230.644) -- 0:00:46
219000 -- (-227.322) (-227.647) (-228.405) [-229.594] * [-227.109] (-225.638) (-228.034) (-229.971) -- 0:00:46
219500 -- (-228.698) [-230.297] (-227.489) (-229.934) * (-228.108) (-225.555) [-227.670] (-233.632) -- 0:00:46
220000 -- [-228.200] (-228.189) (-228.114) (-230.308) * [-226.879] (-226.484) (-228.536) (-227.836) -- 0:00:46
Average standard deviation of split frequencies: 0.010948
220500 -- (-227.213) (-229.088) (-227.102) [-226.396] * [-227.830] (-227.422) (-227.954) (-232.044) -- 0:00:45
221000 -- (-228.203) (-227.644) [-229.042] (-230.314) * (-226.171) [-228.363] (-230.838) (-229.890) -- 0:00:45
221500 -- (-231.157) (-226.730) (-227.868) [-231.354] * (-226.421) (-230.486) [-227.521] (-226.045) -- 0:00:45
222000 -- (-228.972) [-228.272] (-226.302) (-226.756) * (-226.321) [-225.705] (-230.873) (-226.831) -- 0:00:45
222500 -- (-228.198) [-229.212] (-228.117) (-227.217) * (-226.290) [-229.613] (-230.943) (-226.127) -- 0:00:45
223000 -- (-227.742) (-232.059) (-227.352) [-226.409] * [-232.035] (-227.917) (-229.488) (-230.512) -- 0:00:45
223500 -- (-227.298) (-228.218) [-227.357] (-233.359) * (-229.129) (-226.847) [-230.062] (-226.411) -- 0:00:45
224000 -- (-230.737) (-229.581) (-227.435) [-230.598] * [-226.572] (-227.347) (-229.053) (-229.278) -- 0:00:45
224500 -- (-226.770) (-226.397) [-226.011] (-229.184) * (-227.210) (-227.012) (-227.125) [-230.603] -- 0:00:44
225000 -- (-228.239) [-227.883] (-226.585) (-228.447) * (-229.654) (-226.908) [-227.862] (-231.566) -- 0:00:44
Average standard deviation of split frequencies: 0.010299
225500 -- (-232.199) (-230.758) [-228.949] (-231.117) * [-228.408] (-225.982) (-227.003) (-229.658) -- 0:00:44
226000 -- [-230.478] (-228.601) (-232.170) (-230.151) * (-227.893) (-227.320) (-228.375) [-228.119] -- 0:00:44
226500 -- (-229.296) (-227.208) [-228.140] (-229.870) * [-227.416] (-227.950) (-228.452) (-226.736) -- 0:00:44
227000 -- (-228.339) [-230.998] (-229.436) (-228.405) * (-231.042) [-229.609] (-227.198) (-226.436) -- 0:00:44
227500 -- (-226.736) (-228.465) (-227.108) [-226.857] * (-229.101) (-232.199) (-226.448) [-226.677] -- 0:00:44
228000 -- (-229.058) (-228.530) [-229.188] (-226.106) * (-226.916) [-228.728] (-227.194) (-230.430) -- 0:00:44
228500 -- (-229.743) (-225.945) [-227.056] (-228.436) * (-227.036) (-228.279) [-227.596] (-232.888) -- 0:00:43
229000 -- (-228.669) [-226.484] (-231.019) (-226.789) * (-228.964) [-226.061] (-226.653) (-226.948) -- 0:00:43
229500 -- (-228.457) (-232.511) (-227.206) [-227.339] * (-228.934) (-226.799) [-227.137] (-230.272) -- 0:00:43
230000 -- (-230.462) (-230.169) (-230.327) [-228.355] * (-229.148) (-226.533) [-225.902] (-229.146) -- 0:00:46
Average standard deviation of split frequencies: 0.010091
230500 -- [-228.002] (-228.499) (-228.445) (-229.891) * (-229.758) [-226.307] (-227.552) (-227.565) -- 0:00:46
231000 -- (-228.809) (-227.264) (-229.024) [-228.484] * (-228.209) (-230.059) [-226.681] (-227.233) -- 0:00:46
231500 -- (-226.941) [-226.152] (-227.222) (-228.006) * (-228.440) [-229.965] (-228.212) (-229.706) -- 0:00:46
232000 -- [-226.311] (-231.330) (-226.279) (-228.680) * (-227.204) (-226.335) (-228.724) [-226.900] -- 0:00:46
232500 -- (-227.834) (-228.136) (-232.023) [-227.681] * (-230.470) [-229.665] (-231.162) (-226.758) -- 0:00:46
233000 -- (-227.890) [-227.906] (-230.883) (-228.730) * [-226.045] (-229.490) (-235.548) (-228.382) -- 0:00:46
233500 -- [-229.637] (-227.042) (-226.617) (-229.549) * (-229.659) (-225.700) [-232.311] (-227.564) -- 0:00:45
234000 -- (-226.333) (-228.411) [-228.280] (-226.684) * (-228.329) (-229.286) (-233.787) [-229.433] -- 0:00:45
234500 -- [-226.835] (-227.290) (-228.463) (-228.258) * [-228.277] (-227.104) (-227.574) (-230.534) -- 0:00:45
235000 -- [-226.137] (-226.809) (-226.871) (-226.722) * (-227.712) [-226.957] (-227.004) (-228.443) -- 0:00:45
Average standard deviation of split frequencies: 0.010612
235500 -- (-227.135) (-226.470) (-227.140) [-228.230] * (-228.953) [-229.187] (-227.682) (-227.265) -- 0:00:45
236000 -- (-230.073) (-231.871) (-225.817) [-227.576] * [-228.303] (-229.427) (-230.462) (-228.303) -- 0:00:45
236500 -- [-230.804] (-230.841) (-227.273) (-227.788) * (-227.377) (-227.714) (-234.743) [-227.893] -- 0:00:45
237000 -- (-233.068) [-231.041] (-228.222) (-227.430) * (-226.899) (-226.317) [-226.410] (-228.471) -- 0:00:45
237500 -- (-226.941) [-228.616] (-228.153) (-226.768) * (-226.628) (-226.134) (-229.861) [-226.275] -- 0:00:44
238000 -- [-226.733] (-229.986) (-231.426) (-228.913) * [-228.005] (-226.566) (-228.666) (-228.950) -- 0:00:44
238500 -- (-226.588) (-226.316) [-225.770] (-234.981) * (-226.085) [-226.657] (-226.290) (-225.995) -- 0:00:44
239000 -- (-226.401) (-226.990) [-226.981] (-232.219) * (-226.754) [-226.040] (-227.751) (-230.647) -- 0:00:44
239500 -- [-227.120] (-227.241) (-225.973) (-231.209) * (-225.937) (-227.418) [-226.159] (-233.245) -- 0:00:44
240000 -- (-226.390) (-226.275) (-228.095) [-230.458] * (-225.976) [-228.802] (-225.942) (-228.323) -- 0:00:44
Average standard deviation of split frequencies: 0.009916
240500 -- (-229.309) [-227.721] (-226.484) (-228.165) * (-227.018) (-227.713) (-227.760) [-230.272] -- 0:00:44
241000 -- (-228.247) (-230.671) (-229.557) [-226.934] * (-226.574) (-230.109) (-228.691) [-225.688] -- 0:00:44
241500 -- [-230.894] (-227.907) (-226.569) (-225.867) * [-227.016] (-230.806) (-226.559) (-227.155) -- 0:00:43
242000 -- (-227.104) (-230.076) [-226.920] (-229.531) * (-230.895) (-229.596) (-227.839) [-226.171] -- 0:00:43
242500 -- [-225.962] (-226.818) (-226.517) (-229.158) * [-225.859] (-227.237) (-228.355) (-228.877) -- 0:00:43
243000 -- [-225.783] (-229.818) (-226.771) (-226.296) * (-227.274) [-226.914] (-227.221) (-227.324) -- 0:00:43
243500 -- (-227.960) (-228.307) (-230.289) [-228.154] * [-227.726] (-227.865) (-228.069) (-227.531) -- 0:00:43
244000 -- (-227.968) (-228.116) (-227.938) [-227.605] * [-226.882] (-228.070) (-226.134) (-227.984) -- 0:00:43
244500 -- (-227.138) (-231.913) (-229.012) [-229.611] * (-227.910) (-226.429) (-227.454) [-226.019] -- 0:00:46
245000 -- [-227.861] (-234.720) (-228.367) (-227.912) * (-226.994) (-227.739) (-228.859) [-227.757] -- 0:00:46
Average standard deviation of split frequencies: 0.011047
245500 -- (-226.857) (-229.720) (-227.061) [-227.429] * (-227.843) (-228.169) [-229.400] (-227.725) -- 0:00:46
246000 -- (-225.690) (-230.046) (-227.259) [-230.873] * [-229.302] (-227.155) (-227.277) (-231.092) -- 0:00:45
246500 -- [-226.260] (-228.767) (-227.972) (-228.473) * [-227.060] (-229.450) (-226.410) (-227.115) -- 0:00:45
247000 -- (-225.577) (-227.141) [-226.560] (-227.242) * (-226.381) (-229.012) (-226.759) [-227.777] -- 0:00:45
247500 -- [-226.655] (-227.454) (-229.509) (-226.911) * (-226.303) (-226.675) (-226.422) [-228.583] -- 0:00:45
248000 -- (-229.323) [-227.024] (-230.985) (-226.732) * (-226.617) (-229.738) (-229.230) [-229.756] -- 0:00:45
248500 -- (-230.355) [-228.789] (-228.954) (-226.750) * (-226.133) (-229.754) [-226.077] (-229.118) -- 0:00:45
249000 -- (-228.850) (-229.341) (-227.262) [-226.253] * [-226.791] (-227.745) (-226.743) (-228.095) -- 0:00:45
249500 -- [-228.379] (-226.681) (-229.214) (-227.374) * (-228.670) (-229.979) [-227.744] (-230.112) -- 0:00:45
250000 -- [-225.735] (-232.141) (-228.704) (-228.961) * (-227.374) (-228.824) [-226.485] (-232.879) -- 0:00:45
Average standard deviation of split frequencies: 0.010952
250500 -- (-226.869) [-226.773] (-231.955) (-226.815) * [-228.258] (-226.182) (-226.643) (-226.082) -- 0:00:44
251000 -- (-226.591) (-229.840) [-232.659] (-229.206) * (-227.679) (-227.667) [-227.695] (-229.363) -- 0:00:44
251500 -- [-226.609] (-229.490) (-229.098) (-228.269) * (-228.272) (-233.396) (-226.867) [-227.065] -- 0:00:44
252000 -- (-227.900) (-232.630) (-228.536) [-226.685] * (-229.057) [-227.744] (-226.124) (-228.675) -- 0:00:44
252500 -- (-226.562) [-230.889] (-229.962) (-229.439) * (-228.777) [-231.298] (-226.999) (-228.364) -- 0:00:44
253000 -- (-226.521) [-226.171] (-226.095) (-228.300) * (-232.147) (-233.452) (-231.696) [-227.124] -- 0:00:44
253500 -- (-226.216) (-227.349) [-226.566] (-228.776) * (-226.303) [-227.907] (-229.202) (-226.400) -- 0:00:44
254000 -- [-226.806] (-227.976) (-227.620) (-225.562) * (-228.386) (-227.089) (-229.682) [-229.374] -- 0:00:44
254500 -- [-225.546] (-229.058) (-226.802) (-226.735) * (-227.495) (-228.711) (-227.571) [-232.316] -- 0:00:43
255000 -- (-228.411) (-227.318) (-227.973) [-226.726] * (-226.943) (-228.912) [-226.783] (-229.889) -- 0:00:43
Average standard deviation of split frequencies: 0.010724
255500 -- (-228.574) [-226.300] (-227.356) (-229.405) * (-230.359) [-227.067] (-226.905) (-231.072) -- 0:00:43
256000 -- (-225.891) [-230.059] (-227.341) (-232.333) * (-225.516) (-226.487) (-226.892) [-226.601] -- 0:00:43
256500 -- [-226.813] (-227.311) (-226.821) (-229.748) * (-227.355) (-226.991) (-229.939) [-227.051] -- 0:00:43
257000 -- (-228.289) [-231.339] (-227.405) (-227.484) * (-225.761) (-227.095) (-229.138) [-226.533] -- 0:00:43
257500 -- (-232.432) (-229.962) (-228.772) [-226.848] * (-226.222) (-228.029) (-226.711) [-229.074] -- 0:00:43
258000 -- (-230.696) (-230.115) [-227.069] (-228.843) * (-227.421) (-229.099) [-228.161] (-226.714) -- 0:00:43
258500 -- (-226.784) (-227.830) (-230.366) [-227.051] * (-227.867) (-228.465) [-228.868] (-228.865) -- 0:00:45
259000 -- (-227.958) [-227.989] (-228.642) (-227.269) * (-228.305) [-231.771] (-231.421) (-228.015) -- 0:00:45
259500 -- (-226.603) (-225.927) (-231.186) [-228.182] * (-226.845) (-231.902) [-230.645] (-229.151) -- 0:00:45
260000 -- (-227.488) [-225.878] (-226.690) (-229.251) * (-229.202) (-230.884) (-228.748) [-227.324] -- 0:00:45
Average standard deviation of split frequencies: 0.010638
260500 -- (-226.528) (-226.386) (-225.994) [-229.540] * (-228.550) (-228.641) (-228.127) [-230.765] -- 0:00:45
261000 -- (-226.349) [-227.122] (-227.462) (-229.728) * (-227.937) (-227.942) [-228.372] (-229.657) -- 0:00:45
261500 -- (-226.308) (-226.949) [-227.370] (-227.913) * [-226.661] (-228.324) (-231.235) (-231.505) -- 0:00:45
262000 -- (-227.511) (-230.101) (-227.810) [-227.017] * (-227.322) [-230.390] (-228.382) (-228.242) -- 0:00:45
262500 -- (-229.486) (-228.459) [-230.272] (-231.777) * (-229.852) (-230.704) [-229.105] (-226.942) -- 0:00:44
263000 -- (-227.688) (-227.055) [-227.891] (-228.776) * (-228.367) (-229.620) [-230.111] (-228.315) -- 0:00:44
263500 -- (-227.924) [-227.249] (-227.625) (-227.502) * (-228.991) (-227.347) (-231.952) [-226.790] -- 0:00:44
264000 -- (-227.407) (-227.211) (-226.430) [-227.090] * (-227.298) (-228.679) (-231.989) [-230.358] -- 0:00:44
264500 -- (-227.392) [-226.777] (-225.565) (-227.755) * (-226.814) [-226.875] (-229.733) (-225.653) -- 0:00:44
265000 -- (-227.898) (-227.265) [-227.545] (-227.655) * (-226.749) (-228.076) (-229.301) [-226.827] -- 0:00:44
Average standard deviation of split frequencies: 0.008965
265500 -- (-228.049) [-227.968] (-229.388) (-230.222) * (-228.661) [-226.689] (-229.390) (-230.312) -- 0:00:44
266000 -- [-228.179] (-228.161) (-229.314) (-228.056) * [-226.683] (-226.280) (-228.775) (-226.452) -- 0:00:44
266500 -- [-228.789] (-228.424) (-226.760) (-227.917) * [-228.083] (-228.575) (-236.863) (-226.353) -- 0:00:44
267000 -- (-233.791) (-228.569) [-228.665] (-227.870) * [-228.553] (-227.253) (-233.825) (-227.296) -- 0:00:43
267500 -- (-227.181) (-228.700) (-226.684) [-228.976] * (-228.320) [-228.997] (-236.108) (-226.824) -- 0:00:43
268000 -- (-227.096) (-227.282) [-230.555] (-228.590) * (-225.837) (-227.574) [-225.682] (-231.023) -- 0:00:43
268500 -- (-227.201) [-227.149] (-231.127) (-232.241) * (-228.049) (-229.465) [-228.049] (-229.295) -- 0:00:43
269000 -- (-228.339) (-228.100) (-229.675) [-231.212] * [-226.956] (-227.975) (-227.508) (-231.064) -- 0:00:43
269500 -- (-231.213) [-229.025] (-226.188) (-228.651) * (-228.836) [-229.393] (-229.704) (-229.787) -- 0:00:43
270000 -- (-227.970) (-226.502) [-231.193] (-227.459) * (-226.933) [-226.575] (-227.538) (-229.387) -- 0:00:43
Average standard deviation of split frequencies: 0.009733
270500 -- (-226.094) [-226.735] (-230.658) (-228.077) * (-228.409) [-226.218] (-226.599) (-226.834) -- 0:00:43
271000 -- [-226.936] (-227.987) (-229.111) (-227.339) * (-227.883) [-228.155] (-228.115) (-227.899) -- 0:00:43
271500 -- [-227.410] (-225.827) (-228.170) (-230.308) * (-228.137) (-227.413) (-228.279) [-227.058] -- 0:00:42
272000 -- (-232.707) (-230.897) [-227.693] (-228.810) * (-227.635) (-226.773) (-227.076) [-228.919] -- 0:00:42
272500 -- [-232.487] (-227.330) (-226.581) (-228.026) * [-228.108] (-228.705) (-226.478) (-233.521) -- 0:00:42
273000 -- (-228.463) (-227.625) [-228.748] (-225.856) * [-228.019] (-229.290) (-227.351) (-226.733) -- 0:00:42
273500 -- (-225.912) (-233.621) [-226.751] (-227.131) * (-227.252) (-234.246) (-230.440) [-227.498] -- 0:00:45
274000 -- (-227.197) (-228.463) (-233.482) [-227.477] * (-229.794) (-227.319) (-229.314) [-227.556] -- 0:00:45
274500 -- [-226.297] (-227.735) (-229.599) (-227.000) * (-231.926) [-227.350] (-226.840) (-228.407) -- 0:00:44
275000 -- (-230.317) [-229.108] (-225.521) (-225.940) * (-228.670) (-229.832) (-226.710) [-226.470] -- 0:00:44
Average standard deviation of split frequencies: 0.010248
275500 -- [-229.269] (-226.728) (-227.694) (-228.766) * (-226.480) [-231.084] (-228.999) (-228.989) -- 0:00:44
276000 -- (-229.487) (-228.863) (-228.717) [-226.550] * (-226.618) (-228.725) [-226.984] (-227.262) -- 0:00:44
276500 -- [-226.179] (-231.240) (-230.838) (-227.275) * [-226.645] (-226.369) (-227.663) (-227.724) -- 0:00:44
277000 -- (-229.358) (-225.707) (-230.590) [-229.118] * (-232.399) (-229.372) (-227.398) [-230.640] -- 0:00:44
277500 -- (-231.199) (-230.180) (-230.627) [-226.688] * (-227.291) (-226.703) [-228.625] (-228.839) -- 0:00:44
278000 -- (-230.822) (-228.763) (-226.603) [-228.757] * (-226.022) (-227.835) (-226.736) [-227.231] -- 0:00:44
278500 -- (-229.327) (-231.247) (-227.118) [-226.928] * (-228.106) (-228.034) [-227.249] (-226.666) -- 0:00:44
279000 -- (-229.911) (-229.849) (-227.002) [-227.037] * (-226.716) (-229.942) (-227.160) [-229.854] -- 0:00:43
279500 -- (-229.378) [-227.673] (-227.394) (-225.825) * [-226.038] (-227.766) (-233.446) (-227.860) -- 0:00:43
280000 -- (-226.308) [-226.609] (-225.884) (-229.659) * (-228.185) [-229.934] (-228.078) (-227.055) -- 0:00:43
Average standard deviation of split frequencies: 0.009287
280500 -- (-228.596) [-227.670] (-227.428) (-226.336) * (-228.751) (-226.750) (-228.820) [-229.615] -- 0:00:43
281000 -- (-235.678) (-226.949) [-230.045] (-226.501) * (-226.282) (-226.181) (-226.937) [-226.306] -- 0:00:43
281500 -- (-228.551) (-226.450) (-226.712) [-227.031] * (-226.785) [-228.242] (-227.850) (-228.771) -- 0:00:43
282000 -- (-228.909) (-227.821) [-229.091] (-227.929) * (-226.779) [-226.949] (-226.491) (-227.705) -- 0:00:43
282500 -- (-225.865) [-227.450] (-226.160) (-230.326) * (-227.374) (-227.296) (-228.543) [-228.273] -- 0:00:43
283000 -- [-233.131] (-226.365) (-229.361) (-233.005) * [-229.533] (-228.487) (-227.300) (-225.610) -- 0:00:43
283500 -- (-227.489) [-227.893] (-227.203) (-227.836) * (-227.503) [-227.153] (-228.945) (-227.460) -- 0:00:42
284000 -- (-226.929) (-229.450) [-227.134] (-226.851) * (-228.465) (-226.154) [-229.442] (-226.166) -- 0:00:42
284500 -- (-228.187) (-226.892) (-226.876) [-226.856] * (-228.260) (-226.301) (-226.108) [-228.400] -- 0:00:42
285000 -- [-227.479] (-227.125) (-225.641) (-228.670) * [-227.562] (-226.476) (-227.139) (-227.321) -- 0:00:42
Average standard deviation of split frequencies: 0.009696
285500 -- (-229.150) (-229.734) [-226.235] (-227.824) * (-227.781) (-227.532) [-227.364] (-226.870) -- 0:00:42
286000 -- [-226.898] (-228.782) (-231.165) (-229.634) * [-229.420] (-225.972) (-226.256) (-226.606) -- 0:00:42
286500 -- (-227.541) (-227.798) (-228.831) [-226.935] * (-228.679) [-227.075] (-228.949) (-230.834) -- 0:00:42
287000 -- (-229.366) (-227.947) [-226.802] (-228.830) * (-228.487) [-226.600] (-230.029) (-230.863) -- 0:00:42
287500 -- [-230.344] (-227.339) (-226.175) (-226.313) * (-226.762) [-231.939] (-229.229) (-230.502) -- 0:00:42
288000 -- (-233.027) [-229.256] (-229.882) (-225.840) * (-228.998) [-227.234] (-226.740) (-229.029) -- 0:00:44
288500 -- [-229.647] (-228.545) (-228.596) (-227.845) * (-229.173) (-226.250) [-227.483] (-226.617) -- 0:00:44
289000 -- (-227.701) (-230.369) [-231.009] (-226.212) * (-228.172) [-227.539] (-229.380) (-228.323) -- 0:00:44
289500 -- (-226.916) (-227.053) (-230.641) [-227.076] * (-230.447) (-227.453) [-229.338] (-231.895) -- 0:00:44
290000 -- (-226.814) [-227.312] (-231.319) (-227.505) * [-229.166] (-228.195) (-226.540) (-226.674) -- 0:00:44
Average standard deviation of split frequencies: 0.009540
290500 -- (-226.674) (-227.237) (-228.079) [-228.577] * (-228.857) (-230.349) [-228.139] (-228.379) -- 0:00:43
291000 -- (-228.328) (-228.238) [-230.935] (-229.277) * (-226.853) [-228.947] (-227.559) (-225.893) -- 0:00:43
291500 -- (-234.955) (-227.884) [-226.107] (-228.506) * [-226.838] (-229.723) (-225.957) (-227.322) -- 0:00:43
292000 -- (-227.584) [-225.910] (-226.428) (-232.668) * (-231.693) (-226.500) [-228.548] (-229.301) -- 0:00:43
292500 -- (-228.906) (-227.827) (-226.693) [-231.441] * (-230.949) (-226.676) [-227.042] (-226.494) -- 0:00:43
293000 -- (-225.515) (-231.530) [-226.984] (-230.581) * (-226.289) (-228.440) (-227.269) [-226.292] -- 0:00:43
293500 -- (-231.139) [-230.389] (-229.145) (-229.009) * (-230.611) [-230.432] (-227.955) (-225.893) -- 0:00:43
294000 -- (-229.210) [-228.102] (-231.021) (-227.194) * (-231.400) (-229.243) [-227.509] (-228.070) -- 0:00:43
294500 -- (-228.825) (-228.707) [-229.419] (-226.685) * (-230.516) (-228.521) [-227.479] (-226.247) -- 0:00:43
295000 -- (-226.118) (-230.548) (-231.268) [-227.476] * (-226.279) (-226.481) (-227.165) [-226.006] -- 0:00:43
Average standard deviation of split frequencies: 0.009555
295500 -- (-228.223) [-232.425] (-226.763) (-226.992) * [-226.647] (-229.330) (-231.269) (-226.366) -- 0:00:42
296000 -- (-228.327) [-229.364] (-226.745) (-227.042) * (-228.375) (-226.342) (-229.348) [-229.913] -- 0:00:42
296500 -- (-230.474) (-230.940) (-226.532) [-226.733] * (-229.071) (-228.297) [-226.681] (-228.205) -- 0:00:42
297000 -- (-228.838) [-227.368] (-227.401) (-230.666) * (-226.388) (-228.110) [-228.996] (-227.865) -- 0:00:42
297500 -- (-227.648) (-226.798) [-228.070] (-228.464) * [-225.763] (-228.436) (-227.401) (-226.850) -- 0:00:42
298000 -- (-228.486) (-227.096) (-228.422) [-226.232] * (-228.795) [-228.523] (-228.659) (-228.287) -- 0:00:42
298500 -- [-226.522] (-234.618) (-229.499) (-227.551) * (-229.866) (-227.534) [-226.795] (-228.568) -- 0:00:42
299000 -- [-227.966] (-230.149) (-230.653) (-226.305) * (-229.125) (-230.102) [-227.306] (-228.120) -- 0:00:42
299500 -- (-231.644) (-227.996) (-235.527) [-225.813] * (-229.720) [-228.190] (-227.812) (-228.064) -- 0:00:42
300000 -- (-231.184) [-227.820] (-235.324) (-228.025) * (-228.972) (-226.989) [-227.952] (-230.665) -- 0:00:42
Average standard deviation of split frequencies: 0.009499
300500 -- [-230.271] (-229.515) (-229.071) (-226.760) * (-227.315) (-226.167) (-228.850) [-227.059] -- 0:00:41
301000 -- (-228.346) [-227.725] (-228.824) (-225.868) * [-228.312] (-228.982) (-231.491) (-228.327) -- 0:00:41
301500 -- (-228.443) (-226.337) [-227.103] (-226.457) * [-228.193] (-226.238) (-228.094) (-231.661) -- 0:00:41
302000 -- [-227.071] (-227.298) (-229.269) (-227.375) * (-226.807) [-227.477] (-229.050) (-227.021) -- 0:00:41
302500 -- (-228.044) (-229.245) [-226.699] (-226.460) * [-227.069] (-226.879) (-227.613) (-227.548) -- 0:00:41
303000 -- [-226.031] (-228.055) (-229.742) (-230.340) * (-227.102) [-227.844] (-229.112) (-228.697) -- 0:00:41
303500 -- (-227.441) (-228.665) (-227.303) [-228.041] * (-226.869) [-226.852] (-227.508) (-227.964) -- 0:00:41
304000 -- (-226.020) [-227.395] (-226.246) (-226.332) * [-228.731] (-230.785) (-228.256) (-237.195) -- 0:00:43
304500 -- (-227.814) (-232.423) (-227.997) [-227.510] * (-228.272) [-227.646] (-229.008) (-231.074) -- 0:00:43
305000 -- (-228.037) [-229.230] (-227.524) (-226.588) * (-227.193) (-226.198) (-228.015) [-227.457] -- 0:00:43
Average standard deviation of split frequencies: 0.009787
305500 -- (-227.512) (-227.648) (-230.380) [-234.466] * [-227.405] (-225.590) (-227.333) (-229.817) -- 0:00:43
306000 -- (-227.305) (-226.322) [-226.076] (-231.706) * (-226.551) (-231.676) (-227.849) [-231.492] -- 0:00:43
306500 -- (-227.930) [-228.481] (-225.988) (-233.234) * (-226.695) (-228.901) [-228.925] (-228.533) -- 0:00:42
307000 -- (-228.800) [-226.531] (-228.864) (-231.373) * [-228.461] (-230.614) (-227.327) (-231.010) -- 0:00:42
307500 -- [-227.775] (-232.557) (-228.761) (-228.486) * (-227.498) [-227.404] (-227.938) (-226.439) -- 0:00:42
308000 -- (-231.447) (-228.753) [-227.169] (-227.806) * (-228.231) (-226.788) (-227.640) [-227.805] -- 0:00:42
308500 -- (-235.245) (-234.572) [-228.963] (-230.735) * [-228.522] (-226.297) (-227.741) (-226.415) -- 0:00:42
309000 -- [-228.537] (-228.095) (-230.797) (-229.520) * (-228.168) (-227.677) [-227.281] (-226.764) -- 0:00:42
309500 -- (-226.198) (-227.220) (-228.897) [-228.967] * (-226.527) [-230.422] (-230.079) (-228.743) -- 0:00:42
310000 -- (-226.887) (-230.712) [-226.169] (-231.160) * (-229.139) (-227.800) (-229.841) [-229.019] -- 0:00:42
Average standard deviation of split frequencies: 0.010622
310500 -- (-227.293) (-228.137) (-229.989) [-227.820] * (-227.210) [-229.835] (-227.870) (-229.470) -- 0:00:42
311000 -- (-228.787) (-228.570) [-229.200] (-227.954) * (-227.540) (-228.529) [-227.233] (-226.236) -- 0:00:42
311500 -- [-227.667] (-228.733) (-227.656) (-231.113) * [-226.998] (-225.792) (-230.064) (-227.661) -- 0:00:41
312000 -- (-227.506) (-226.339) (-227.033) [-225.658] * (-228.288) [-228.434] (-233.085) (-230.617) -- 0:00:41
312500 -- (-229.314) (-226.969) [-229.065] (-227.031) * [-230.191] (-228.014) (-229.142) (-226.202) -- 0:00:41
313000 -- (-228.034) [-225.617] (-232.153) (-230.322) * (-228.829) (-230.659) [-229.449] (-227.701) -- 0:00:41
313500 -- (-227.989) [-226.868] (-226.632) (-227.609) * [-227.742] (-226.716) (-231.123) (-227.415) -- 0:00:41
314000 -- (-226.860) (-228.596) (-226.110) [-228.409] * (-227.281) [-225.819] (-225.955) (-226.310) -- 0:00:41
314500 -- [-228.405] (-227.133) (-226.348) (-229.267) * (-229.261) (-227.742) (-227.148) [-226.214] -- 0:00:41
315000 -- [-227.467] (-226.990) (-226.986) (-227.335) * [-228.590] (-227.476) (-227.285) (-230.695) -- 0:00:41
Average standard deviation of split frequencies: 0.011408
315500 -- (-228.225) (-226.491) [-226.770] (-228.627) * (-228.504) (-227.831) (-231.876) [-229.195] -- 0:00:41
316000 -- (-227.522) (-226.083) (-233.490) [-229.056] * [-226.564] (-228.694) (-226.596) (-228.659) -- 0:00:41
316500 -- (-228.597) (-226.267) [-231.914] (-229.580) * (-226.872) (-226.797) (-226.918) [-228.841] -- 0:00:41
317000 -- [-228.884] (-227.391) (-228.265) (-228.915) * [-229.133] (-229.989) (-230.558) (-227.257) -- 0:00:40
317500 -- (-227.042) (-229.187) (-226.396) [-227.744] * (-227.421) (-230.149) [-227.731] (-231.966) -- 0:00:40
318000 -- (-229.103) (-227.509) (-228.167) [-231.621] * (-225.614) (-226.859) [-227.467] (-230.283) -- 0:00:42
318500 -- (-227.932) (-229.528) [-229.240] (-227.226) * (-228.495) (-226.910) [-226.649] (-230.452) -- 0:00:42
319000 -- (-229.777) (-228.887) [-226.034] (-226.344) * (-227.490) (-226.496) (-229.538) [-229.074] -- 0:00:42
319500 -- (-233.840) [-226.847] (-226.914) (-226.432) * [-226.967] (-226.521) (-230.549) (-230.625) -- 0:00:42
320000 -- (-230.410) (-230.692) [-227.820] (-226.749) * [-226.320] (-229.141) (-229.842) (-229.937) -- 0:00:42
Average standard deviation of split frequencies: 0.010982
320500 -- (-227.784) (-230.048) (-227.926) [-227.158] * [-227.196] (-228.355) (-228.545) (-226.356) -- 0:00:42
321000 -- (-229.307) (-230.059) (-231.532) [-228.534] * (-226.022) (-228.880) (-239.149) [-227.203] -- 0:00:42
321500 -- (-229.831) (-229.159) (-230.964) [-227.326] * (-229.456) (-228.799) [-227.148] (-228.496) -- 0:00:42
322000 -- (-228.003) (-226.724) (-228.950) [-226.593] * (-229.913) [-233.797] (-226.333) (-225.844) -- 0:00:42
322500 -- [-228.352] (-227.361) (-227.072) (-230.026) * (-227.143) [-226.366] (-226.122) (-227.214) -- 0:00:42
323000 -- (-229.651) [-225.900] (-229.982) (-228.659) * (-227.335) (-226.247) (-226.923) [-231.036] -- 0:00:41
323500 -- [-230.861] (-226.690) (-228.840) (-227.574) * (-226.662) [-226.500] (-228.432) (-226.592) -- 0:00:41
324000 -- (-225.860) (-226.330) (-228.792) [-226.602] * (-228.388) [-228.414] (-226.275) (-228.738) -- 0:00:41
324500 -- [-228.379] (-228.512) (-226.420) (-227.272) * [-227.793] (-232.533) (-228.986) (-227.857) -- 0:00:41
325000 -- (-227.447) (-231.093) [-226.228] (-229.739) * (-229.963) (-228.382) [-225.832] (-226.392) -- 0:00:41
Average standard deviation of split frequencies: 0.011143
325500 -- (-228.073) (-227.123) (-226.662) [-229.519] * (-227.590) (-227.861) [-226.532] (-226.396) -- 0:00:41
326000 -- [-226.771] (-227.011) (-226.461) (-227.611) * (-230.274) (-229.136) (-227.922) [-227.673] -- 0:00:41
326500 -- (-228.512) (-226.172) [-225.871] (-227.256) * (-228.511) (-228.856) [-228.364] (-228.396) -- 0:00:41
327000 -- (-226.362) [-228.016] (-228.827) (-228.015) * [-227.180] (-227.760) (-227.960) (-228.634) -- 0:00:41
327500 -- (-228.740) (-228.361) [-227.079] (-225.948) * (-226.663) (-229.660) [-226.682] (-227.786) -- 0:00:41
328000 -- [-226.722] (-235.309) (-229.587) (-227.073) * (-228.531) [-227.374] (-227.717) (-226.269) -- 0:00:40
328500 -- (-229.604) (-229.307) [-226.374] (-226.367) * (-227.634) (-228.658) [-229.248] (-229.049) -- 0:00:40
329000 -- [-226.912] (-228.108) (-228.154) (-226.468) * [-226.870] (-228.404) (-228.235) (-226.642) -- 0:00:42
329500 -- (-228.902) (-229.015) (-227.217) [-225.911] * [-227.488] (-229.224) (-227.452) (-228.677) -- 0:00:42
330000 -- (-230.816) (-226.711) (-228.410) [-225.587] * (-225.899) (-226.378) [-226.953] (-228.399) -- 0:00:42
Average standard deviation of split frequencies: 0.011908
330500 -- (-227.733) [-231.999] (-226.445) (-230.427) * (-226.658) [-226.181] (-232.446) (-226.592) -- 0:00:42
331000 -- (-226.699) [-225.927] (-228.662) (-230.738) * (-226.915) (-227.351) [-231.618] (-227.213) -- 0:00:42
331500 -- [-228.146] (-227.415) (-229.912) (-226.367) * [-228.344] (-229.082) (-227.084) (-227.983) -- 0:00:42
332000 -- (-229.236) [-229.603] (-230.144) (-228.564) * (-226.186) (-228.709) [-227.697] (-228.433) -- 0:00:42
332500 -- [-227.257] (-229.568) (-227.944) (-229.834) * [-227.097] (-226.729) (-228.424) (-230.794) -- 0:00:42
333000 -- (-228.037) (-230.788) (-226.261) [-227.893] * (-226.139) (-227.923) (-227.661) [-227.489] -- 0:00:42
333500 -- [-229.007] (-229.720) (-226.558) (-228.946) * (-228.737) [-227.939] (-239.179) (-227.050) -- 0:00:41
334000 -- (-226.401) (-227.778) [-229.196] (-225.770) * [-229.128] (-229.245) (-229.918) (-230.843) -- 0:00:41
334500 -- (-228.806) (-228.405) (-229.494) [-232.303] * (-231.828) (-228.827) (-228.088) [-226.648] -- 0:00:41
335000 -- (-228.877) (-227.757) (-226.102) [-229.446] * (-231.752) (-228.068) [-226.608] (-227.241) -- 0:00:41
Average standard deviation of split frequencies: 0.010564
335500 -- (-228.019) [-227.236] (-229.561) (-226.728) * [-226.225] (-229.722) (-227.429) (-226.296) -- 0:00:41
336000 -- (-228.104) (-229.021) (-228.624) [-227.396] * (-226.761) (-228.512) [-228.497] (-226.332) -- 0:00:41
336500 -- (-228.027) [-228.137] (-235.861) (-227.055) * (-227.289) [-228.062] (-226.826) (-227.511) -- 0:00:41
337000 -- (-226.804) [-232.259] (-226.982) (-227.139) * [-227.659] (-228.099) (-226.898) (-229.235) -- 0:00:41
337500 -- (-229.031) (-228.869) [-226.330] (-226.902) * (-231.337) (-234.097) [-226.801] (-230.076) -- 0:00:41
338000 -- [-228.676] (-228.043) (-228.526) (-228.932) * (-226.619) (-226.456) [-227.806] (-226.818) -- 0:00:41
338500 -- (-227.764) [-227.113] (-227.116) (-231.763) * (-227.872) (-226.563) (-228.270) [-226.498] -- 0:00:41
339000 -- [-229.354] (-228.064) (-226.345) (-233.859) * (-227.586) (-229.233) [-230.989] (-229.988) -- 0:00:40
339500 -- [-225.949] (-227.811) (-226.256) (-226.441) * (-231.401) [-226.465] (-226.578) (-227.512) -- 0:00:40
340000 -- [-227.376] (-226.467) (-229.651) (-228.398) * (-230.629) [-229.643] (-228.643) (-231.483) -- 0:00:40
Average standard deviation of split frequencies: 0.011477
340500 -- (-226.636) [-226.628] (-228.532) (-228.360) * (-227.782) (-227.403) (-226.452) [-226.539] -- 0:00:40
341000 -- [-226.936] (-227.901) (-226.942) (-228.570) * (-230.996) (-230.168) (-231.730) [-225.927] -- 0:00:42
341500 -- (-228.387) (-226.131) (-227.546) [-226.752] * [-226.456] (-229.037) (-227.179) (-226.214) -- 0:00:42
342000 -- (-228.303) [-225.719] (-226.746) (-226.545) * [-225.930] (-229.682) (-229.365) (-226.529) -- 0:00:42
342500 -- [-227.086] (-226.748) (-227.237) (-230.053) * (-235.515) (-227.246) [-226.878] (-227.752) -- 0:00:42
343000 -- (-226.959) [-229.548] (-230.028) (-227.328) * (-227.160) [-226.589] (-227.367) (-227.878) -- 0:00:42
343500 -- (-229.334) (-230.449) (-230.282) [-227.035] * (-225.665) (-228.365) [-229.988] (-227.221) -- 0:00:42
344000 -- [-226.278] (-227.059) (-228.865) (-231.249) * (-228.874) (-225.739) (-227.474) [-228.742] -- 0:00:41
344500 -- (-227.033) (-232.262) [-227.764] (-233.346) * [-226.639] (-226.716) (-231.475) (-226.273) -- 0:00:41
345000 -- (-232.998) (-228.903) [-226.905] (-228.687) * (-227.778) [-226.033] (-229.182) (-226.022) -- 0:00:41
Average standard deviation of split frequencies: 0.011051
345500 -- (-228.732) (-227.853) (-227.653) [-229.213] * (-226.856) [-230.272] (-228.508) (-227.342) -- 0:00:41
346000 -- [-227.427] (-232.713) (-229.451) (-228.599) * (-227.166) [-228.875] (-229.927) (-228.087) -- 0:00:41
346500 -- (-229.397) (-231.058) (-228.092) [-228.124] * (-226.852) (-230.468) (-228.494) [-226.177] -- 0:00:41
347000 -- (-231.507) [-229.489] (-232.510) (-229.090) * (-229.461) [-228.325] (-228.493) (-226.821) -- 0:00:41
347500 -- (-230.953) (-229.689) (-233.969) [-227.010] * (-228.651) (-227.903) [-229.278] (-230.153) -- 0:00:41
348000 -- (-226.004) (-228.417) (-230.973) [-228.056] * (-229.204) (-226.482) (-231.761) [-228.209] -- 0:00:41
348500 -- (-229.387) [-227.415] (-230.930) (-226.650) * (-227.754) [-228.591] (-230.329) (-227.579) -- 0:00:41
349000 -- (-229.336) [-230.416] (-226.947) (-227.759) * (-228.071) (-229.050) [-225.842] (-227.439) -- 0:00:41
349500 -- (-226.894) (-227.895) (-228.738) [-227.686] * (-226.340) (-229.505) [-227.078] (-226.361) -- 0:00:40
350000 -- (-226.197) (-226.499) [-227.356] (-228.798) * [-229.641] (-226.336) (-226.780) (-226.368) -- 0:00:40
Average standard deviation of split frequencies: 0.011308
350500 -- [-226.345] (-226.520) (-230.225) (-226.879) * (-227.676) (-228.975) [-228.590] (-226.951) -- 0:00:40
351000 -- (-226.963) (-228.192) [-227.125] (-226.225) * [-226.736] (-227.378) (-227.901) (-231.822) -- 0:00:40
351500 -- [-228.231] (-229.181) (-229.097) (-226.930) * (-226.006) (-227.049) [-229.087] (-226.035) -- 0:00:40
352000 -- (-229.766) (-228.643) (-227.862) [-228.669] * (-226.879) (-229.799) [-228.096] (-227.246) -- 0:00:40
352500 -- [-226.752] (-228.240) (-228.775) (-226.535) * [-226.908] (-228.348) (-229.635) (-228.885) -- 0:00:40
353000 -- [-228.305] (-227.544) (-228.047) (-228.287) * (-227.121) (-230.618) (-226.547) [-227.590] -- 0:00:42
353500 -- (-227.804) (-227.571) (-226.860) [-227.030] * [-226.932] (-226.642) (-226.530) (-227.383) -- 0:00:42
354000 -- (-228.720) [-228.071] (-228.788) (-227.589) * [-227.028] (-227.514) (-228.497) (-228.407) -- 0:00:41
354500 -- (-228.532) (-228.713) (-225.896) [-227.332] * [-228.496] (-226.578) (-228.227) (-227.542) -- 0:00:41
355000 -- (-228.931) [-227.514] (-226.779) (-228.787) * (-227.314) [-227.217] (-227.219) (-228.949) -- 0:00:41
Average standard deviation of split frequencies: 0.011606
355500 -- (-227.797) (-227.749) [-228.419] (-228.528) * (-225.973) [-229.359] (-227.386) (-228.558) -- 0:00:41
356000 -- (-227.970) (-228.437) (-228.795) [-227.692] * (-230.038) [-226.382] (-230.172) (-226.818) -- 0:00:41
356500 -- [-226.814] (-228.376) (-230.077) (-227.246) * (-229.502) (-228.493) [-226.798] (-226.001) -- 0:00:41
357000 -- (-228.835) (-229.509) (-226.851) [-227.782] * (-227.288) (-229.788) [-230.297] (-226.887) -- 0:00:41
357500 -- (-227.917) (-226.354) [-228.554] (-226.176) * (-227.333) [-229.417] (-226.652) (-228.516) -- 0:00:41
358000 -- (-227.631) (-227.432) (-230.530) [-225.982] * [-227.741] (-226.271) (-228.213) (-229.635) -- 0:00:41
358500 -- (-229.978) (-227.425) (-229.468) [-226.187] * (-227.008) (-235.068) (-226.612) [-226.057] -- 0:00:41
359000 -- (-227.131) [-225.931] (-227.066) (-227.402) * (-228.731) (-228.971) [-226.295] (-229.357) -- 0:00:41
359500 -- (-227.894) (-227.846) (-230.312) [-227.067] * (-226.829) (-225.791) (-229.495) [-226.548] -- 0:00:40
360000 -- (-226.121) (-230.553) (-228.317) [-226.312] * [-229.912] (-230.103) (-228.410) (-228.045) -- 0:00:40
Average standard deviation of split frequencies: 0.010918
360500 -- (-226.162) (-227.088) (-231.851) [-227.535] * (-228.304) (-229.231) (-227.387) [-227.721] -- 0:00:40
361000 -- [-228.897] (-226.786) (-230.907) (-227.054) * [-226.941] (-229.799) (-226.282) (-228.748) -- 0:00:40
361500 -- [-229.556] (-230.623) (-229.837) (-227.342) * (-229.227) (-228.798) (-229.535) [-229.140] -- 0:00:40
362000 -- [-231.279] (-228.285) (-228.338) (-227.214) * [-228.778] (-227.776) (-231.277) (-226.791) -- 0:00:40
362500 -- (-229.276) (-227.809) [-229.570] (-227.083) * (-231.337) [-227.189] (-228.308) (-226.414) -- 0:00:40
363000 -- (-227.976) (-229.507) (-227.742) [-226.085] * (-229.802) [-226.245] (-229.493) (-231.100) -- 0:00:40
363500 -- (-226.833) (-229.764) [-227.706] (-229.239) * (-228.335) (-228.909) [-227.568] (-226.231) -- 0:00:40
364000 -- (-229.412) (-232.393) (-225.840) [-227.840] * (-226.996) (-230.741) (-227.858) [-232.270] -- 0:00:40
364500 -- (-226.974) (-226.930) (-227.338) [-228.481] * (-228.398) (-231.773) (-227.198) [-229.251] -- 0:00:40
365000 -- [-226.804] (-229.829) (-229.578) (-225.647) * (-230.607) [-228.619] (-226.024) (-228.618) -- 0:00:40
Average standard deviation of split frequencies: 0.010986
365500 -- (-230.314) (-227.568) (-228.683) [-232.471] * (-228.779) (-228.606) [-226.800] (-231.040) -- 0:00:39
366000 -- [-227.382] (-227.126) (-226.963) (-230.438) * [-229.346] (-228.813) (-229.609) (-226.421) -- 0:00:41
366500 -- (-226.813) [-228.929] (-229.370) (-227.316) * (-228.970) (-227.631) [-230.221] (-227.001) -- 0:00:41
367000 -- (-228.049) (-228.207) (-230.060) [-228.283] * (-227.006) [-229.977] (-227.400) (-226.979) -- 0:00:41
367500 -- (-228.590) (-230.194) [-227.773] (-227.531) * (-228.870) (-230.622) (-227.773) [-228.661] -- 0:00:41
368000 -- (-226.487) (-226.251) (-226.452) [-228.926] * [-227.284] (-228.306) (-226.800) (-228.122) -- 0:00:41
368500 -- [-227.020] (-225.994) (-226.291) (-227.616) * (-232.827) (-229.232) [-226.624] (-229.992) -- 0:00:41
369000 -- [-227.214] (-230.059) (-226.157) (-229.855) * (-228.083) (-228.654) (-226.754) [-227.725] -- 0:00:41
369500 -- (-226.580) [-226.610] (-227.050) (-232.774) * (-226.753) (-228.365) (-229.953) [-226.498] -- 0:00:40
370000 -- (-228.354) (-227.056) [-227.565] (-234.922) * (-226.710) (-227.689) [-227.409] (-226.511) -- 0:00:40
Average standard deviation of split frequencies: 0.010773
370500 -- (-229.651) [-227.036] (-228.364) (-230.468) * (-230.278) (-232.142) (-229.175) [-226.805] -- 0:00:40
371000 -- (-228.284) (-227.405) (-228.239) [-232.133] * (-226.711) (-228.604) [-230.573] (-227.494) -- 0:00:40
371500 -- [-226.428] (-229.083) (-226.045) (-234.026) * (-230.483) [-227.996] (-235.163) (-228.062) -- 0:00:40
372000 -- (-227.155) (-230.108) [-226.631] (-228.408) * (-233.347) [-225.932] (-227.197) (-227.767) -- 0:00:40
372500 -- (-227.133) (-230.615) (-226.946) [-226.414] * (-231.024) (-225.674) [-228.767] (-230.482) -- 0:00:40
373000 -- (-228.227) (-227.722) (-228.752) [-228.185] * (-236.636) [-227.408] (-228.295) (-226.165) -- 0:00:40
373500 -- (-229.787) (-229.138) (-232.494) [-226.602] * (-226.487) [-230.365] (-227.274) (-226.335) -- 0:00:40
374000 -- (-227.130) [-227.252] (-234.680) (-229.376) * (-226.407) [-226.998] (-228.173) (-228.631) -- 0:00:40
374500 -- (-227.555) [-229.324] (-229.907) (-226.064) * (-229.711) [-227.059] (-230.219) (-228.120) -- 0:00:40
375000 -- [-226.713] (-227.632) (-228.972) (-231.772) * [-230.724] (-228.239) (-227.232) (-226.439) -- 0:00:40
Average standard deviation of split frequencies: 0.009735
375500 -- (-228.111) (-226.307) [-227.388] (-226.418) * (-226.570) (-225.550) (-228.521) [-227.432] -- 0:00:39
376000 -- (-227.633) (-226.631) [-226.384] (-226.929) * (-231.492) (-229.966) [-227.020] (-227.878) -- 0:00:39
376500 -- (-226.622) [-226.993] (-229.024) (-228.475) * [-228.733] (-227.081) (-226.819) (-227.116) -- 0:00:39
377000 -- [-226.618] (-228.338) (-233.851) (-228.370) * (-225.617) (-228.604) [-226.311] (-227.493) -- 0:00:39
377500 -- (-227.003) [-227.805] (-230.685) (-227.888) * (-226.170) (-226.804) (-228.763) [-228.776] -- 0:00:39
378000 -- (-227.512) (-226.367) (-229.997) [-227.043] * (-226.605) (-227.470) (-226.918) [-225.577] -- 0:00:39
378500 -- (-228.430) (-226.903) [-227.205] (-227.102) * [-226.865] (-226.368) (-227.322) (-226.057) -- 0:00:39
379000 -- [-227.585] (-226.506) (-226.828) (-229.870) * (-226.132) (-227.026) [-227.433] (-226.893) -- 0:00:39
379500 -- [-228.456] (-227.623) (-230.160) (-228.263) * (-228.926) (-228.199) [-227.631] (-227.431) -- 0:00:39
380000 -- [-228.690] (-234.369) (-228.538) (-227.821) * (-228.883) (-226.865) (-229.595) [-229.544] -- 0:00:39
Average standard deviation of split frequencies: 0.009907
380500 -- (-227.903) (-228.848) [-226.826] (-227.707) * (-227.009) (-226.718) (-226.724) [-225.968] -- 0:00:40
381000 -- (-226.415) [-228.144] (-227.180) (-229.288) * [-225.796] (-226.765) (-225.978) (-228.328) -- 0:00:40
381500 -- (-226.371) (-228.126) [-230.599] (-230.914) * (-226.858) (-226.588) [-227.115] (-226.086) -- 0:00:40
382000 -- (-231.751) (-228.740) (-228.632) [-227.781] * [-229.205] (-228.182) (-226.795) (-229.356) -- 0:00:40
382500 -- (-230.096) [-225.994] (-226.130) (-228.110) * (-230.870) [-226.714] (-228.237) (-228.034) -- 0:00:40
383000 -- (-228.640) (-227.668) (-227.471) [-228.358] * (-231.149) (-230.219) [-227.341] (-227.682) -- 0:00:40
383500 -- (-228.749) (-226.427) [-226.637] (-229.642) * (-228.152) [-228.973] (-227.726) (-227.761) -- 0:00:40
384000 -- (-228.289) (-226.432) (-225.920) [-225.752] * (-228.016) (-226.419) [-228.710] (-227.775) -- 0:00:40
384500 -- [-226.763] (-228.481) (-228.697) (-227.074) * (-228.264) [-225.994] (-230.123) (-228.634) -- 0:00:40
385000 -- (-228.063) [-227.720] (-226.058) (-227.821) * (-227.989) (-225.983) [-229.521] (-231.814) -- 0:00:39
Average standard deviation of split frequencies: 0.009842
385500 -- (-230.312) (-231.199) [-228.268] (-226.053) * [-226.939] (-226.923) (-233.125) (-231.361) -- 0:00:39
386000 -- [-227.748] (-227.035) (-229.132) (-226.849) * (-228.701) [-227.190] (-237.397) (-227.941) -- 0:00:39
386500 -- (-230.789) (-227.216) [-227.408] (-227.709) * (-229.865) [-227.276] (-228.231) (-226.871) -- 0:00:39
387000 -- [-231.496] (-228.552) (-233.016) (-229.141) * (-228.978) (-230.401) (-227.210) [-225.960] -- 0:00:39
387500 -- (-226.381) (-232.584) (-230.352) [-227.578] * [-227.854] (-228.060) (-230.052) (-227.832) -- 0:00:39
388000 -- (-227.842) (-230.411) (-231.465) [-226.720] * (-229.188) [-226.995] (-229.682) (-226.514) -- 0:00:39
388500 -- (-232.470) (-226.890) (-229.542) [-227.071] * (-230.431) [-227.986] (-230.640) (-228.544) -- 0:00:39
389000 -- [-229.077] (-227.520) (-228.473) (-226.471) * (-226.137) [-227.507] (-227.305) (-227.327) -- 0:00:39
389500 -- [-230.240] (-226.720) (-227.646) (-227.797) * (-227.470) (-226.839) [-226.593] (-229.256) -- 0:00:39
390000 -- [-228.319] (-228.056) (-226.551) (-228.276) * (-229.295) [-229.531] (-227.203) (-229.099) -- 0:00:39
Average standard deviation of split frequencies: 0.010079
390500 -- [-227.124] (-225.716) (-226.188) (-228.456) * (-227.832) (-227.360) (-227.409) [-226.833] -- 0:00:39
391000 -- (-230.153) [-226.784] (-230.850) (-226.439) * [-226.645] (-228.883) (-230.459) (-227.069) -- 0:00:38
391500 -- [-229.614] (-226.213) (-229.228) (-226.495) * [-229.468] (-229.550) (-232.904) (-228.578) -- 0:00:38
392000 -- [-226.442] (-228.418) (-229.148) (-226.189) * (-226.847) (-229.400) (-230.032) [-228.175] -- 0:00:38
392500 -- (-229.973) (-227.763) [-227.435] (-227.919) * [-231.807] (-228.017) (-226.538) (-232.039) -- 0:00:38
393000 -- [-227.183] (-226.932) (-228.234) (-230.988) * (-226.811) (-226.926) (-228.813) [-229.938] -- 0:00:38
393500 -- (-226.032) (-227.774) (-227.074) [-227.011] * (-230.357) [-227.022] (-227.436) (-231.356) -- 0:00:38
394000 -- (-225.918) (-227.717) (-228.776) [-228.677] * (-227.034) (-226.465) (-228.528) [-227.359] -- 0:00:38
394500 -- (-229.595) (-226.212) [-227.834] (-226.436) * [-229.220] (-228.039) (-228.357) (-226.804) -- 0:00:38
395000 -- (-228.292) (-226.990) (-229.221) [-226.379] * [-228.109] (-230.482) (-234.864) (-228.077) -- 0:00:38
Average standard deviation of split frequencies: 0.009873
395500 -- (-233.236) [-228.540] (-225.868) (-227.554) * [-229.942] (-227.915) (-227.409) (-226.592) -- 0:00:38
396000 -- (-226.160) (-229.717) [-227.713] (-227.483) * (-226.868) (-229.250) (-225.553) [-226.610] -- 0:00:39
396500 -- (-226.557) (-226.519) (-227.573) [-227.434] * (-226.571) [-227.228] (-228.174) (-229.847) -- 0:00:39
397000 -- (-228.517) (-226.564) [-230.350] (-228.463) * [-228.381] (-226.994) (-229.406) (-226.794) -- 0:00:39
397500 -- (-228.846) [-227.621] (-228.912) (-232.766) * (-227.398) (-232.913) [-230.211] (-231.500) -- 0:00:39
398000 -- (-230.553) [-227.851] (-227.432) (-231.509) * (-227.172) [-229.145] (-226.590) (-231.105) -- 0:00:39
398500 -- (-227.775) [-226.075] (-229.349) (-228.306) * [-226.618] (-226.223) (-227.433) (-227.346) -- 0:00:39
399000 -- (-235.826) (-228.216) [-227.026] (-228.520) * [-227.192] (-232.211) (-227.482) (-227.908) -- 0:00:39
399500 -- (-232.102) (-228.795) (-227.596) [-231.490] * [-229.028] (-229.525) (-227.219) (-226.663) -- 0:00:39
400000 -- (-225.801) (-226.926) (-230.359) [-227.988] * [-228.707] (-229.896) (-230.075) (-229.317) -- 0:00:39
Average standard deviation of split frequencies: 0.010727
400500 -- (-227.078) (-229.158) (-226.507) [-226.190] * (-226.413) (-235.186) [-228.781] (-234.498) -- 0:00:38
401000 -- (-228.120) (-226.634) (-226.172) [-228.263] * (-226.663) (-230.089) [-228.009] (-227.010) -- 0:00:38
401500 -- (-225.768) [-227.168] (-227.771) (-227.453) * (-228.765) [-227.716] (-230.611) (-226.599) -- 0:00:38
402000 -- [-226.450] (-232.333) (-227.379) (-230.295) * (-227.555) (-226.239) [-234.457] (-226.357) -- 0:00:38
402500 -- (-228.376) (-227.963) (-228.419) [-226.630] * (-226.778) [-225.822] (-228.970) (-227.899) -- 0:00:38
403000 -- (-225.865) (-226.746) (-226.451) [-229.104] * [-227.592] (-226.284) (-226.931) (-229.230) -- 0:00:38
403500 -- (-227.760) (-227.504) [-226.578] (-228.337) * (-226.215) (-228.165) [-227.064] (-226.658) -- 0:00:38
404000 -- (-225.593) [-225.978] (-228.791) (-226.994) * (-229.015) [-229.835] (-228.526) (-229.366) -- 0:00:38
404500 -- [-226.984] (-227.945) (-228.001) (-228.656) * (-229.397) (-229.760) [-227.712] (-226.651) -- 0:00:38
405000 -- [-229.386] (-227.307) (-227.310) (-227.878) * [-225.988] (-231.071) (-226.925) (-228.451) -- 0:00:38
Average standard deviation of split frequencies: 0.010586
405500 -- [-228.970] (-226.558) (-229.011) (-229.029) * (-226.278) (-228.295) [-226.594] (-227.557) -- 0:00:38
406000 -- (-226.502) (-228.248) (-226.981) [-226.674] * (-226.622) [-228.519] (-228.499) (-229.921) -- 0:00:38
406500 -- [-231.997] (-230.521) (-227.454) (-228.665) * [-231.193] (-230.787) (-226.208) (-229.147) -- 0:00:37
407000 -- (-227.016) (-228.322) [-227.068] (-228.981) * (-232.908) (-230.192) [-226.000] (-226.326) -- 0:00:37
407500 -- (-227.389) (-226.475) [-227.106] (-227.801) * [-229.218] (-228.085) (-227.149) (-228.986) -- 0:00:37
408000 -- (-227.015) (-228.382) (-226.980) [-227.340] * [-228.219] (-229.165) (-226.237) (-228.153) -- 0:00:37
408500 -- (-228.485) (-228.355) (-226.231) [-229.655] * (-233.018) (-226.969) (-226.678) [-228.805] -- 0:00:37
409000 -- (-227.972) (-227.581) (-226.353) [-227.487] * [-227.066] (-227.959) (-228.283) (-228.175) -- 0:00:37
409500 -- (-226.032) (-228.347) (-230.420) [-226.127] * (-229.421) [-226.407] (-228.474) (-226.673) -- 0:00:37
410000 -- (-229.807) [-229.486] (-234.359) (-226.441) * (-228.322) (-227.456) [-229.715] (-227.930) -- 0:00:37
Average standard deviation of split frequencies: 0.010399
410500 -- (-228.350) (-227.927) [-228.683] (-225.975) * (-228.464) (-228.289) [-227.593] (-229.665) -- 0:00:37
411000 -- (-231.835) [-227.693] (-228.590) (-228.224) * [-227.790] (-227.749) (-230.325) (-234.349) -- 0:00:38
411500 -- (-227.040) [-226.282] (-227.698) (-228.093) * (-226.239) (-226.719) (-230.529) [-226.115] -- 0:00:38
412000 -- (-226.189) [-227.481] (-230.732) (-229.825) * [-226.261] (-226.591) (-228.631) (-226.347) -- 0:00:38
412500 -- (-227.248) (-225.725) (-228.485) [-226.604] * [-228.122] (-226.786) (-228.560) (-226.880) -- 0:00:38
413000 -- [-227.920] (-226.008) (-226.633) (-229.729) * (-226.122) [-225.690] (-227.350) (-227.673) -- 0:00:38
413500 -- (-226.447) (-226.006) (-229.439) [-228.777] * (-227.667) (-226.263) [-228.455] (-228.421) -- 0:00:38
414000 -- (-226.361) (-226.749) [-229.111] (-228.448) * (-229.478) [-227.823] (-226.649) (-229.229) -- 0:00:38
414500 -- (-226.845) [-227.337] (-226.740) (-229.300) * (-229.797) (-229.678) [-231.411] (-231.940) -- 0:00:38
415000 -- [-226.560] (-227.874) (-227.748) (-229.467) * (-227.071) (-234.651) (-227.433) [-228.761] -- 0:00:38
Average standard deviation of split frequencies: 0.010732
415500 -- (-228.735) [-226.603] (-226.370) (-226.596) * [-225.928] (-230.849) (-227.667) (-225.594) -- 0:00:37
416000 -- (-229.436) (-228.468) [-230.185] (-227.396) * [-228.602] (-228.254) (-228.834) (-225.950) -- 0:00:37
416500 -- [-229.983] (-232.177) (-226.254) (-226.092) * (-231.512) (-228.527) (-230.460) [-229.802] -- 0:00:37
417000 -- (-227.252) (-227.437) [-228.131] (-226.400) * (-228.490) [-225.761] (-226.276) (-230.371) -- 0:00:37
417500 -- (-229.469) (-228.405) [-227.892] (-228.932) * (-228.987) (-227.945) [-226.760] (-229.683) -- 0:00:37
418000 -- (-227.533) [-226.795] (-226.151) (-230.579) * [-227.228] (-226.986) (-227.869) (-228.514) -- 0:00:37
418500 -- (-226.482) (-226.536) [-229.538] (-227.375) * (-226.535) (-226.489) (-227.948) [-228.193] -- 0:00:37
419000 -- (-234.769) [-229.101] (-226.722) (-225.825) * [-227.358] (-230.720) (-229.301) (-227.484) -- 0:00:37
419500 -- [-227.463] (-229.719) (-229.099) (-226.232) * [-227.309] (-227.919) (-227.635) (-227.317) -- 0:00:37
420000 -- [-226.825] (-227.815) (-227.925) (-227.672) * (-227.810) [-231.605] (-226.343) (-226.955) -- 0:00:37
Average standard deviation of split frequencies: 0.011602
420500 -- (-227.314) (-229.121) [-230.718] (-231.500) * (-227.654) (-228.592) [-226.982] (-225.912) -- 0:00:37
421000 -- (-228.571) (-230.294) [-229.363] (-229.909) * (-228.026) (-229.364) (-228.907) [-227.007] -- 0:00:37
421500 -- [-227.698] (-226.108) (-227.201) (-228.408) * (-228.688) (-228.292) [-228.857] (-229.840) -- 0:00:37
422000 -- [-227.253] (-227.997) (-226.869) (-227.355) * [-228.556] (-227.826) (-228.915) (-226.178) -- 0:00:36
422500 -- (-228.750) (-227.931) [-226.562] (-226.842) * (-229.188) (-228.708) (-227.229) [-228.940] -- 0:00:36
423000 -- (-228.313) [-228.403] (-229.824) (-227.536) * (-228.847) (-228.618) (-228.636) [-230.865] -- 0:00:36
423500 -- (-227.549) [-226.684] (-225.817) (-232.914) * [-226.137] (-229.655) (-228.800) (-226.513) -- 0:00:36
424000 -- (-227.224) (-228.100) (-226.708) [-225.780] * (-229.115) [-229.029] (-227.535) (-227.255) -- 0:00:36
424500 -- (-226.580) (-228.602) [-225.985] (-229.726) * [-230.102] (-227.594) (-227.974) (-231.729) -- 0:00:36
425000 -- (-226.583) [-227.415] (-230.344) (-229.429) * (-226.479) (-228.632) [-228.299] (-230.782) -- 0:00:36
Average standard deviation of split frequencies: 0.011977
425500 -- (-227.899) [-227.770] (-226.829) (-231.219) * (-226.689) [-227.815] (-227.759) (-234.575) -- 0:00:37
426000 -- [-226.864] (-229.282) (-228.212) (-226.218) * (-229.097) (-231.879) (-227.553) [-228.617] -- 0:00:37
426500 -- (-228.840) (-227.946) [-228.057] (-228.759) * (-231.164) [-226.864] (-226.096) (-229.834) -- 0:00:37
427000 -- [-228.394] (-231.221) (-229.185) (-227.996) * (-228.293) (-229.751) (-226.686) [-226.627] -- 0:00:37
427500 -- (-226.741) [-228.753] (-228.283) (-227.447) * (-228.229) [-230.972] (-229.149) (-226.786) -- 0:00:37
428000 -- (-226.053) [-228.257] (-226.527) (-227.643) * [-226.883] (-228.147) (-230.050) (-227.455) -- 0:00:37
428500 -- [-226.261] (-227.863) (-226.732) (-229.368) * (-226.491) [-228.674] (-227.767) (-228.990) -- 0:00:37
429000 -- [-226.669] (-228.519) (-226.249) (-227.508) * (-228.380) (-226.361) [-231.277] (-225.970) -- 0:00:37
429500 -- (-228.962) [-226.798] (-228.795) (-226.090) * (-234.800) (-226.519) [-229.711] (-226.539) -- 0:00:37
430000 -- [-227.734] (-225.901) (-230.530) (-226.841) * (-230.283) (-233.289) (-228.383) [-227.616] -- 0:00:37
Average standard deviation of split frequencies: 0.012041
430500 -- (-228.979) (-228.997) [-226.388] (-225.534) * (-229.920) (-230.126) (-230.994) [-228.264] -- 0:00:37
431000 -- (-234.314) [-227.044] (-229.200) (-225.629) * (-226.463) [-226.688] (-227.911) (-229.413) -- 0:00:36
431500 -- (-230.972) (-226.003) [-228.475] (-225.816) * (-228.678) (-229.623) (-227.391) [-229.120] -- 0:00:36
432000 -- [-228.714] (-227.354) (-230.990) (-228.623) * (-227.888) [-231.146] (-225.711) (-232.604) -- 0:00:36
432500 -- (-228.387) [-227.701] (-225.550) (-228.007) * (-228.914) (-228.061) [-228.088] (-227.450) -- 0:00:36
433000 -- (-234.510) [-229.992] (-226.050) (-228.465) * [-229.459] (-234.242) (-230.164) (-229.075) -- 0:00:36
433500 -- [-229.409] (-226.978) (-229.307) (-229.580) * (-231.625) (-232.963) (-226.061) [-226.201] -- 0:00:36
434000 -- (-226.757) (-229.363) (-235.186) [-230.868] * [-226.472] (-231.194) (-230.749) (-226.263) -- 0:00:36
434500 -- [-228.576] (-227.187) (-231.672) (-226.942) * (-227.497) (-230.847) [-226.875] (-229.864) -- 0:00:36
435000 -- (-227.053) [-228.054] (-231.904) (-225.713) * [-228.520] (-226.685) (-228.192) (-227.129) -- 0:00:36
Average standard deviation of split frequencies: 0.011893
435500 -- [-226.966] (-227.179) (-227.827) (-226.049) * (-232.571) (-225.998) [-230.172] (-228.317) -- 0:00:36
436000 -- [-227.144] (-227.800) (-229.504) (-226.366) * (-227.920) [-227.153] (-233.040) (-228.729) -- 0:00:36
436500 -- (-227.480) [-227.347] (-229.265) (-232.408) * (-227.997) (-229.272) [-227.715] (-230.374) -- 0:00:36
437000 -- (-227.553) (-226.706) [-226.107] (-228.076) * (-228.916) [-229.373] (-234.590) (-226.409) -- 0:00:36
437500 -- (-227.596) (-231.597) [-227.556] (-227.982) * (-228.990) (-229.424) (-227.531) [-227.745] -- 0:00:36
438000 -- (-232.201) (-230.090) [-226.832] (-228.880) * (-229.059) (-227.478) (-229.062) [-227.154] -- 0:00:35
438500 -- (-228.605) (-226.745) (-226.973) [-228.116] * (-227.743) (-227.981) [-228.555] (-228.566) -- 0:00:35
439000 -- (-228.665) (-231.081) [-227.196] (-228.103) * (-227.962) [-227.291] (-227.157) (-228.161) -- 0:00:35
439500 -- (-230.633) [-226.947] (-226.252) (-227.676) * (-226.164) (-228.039) (-226.560) [-228.275] -- 0:00:35
440000 -- (-232.004) (-226.759) (-230.593) [-227.761] * (-226.009) (-226.432) (-226.613) [-227.342] -- 0:00:35
Average standard deviation of split frequencies: 0.012585
440500 -- (-231.185) (-227.619) [-233.313] (-230.596) * (-226.235) (-226.508) (-226.642) [-229.071] -- 0:00:36
441000 -- (-227.301) (-227.448) (-236.332) [-226.794] * (-226.673) (-226.640) [-227.520] (-230.986) -- 0:00:36
441500 -- [-226.363] (-228.613) (-228.778) (-227.604) * [-232.022] (-230.355) (-226.531) (-226.995) -- 0:00:36
442000 -- (-227.254) (-232.553) (-226.951) [-228.888] * (-226.829) (-227.502) [-226.226] (-226.857) -- 0:00:36
442500 -- [-226.307] (-227.135) (-228.045) (-227.391) * (-227.232) [-228.215] (-229.163) (-230.412) -- 0:00:36
443000 -- (-227.156) [-227.907] (-226.283) (-228.868) * (-226.244) [-228.817] (-228.234) (-228.361) -- 0:00:36
443500 -- (-228.928) (-226.029) (-229.324) [-226.651] * (-229.903) [-227.995] (-226.636) (-227.985) -- 0:00:36
444000 -- (-226.944) (-230.150) (-229.865) [-226.085] * (-232.211) [-228.035] (-226.780) (-230.453) -- 0:00:36
444500 -- (-228.342) [-227.781] (-228.594) (-228.675) * (-230.486) (-229.243) [-226.119] (-233.857) -- 0:00:36
445000 -- [-228.010] (-226.923) (-226.512) (-227.819) * (-230.171) (-227.250) [-226.900] (-227.192) -- 0:00:36
Average standard deviation of split frequencies: 0.012124
445500 -- (-229.376) [-228.155] (-227.872) (-227.185) * (-227.821) (-226.768) [-226.379] (-226.458) -- 0:00:36
446000 -- (-232.266) (-228.009) (-228.811) [-228.350] * (-228.366) (-230.976) (-227.335) [-227.226] -- 0:00:36
446500 -- (-227.982) [-229.193] (-226.486) (-225.966) * (-229.378) [-226.965] (-226.394) (-227.591) -- 0:00:35
447000 -- (-225.893) (-226.208) [-229.866] (-225.800) * (-227.041) (-228.035) [-227.147] (-226.359) -- 0:00:35
447500 -- (-227.587) (-227.938) [-229.449] (-227.386) * (-229.599) (-227.704) (-228.216) [-228.159] -- 0:00:35
448000 -- (-229.533) (-228.931) (-230.295) [-229.162] * [-225.710] (-227.082) (-229.548) (-229.961) -- 0:00:35
448500 -- (-226.647) (-229.634) [-227.776] (-231.930) * (-228.409) [-227.206] (-229.896) (-229.638) -- 0:00:35
449000 -- (-227.618) (-231.103) [-225.598] (-227.333) * (-229.464) (-229.984) [-227.048] (-229.577) -- 0:00:35
449500 -- [-227.382] (-230.604) (-225.804) (-228.943) * (-228.762) (-226.873) [-226.066] (-226.978) -- 0:00:35
450000 -- (-226.018) [-229.535] (-227.911) (-229.541) * (-227.106) (-225.725) (-227.891) [-228.390] -- 0:00:35
Average standard deviation of split frequencies: 0.012245
450500 -- (-228.467) (-227.453) (-227.831) [-228.243] * (-230.078) [-229.447] (-227.221) (-230.329) -- 0:00:35
451000 -- [-227.753] (-229.558) (-226.682) (-229.270) * (-229.327) [-227.384] (-230.277) (-231.084) -- 0:00:35
451500 -- (-227.808) (-228.156) [-227.193] (-226.992) * (-227.890) (-234.386) (-226.136) [-227.703] -- 0:00:35
452000 -- [-226.789] (-228.423) (-227.177) (-227.314) * (-227.436) (-235.660) (-230.118) [-228.522] -- 0:00:35
452500 -- (-227.038) (-225.958) (-228.802) [-227.348] * [-228.717] (-234.826) (-227.522) (-231.477) -- 0:00:35
453000 -- (-228.814) (-225.985) [-228.469] (-226.877) * (-228.708) (-227.892) [-229.790] (-227.414) -- 0:00:35
453500 -- (-228.867) [-228.473] (-228.877) (-227.742) * (-231.202) (-228.455) (-232.132) [-228.075] -- 0:00:34
454000 -- (-230.160) (-227.930) [-230.186] (-228.865) * (-233.812) (-228.408) (-227.918) [-226.481] -- 0:00:34
454500 -- (-228.280) (-229.229) (-227.563) [-229.795] * (-227.994) (-226.703) (-226.552) [-230.929] -- 0:00:34
455000 -- (-228.795) [-226.961] (-228.208) (-226.717) * (-230.672) (-226.872) (-227.139) [-230.845] -- 0:00:34
Average standard deviation of split frequencies: 0.011980
455500 -- [-228.498] (-229.118) (-227.457) (-226.363) * [-226.735] (-229.262) (-228.891) (-227.000) -- 0:00:35
456000 -- (-232.162) (-228.184) (-228.085) [-227.788] * (-227.805) (-229.190) [-227.949] (-226.648) -- 0:00:35
456500 -- (-226.390) [-226.739] (-230.724) (-228.575) * [-228.747] (-229.346) (-226.404) (-227.158) -- 0:00:35
457000 -- (-228.760) [-228.687] (-226.296) (-234.445) * (-229.079) (-227.492) (-226.377) [-230.161] -- 0:00:35
457500 -- (-229.830) (-233.472) [-228.895] (-233.697) * (-228.710) (-226.983) (-227.591) [-231.475] -- 0:00:35
458000 -- [-227.540] (-229.956) (-227.938) (-227.517) * (-229.363) [-226.307] (-230.584) (-228.370) -- 0:00:35
458500 -- [-227.365] (-228.840) (-231.096) (-225.978) * (-230.377) (-226.579) (-228.113) [-228.409] -- 0:00:35
459000 -- (-229.319) (-231.212) (-230.625) [-227.975] * (-228.034) [-227.884] (-229.317) (-227.781) -- 0:00:35
459500 -- (-234.940) (-230.785) [-232.714] (-226.071) * (-227.483) (-227.979) [-226.878] (-228.571) -- 0:00:35
460000 -- (-227.069) (-226.275) (-229.102) [-226.572] * (-226.255) [-227.555] (-227.501) (-227.092) -- 0:00:35
Average standard deviation of split frequencies: 0.012099
460500 -- [-230.028] (-226.521) (-232.586) (-228.497) * (-228.066) [-227.995] (-228.613) (-232.493) -- 0:00:35
461000 -- (-231.516) (-230.184) (-226.420) [-228.239] * [-227.997] (-227.359) (-226.561) (-226.094) -- 0:00:35
461500 -- (-231.019) [-228.057] (-230.455) (-228.839) * [-228.123] (-230.057) (-227.199) (-228.868) -- 0:00:35
462000 -- (-229.259) [-229.337] (-227.358) (-227.823) * (-226.378) (-227.738) (-227.135) [-231.372] -- 0:00:34
462500 -- (-226.560) (-225.857) [-227.751] (-228.615) * [-225.943] (-227.426) (-227.140) (-225.865) -- 0:00:34
463000 -- (-230.484) (-228.919) [-229.203] (-227.401) * (-225.943) (-233.425) [-230.389] (-228.455) -- 0:00:34
463500 -- (-227.496) (-228.977) (-228.633) [-227.272] * (-228.740) [-226.420] (-228.848) (-230.237) -- 0:00:34
464000 -- [-233.300] (-229.997) (-228.396) (-228.298) * [-226.151] (-235.066) (-226.834) (-229.023) -- 0:00:34
464500 -- (-229.251) [-229.892] (-226.425) (-228.939) * [-228.163] (-227.375) (-226.294) (-227.645) -- 0:00:34
465000 -- (-228.065) (-229.007) [-226.142] (-232.269) * [-229.577] (-229.812) (-227.213) (-228.708) -- 0:00:34
Average standard deviation of split frequencies: 0.012199
465500 -- (-226.531) (-226.255) [-226.080] (-226.256) * (-226.140) (-228.442) [-226.948] (-227.884) -- 0:00:34
466000 -- [-227.512] (-232.639) (-226.041) (-227.681) * (-225.849) (-226.148) (-227.188) [-226.876] -- 0:00:34
466500 -- [-227.073] (-235.228) (-229.305) (-229.126) * (-226.819) [-229.718] (-228.145) (-227.732) -- 0:00:34
467000 -- (-228.096) (-233.531) (-227.604) [-228.701] * [-229.694] (-229.510) (-228.186) (-227.848) -- 0:00:34
467500 -- (-228.077) (-226.735) [-226.183] (-227.954) * (-229.050) (-233.190) (-226.005) [-230.222] -- 0:00:34
468000 -- (-228.928) (-231.914) (-228.166) [-226.911] * [-231.583] (-229.782) (-230.579) (-228.802) -- 0:00:34
468500 -- (-228.259) (-227.778) [-226.293] (-229.863) * (-229.705) [-227.050] (-231.738) (-229.442) -- 0:00:34
469000 -- (-227.490) (-227.706) [-228.124] (-227.268) * (-229.378) (-230.343) (-228.311) [-226.774] -- 0:00:33
469500 -- (-228.611) (-227.289) (-229.711) [-226.350] * (-231.783) (-227.203) [-227.725] (-227.632) -- 0:00:33
470000 -- [-227.273] (-226.689) (-229.454) (-227.578) * (-226.906) [-226.076] (-232.264) (-226.569) -- 0:00:33
Average standard deviation of split frequencies: 0.012196
470500 -- (-231.085) (-231.316) (-230.023) [-229.138] * [-228.246] (-227.227) (-236.241) (-226.522) -- 0:00:34
471000 -- [-229.545] (-228.370) (-231.238) (-231.614) * [-230.980] (-227.737) (-229.464) (-225.998) -- 0:00:34
471500 -- (-227.502) (-225.753) (-234.189) [-226.453] * (-232.804) (-226.196) [-229.022] (-227.546) -- 0:00:34
472000 -- [-228.188] (-225.730) (-228.721) (-227.579) * (-232.673) [-226.877] (-229.483) (-227.279) -- 0:00:34
472500 -- (-229.163) [-228.034] (-226.268) (-226.169) * (-230.092) (-227.365) [-228.559] (-227.119) -- 0:00:34
473000 -- (-227.682) (-229.317) (-227.255) [-228.937] * [-231.153] (-229.580) (-236.669) (-228.366) -- 0:00:34
473500 -- (-228.681) [-227.231] (-227.469) (-226.472) * (-226.659) (-231.498) [-228.388] (-227.348) -- 0:00:34
474000 -- (-226.132) (-227.742) [-226.917] (-226.729) * (-226.404) (-230.067) (-227.920) [-227.979] -- 0:00:34
474500 -- [-227.785] (-227.871) (-233.745) (-229.488) * (-227.504) (-226.404) [-225.952] (-227.417) -- 0:00:34
475000 -- (-226.600) (-233.195) (-227.764) [-227.428] * [-227.931] (-227.002) (-232.365) (-229.524) -- 0:00:34
Average standard deviation of split frequencies: 0.011884
475500 -- (-227.343) (-228.971) (-228.624) [-226.515] * (-228.118) [-229.557] (-229.368) (-228.123) -- 0:00:34
476000 -- (-227.329) [-228.746] (-230.456) (-230.993) * (-231.186) (-227.138) [-227.717] (-235.538) -- 0:00:34
476500 -- (-226.713) [-227.860] (-226.780) (-227.979) * (-227.746) [-225.730] (-226.188) (-229.604) -- 0:00:34
477000 -- (-229.765) [-226.783] (-227.297) (-228.428) * (-226.568) [-228.351] (-228.496) (-229.701) -- 0:00:33
477500 -- (-228.463) (-229.977) (-227.562) [-227.745] * [-226.788] (-234.019) (-226.740) (-227.543) -- 0:00:33
478000 -- (-231.370) (-227.460) (-229.105) [-229.195] * (-229.222) (-227.095) (-228.051) [-229.714] -- 0:00:33
478500 -- [-229.150] (-227.751) (-227.193) (-226.521) * (-226.732) [-226.755] (-226.947) (-228.138) -- 0:00:33
479000 -- (-237.772) [-228.312] (-228.656) (-228.184) * (-228.637) (-226.539) [-229.436] (-230.209) -- 0:00:33
479500 -- (-225.920) [-227.408] (-226.125) (-226.712) * (-228.402) (-228.028) [-229.513] (-227.234) -- 0:00:33
480000 -- (-233.281) (-227.330) [-226.164] (-228.754) * (-227.561) (-226.189) [-226.256] (-230.009) -- 0:00:33
Average standard deviation of split frequencies: 0.009685
480500 -- (-228.671) (-227.814) (-227.897) [-230.020] * (-229.051) [-229.033] (-227.786) (-226.315) -- 0:00:33
481000 -- (-230.253) (-226.115) (-227.742) [-227.377] * (-227.879) (-232.491) (-228.449) [-229.530] -- 0:00:33
481500 -- (-230.423) [-226.618] (-228.122) (-227.493) * (-226.486) (-226.511) (-228.142) [-229.650] -- 0:00:33
482000 -- (-226.795) (-226.492) [-226.456] (-228.418) * (-228.018) (-228.485) (-227.293) [-227.070] -- 0:00:33
482500 -- (-228.612) (-227.118) (-228.000) [-226.611] * (-227.217) (-227.265) (-233.496) [-227.727] -- 0:00:33
483000 -- (-227.181) [-227.625] (-228.108) (-226.205) * (-228.123) (-225.909) (-231.435) [-228.661] -- 0:00:33
483500 -- [-232.089] (-228.935) (-227.967) (-230.772) * [-227.205] (-228.902) (-229.056) (-228.788) -- 0:00:34
484000 -- (-227.185) [-226.436] (-226.512) (-236.263) * [-228.484] (-232.170) (-229.671) (-230.804) -- 0:00:34
484500 -- (-225.889) [-229.104] (-227.818) (-230.001) * (-226.673) [-226.265] (-227.985) (-228.222) -- 0:00:34
485000 -- (-227.784) (-226.919) (-226.922) [-227.471] * (-227.924) [-226.018] (-229.441) (-226.952) -- 0:00:33
Average standard deviation of split frequencies: 0.010613
485500 -- (-228.364) [-230.903] (-227.342) (-228.614) * (-227.390) [-225.758] (-231.622) (-227.915) -- 0:00:33
486000 -- [-227.907] (-226.650) (-228.031) (-229.789) * (-227.214) [-226.551] (-228.783) (-228.395) -- 0:00:33
486500 -- (-228.131) (-227.103) [-227.438] (-226.557) * [-227.688] (-227.980) (-225.729) (-231.273) -- 0:00:33
487000 -- [-228.679] (-227.928) (-232.368) (-228.076) * (-227.346) (-228.408) [-228.472] (-226.126) -- 0:00:33
487500 -- (-226.549) (-227.706) [-229.535] (-228.631) * [-226.985] (-233.150) (-230.641) (-232.817) -- 0:00:33
488000 -- (-228.382) (-230.847) [-228.167] (-233.175) * (-226.757) (-227.622) [-227.166] (-225.826) -- 0:00:33
488500 -- (-230.215) (-232.378) [-228.025] (-227.695) * (-232.494) [-227.910] (-228.420) (-225.985) -- 0:00:33
489000 -- (-228.300) (-227.311) [-226.917] (-227.460) * (-230.091) [-231.834] (-227.549) (-226.865) -- 0:00:33
489500 -- (-231.727) [-227.888] (-226.778) (-226.870) * [-226.817] (-234.238) (-228.586) (-231.119) -- 0:00:33
490000 -- (-227.437) (-228.201) [-227.630] (-230.038) * [-227.093] (-229.105) (-228.390) (-230.135) -- 0:00:33
Average standard deviation of split frequencies: 0.010399
490500 -- (-229.752) [-226.913] (-229.755) (-230.064) * (-229.375) (-230.031) (-227.589) [-226.573] -- 0:00:33
491000 -- (-233.556) [-225.658] (-227.195) (-231.142) * [-228.171] (-227.832) (-228.905) (-227.070) -- 0:00:33
491500 -- (-227.557) [-230.195] (-228.909) (-236.195) * (-228.241) (-229.542) (-231.221) [-230.236] -- 0:00:33
492000 -- (-227.204) (-226.857) [-229.965] (-227.272) * (-227.460) [-228.508] (-227.703) (-226.648) -- 0:00:33
492500 -- [-231.318] (-227.248) (-230.581) (-230.639) * (-233.302) [-228.030] (-227.803) (-226.433) -- 0:00:32
493000 -- [-226.265] (-227.396) (-226.817) (-228.440) * (-231.649) [-226.459] (-228.545) (-226.518) -- 0:00:32
493500 -- [-226.637] (-228.185) (-230.210) (-225.746) * (-230.601) [-228.046] (-228.947) (-228.848) -- 0:00:32
494000 -- (-227.334) (-227.022) (-231.672) [-225.812] * (-228.159) (-226.031) (-228.408) [-226.015] -- 0:00:32
494500 -- (-226.573) (-228.868) (-227.263) [-226.668] * (-227.868) (-231.457) [-228.915] (-227.986) -- 0:00:32
495000 -- (-226.800) (-231.766) [-229.463] (-230.111) * (-227.830) [-226.524] (-227.482) (-227.040) -- 0:00:32
Average standard deviation of split frequencies: 0.011349
495500 -- (-226.272) (-227.354) (-230.917) [-228.913] * (-225.941) (-228.259) [-230.211] (-229.573) -- 0:00:32
496000 -- (-226.588) (-230.136) [-227.751] (-227.446) * (-227.248) (-226.745) [-229.840] (-227.177) -- 0:00:32
496500 -- (-231.290) (-227.444) [-227.337] (-227.213) * (-227.667) [-228.312] (-227.021) (-227.605) -- 0:00:32
497000 -- (-227.440) [-226.036] (-228.431) (-231.559) * (-228.815) (-228.092) [-231.619] (-227.067) -- 0:00:32
497500 -- (-227.941) (-226.964) (-226.234) [-226.594] * [-228.407] (-227.289) (-234.724) (-226.796) -- 0:00:32
498000 -- [-226.736] (-229.649) (-226.974) (-231.852) * (-228.524) (-225.834) [-227.732] (-226.306) -- 0:00:33
498500 -- (-226.030) [-229.916] (-232.225) (-229.788) * [-227.554] (-230.034) (-228.095) (-227.677) -- 0:00:33
499000 -- (-228.903) (-226.785) (-231.422) [-226.970] * (-226.671) (-231.917) [-226.067] (-226.300) -- 0:00:33
499500 -- (-227.866) [-229.331] (-234.854) (-227.959) * (-229.223) (-228.150) (-227.229) [-225.516] -- 0:00:33
500000 -- (-227.105) (-227.623) [-226.173] (-228.178) * (-227.869) (-231.005) (-230.521) [-227.213] -- 0:00:33
Average standard deviation of split frequencies: 0.011354
500500 -- [-227.213] (-227.411) (-226.867) (-228.105) * [-225.898] (-226.963) (-227.638) (-227.473) -- 0:00:32
501000 -- (-228.003) (-226.265) (-227.079) [-225.609] * [-231.307] (-228.844) (-227.451) (-226.350) -- 0:00:32
501500 -- (-225.769) (-228.626) (-228.926) [-228.483] * (-234.163) (-230.685) [-225.609] (-226.979) -- 0:00:32
502000 -- (-229.089) (-228.126) (-227.305) [-228.075] * (-231.605) [-226.503] (-228.184) (-227.923) -- 0:00:32
502500 -- (-230.564) (-231.772) [-227.038] (-231.930) * (-229.564) (-226.599) [-227.879] (-230.097) -- 0:00:32
503000 -- (-230.547) (-226.092) [-226.322] (-229.083) * (-232.105) (-226.886) [-226.666] (-231.284) -- 0:00:32
503500 -- (-228.449) [-227.013] (-227.026) (-226.527) * (-233.254) [-226.211] (-225.614) (-226.435) -- 0:00:32
504000 -- (-230.178) [-226.792] (-227.751) (-227.649) * (-231.790) [-226.987] (-232.170) (-232.855) -- 0:00:32
504500 -- [-226.584] (-226.330) (-227.706) (-227.592) * [-226.653] (-227.484) (-228.344) (-227.362) -- 0:00:32
505000 -- (-228.549) [-227.387] (-228.457) (-227.485) * (-228.328) (-228.668) (-226.926) [-230.771] -- 0:00:32
Average standard deviation of split frequencies: 0.011180
505500 -- (-231.104) (-227.294) (-229.399) [-227.999] * (-228.766) (-226.603) (-226.018) [-237.909] -- 0:00:32
506000 -- [-227.259] (-234.772) (-227.870) (-227.225) * (-227.901) (-226.158) (-227.384) [-228.235] -- 0:00:32
506500 -- (-229.986) [-227.690] (-227.146) (-227.217) * (-228.145) (-230.409) (-229.033) [-230.512] -- 0:00:32
507000 -- (-229.145) (-230.836) (-228.205) [-229.985] * (-226.761) (-230.374) [-228.254] (-225.839) -- 0:00:32
507500 -- (-228.705) (-229.717) [-227.415] (-227.977) * [-226.674] (-230.505) (-229.546) (-229.070) -- 0:00:32
508000 -- (-227.075) (-228.076) (-227.917) [-228.689] * (-230.884) [-227.679] (-228.836) (-227.301) -- 0:00:31
508500 -- [-228.254] (-227.414) (-228.563) (-229.621) * [-228.537] (-228.741) (-226.872) (-227.839) -- 0:00:31
509000 -- (-229.830) (-227.347) (-226.304) [-227.211] * [-227.816] (-226.242) (-228.930) (-228.692) -- 0:00:31
509500 -- (-228.954) (-225.671) (-227.006) [-229.246] * (-227.134) (-228.583) [-229.404] (-226.892) -- 0:00:31
510000 -- (-228.748) (-227.631) [-231.478] (-226.314) * [-230.227] (-226.738) (-227.168) (-228.315) -- 0:00:31
Average standard deviation of split frequencies: 0.010752
510500 -- (-230.366) [-226.198] (-234.271) (-229.056) * [-230.325] (-225.900) (-228.346) (-228.337) -- 0:00:31
511000 -- (-227.850) (-227.864) [-228.787] (-227.319) * (-228.940) [-226.301] (-228.253) (-231.164) -- 0:00:31
511500 -- (-229.641) [-226.883] (-227.934) (-234.463) * (-228.668) (-231.356) [-226.969] (-226.619) -- 0:00:31
512000 -- (-227.693) (-226.503) [-225.971] (-227.213) * [-229.638] (-228.608) (-227.919) (-228.519) -- 0:00:31
512500 -- (-227.662) [-229.440] (-227.212) (-226.901) * (-227.375) (-226.670) (-225.877) [-228.099] -- 0:00:31
513000 -- (-228.964) [-227.588] (-227.132) (-227.525) * [-226.698] (-226.817) (-226.996) (-227.199) -- 0:00:31
513500 -- [-228.217] (-226.369) (-230.722) (-227.178) * (-229.293) (-227.114) [-226.239] (-226.977) -- 0:00:32
514000 -- (-230.527) (-227.579) (-228.977) [-226.685] * [-229.686] (-228.614) (-225.621) (-229.396) -- 0:00:32
514500 -- (-227.534) (-231.433) (-229.704) [-227.088] * [-228.183] (-228.115) (-226.864) (-230.466) -- 0:00:32
515000 -- [-227.886] (-227.732) (-229.651) (-228.767) * (-226.975) (-227.436) (-228.138) [-229.963] -- 0:00:32
Average standard deviation of split frequencies: 0.010221
515500 -- [-228.258] (-227.210) (-229.366) (-228.046) * (-226.397) [-227.807] (-229.090) (-229.007) -- 0:00:31
516000 -- (-226.036) (-226.360) (-229.287) [-226.114] * (-226.506) (-228.258) [-226.746] (-226.409) -- 0:00:31
516500 -- [-226.372] (-228.587) (-228.226) (-226.755) * [-226.900] (-226.118) (-230.439) (-226.069) -- 0:00:31
517000 -- (-229.102) [-228.756] (-228.619) (-228.208) * [-228.788] (-228.545) (-228.764) (-226.070) -- 0:00:31
517500 -- (-234.066) [-230.975] (-226.203) (-228.926) * [-226.585] (-228.575) (-228.460) (-230.604) -- 0:00:31
518000 -- [-228.112] (-227.754) (-228.073) (-228.892) * (-226.305) [-228.393] (-228.156) (-228.643) -- 0:00:31
518500 -- (-226.767) (-230.544) [-226.418] (-226.308) * [-225.802] (-229.033) (-226.769) (-229.948) -- 0:00:31
519000 -- [-227.413] (-226.923) (-227.359) (-227.177) * (-226.860) [-227.730] (-229.853) (-227.688) -- 0:00:31
519500 -- (-227.384) (-226.727) [-227.956] (-228.564) * (-229.484) (-226.103) (-226.737) [-227.065] -- 0:00:31
520000 -- (-227.506) [-228.832] (-228.892) (-227.613) * (-229.529) (-229.860) (-227.427) [-226.877] -- 0:00:31
Average standard deviation of split frequencies: 0.009676
520500 -- (-229.076) (-226.593) [-228.757] (-227.762) * [-227.607] (-238.272) (-227.952) (-225.604) -- 0:00:31
521000 -- [-227.917] (-227.293) (-227.819) (-226.173) * (-227.351) (-228.258) (-228.063) [-226.155] -- 0:00:31
521500 -- [-227.879] (-227.342) (-228.000) (-226.422) * (-228.879) (-228.834) (-226.839) [-227.719] -- 0:00:31
522000 -- [-226.452] (-227.615) (-226.542) (-228.401) * (-229.027) (-230.353) (-225.612) [-226.334] -- 0:00:31
522500 -- [-228.706] (-230.881) (-227.617) (-227.933) * (-228.848) [-226.847] (-230.048) (-227.330) -- 0:00:31
523000 -- (-226.438) (-228.616) (-228.050) [-227.648] * [-229.144] (-228.762) (-228.016) (-225.954) -- 0:00:31
523500 -- [-226.611] (-227.660) (-232.680) (-228.748) * [-227.688] (-228.068) (-227.242) (-228.116) -- 0:00:30
524000 -- [-226.638] (-226.929) (-227.656) (-226.857) * (-229.909) [-227.413] (-225.608) (-226.945) -- 0:00:30
524500 -- (-230.939) (-226.996) (-226.576) [-227.035] * (-232.851) (-228.139) (-229.286) [-229.070] -- 0:00:30
525000 -- [-227.341] (-229.016) (-230.081) (-227.500) * (-228.096) [-226.056] (-228.732) (-226.659) -- 0:00:30
Average standard deviation of split frequencies: 0.009858
525500 -- [-229.602] (-226.962) (-229.212) (-232.111) * (-233.380) (-227.790) [-225.968] (-226.038) -- 0:00:30
526000 -- [-227.633] (-227.227) (-228.604) (-230.227) * (-229.868) [-228.464] (-226.318) (-227.343) -- 0:00:30
526500 -- (-226.066) (-228.086) [-232.090] (-226.831) * [-227.601] (-230.988) (-226.554) (-225.850) -- 0:00:30
527000 -- [-226.437] (-230.664) (-228.197) (-227.957) * (-227.046) [-230.122] (-227.075) (-226.787) -- 0:00:30
527500 -- (-230.939) (-228.403) (-226.953) [-230.397] * (-226.373) (-229.930) [-227.050] (-227.921) -- 0:00:30
528000 -- (-230.972) (-228.249) [-230.770] (-231.926) * (-228.152) [-226.137] (-229.235) (-235.648) -- 0:00:30
528500 -- (-228.336) [-228.237] (-225.812) (-227.716) * (-226.432) (-226.233) [-231.148] (-231.011) -- 0:00:30
529000 -- (-228.281) (-231.062) [-231.513] (-227.148) * (-231.939) (-229.409) [-229.928] (-227.846) -- 0:00:30
529500 -- (-227.860) [-227.000] (-229.984) (-229.226) * (-229.284) (-226.110) [-227.564] (-228.470) -- 0:00:30
530000 -- (-226.336) (-228.168) [-227.072] (-228.697) * [-226.371] (-225.974) (-227.659) (-231.056) -- 0:00:30
Average standard deviation of split frequencies: 0.009716
530500 -- (-226.686) (-228.240) [-227.020] (-226.128) * (-227.910) (-231.625) [-225.823] (-229.546) -- 0:00:30
531000 -- [-227.667] (-227.611) (-226.427) (-228.229) * (-227.674) (-227.564) [-226.553] (-228.272) -- 0:00:30
531500 -- [-232.693] (-230.032) (-231.894) (-232.163) * (-228.477) (-229.430) [-228.004] (-227.889) -- 0:00:30
532000 -- (-229.020) [-227.827] (-228.034) (-229.229) * [-226.000] (-227.458) (-228.424) (-228.385) -- 0:00:30
532500 -- (-229.278) [-228.130] (-230.939) (-226.458) * [-226.637] (-230.451) (-229.356) (-226.686) -- 0:00:30
533000 -- (-227.759) [-230.505] (-228.247) (-225.908) * (-225.946) [-228.704] (-229.025) (-227.151) -- 0:00:30
533500 -- (-227.672) (-231.167) (-226.038) [-225.709] * (-226.838) (-226.511) [-225.920] (-226.897) -- 0:00:30
534000 -- [-228.248] (-228.032) (-227.577) (-227.140) * [-230.294] (-228.353) (-225.848) (-231.238) -- 0:00:30
534500 -- (-228.216) (-230.142) (-226.765) [-226.848] * (-230.098) (-229.907) (-226.728) [-225.801] -- 0:00:30
535000 -- (-225.962) (-228.047) (-227.520) [-226.467] * (-227.931) [-227.393] (-227.752) (-227.816) -- 0:00:30
Average standard deviation of split frequencies: 0.008905
535500 -- [-227.807] (-228.518) (-227.529) (-230.735) * (-228.360) [-227.972] (-227.520) (-227.595) -- 0:00:30
536000 -- (-229.343) (-228.490) (-230.699) [-226.612] * [-229.258] (-230.691) (-226.361) (-230.707) -- 0:00:30
536500 -- (-228.096) (-227.277) [-228.734] (-226.709) * (-229.729) (-228.700) [-227.326] (-229.583) -- 0:00:30
537000 -- (-229.122) (-226.852) [-225.946] (-227.701) * (-227.811) [-226.927] (-230.642) (-230.630) -- 0:00:30
537500 -- (-226.944) (-227.775) (-226.894) [-228.896] * (-228.046) (-231.289) (-227.104) [-227.214] -- 0:00:30
538000 -- (-226.764) [-228.859] (-229.868) (-227.048) * (-228.196) [-227.854] (-227.306) (-231.154) -- 0:00:30
538500 -- [-226.534] (-227.973) (-226.519) (-228.499) * [-227.307] (-226.837) (-226.242) (-228.666) -- 0:00:29
539000 -- (-227.340) [-228.818] (-225.709) (-227.706) * (-228.528) [-227.410] (-226.368) (-228.824) -- 0:00:29
539500 -- (-228.107) [-228.069] (-228.916) (-229.348) * (-231.720) (-227.161) (-227.935) [-227.762] -- 0:00:29
540000 -- [-226.840] (-225.783) (-230.865) (-226.833) * (-225.852) [-228.256] (-231.381) (-227.541) -- 0:00:29
Average standard deviation of split frequencies: 0.008882
540500 -- [-226.149] (-226.365) (-228.227) (-226.055) * [-226.602] (-226.677) (-232.662) (-227.192) -- 0:00:29
541000 -- (-226.959) (-227.583) (-229.129) [-228.879] * (-226.260) (-226.108) [-229.933] (-225.841) -- 0:00:29
541500 -- (-226.216) (-229.533) (-226.711) [-226.218] * (-228.651) [-227.859] (-234.258) (-227.296) -- 0:00:29
542000 -- (-226.759) [-228.979] (-227.121) (-227.432) * (-230.644) (-229.295) (-229.299) [-227.728] -- 0:00:29
542500 -- [-228.395] (-228.339) (-228.471) (-231.244) * (-229.402) (-226.213) (-227.744) [-226.589] -- 0:00:29
543000 -- (-228.702) (-225.903) [-228.186] (-232.316) * [-228.773] (-227.863) (-227.567) (-230.793) -- 0:00:29
543500 -- [-229.090] (-229.085) (-229.354) (-232.161) * (-228.847) (-227.835) (-227.458) [-227.511] -- 0:00:29
544000 -- (-229.248) (-225.995) [-227.621] (-227.469) * [-230.075] (-227.119) (-226.191) (-228.143) -- 0:00:29
544500 -- (-229.816) (-226.469) [-227.120] (-228.758) * (-229.548) (-227.001) [-231.025] (-229.979) -- 0:00:29
545000 -- (-233.342) (-228.287) (-227.596) [-227.390] * (-227.576) (-227.284) (-227.250) [-226.970] -- 0:00:29
Average standard deviation of split frequencies: 0.009012
545500 -- (-228.379) (-227.900) (-227.781) [-226.338] * (-227.036) (-225.699) [-231.331] (-229.336) -- 0:00:29
546000 -- (-231.779) [-230.158] (-229.638) (-227.565) * (-227.675) (-227.401) [-225.938] (-230.037) -- 0:00:29
546500 -- [-227.762] (-227.597) (-227.259) (-227.673) * (-227.112) [-225.835] (-229.274) (-226.871) -- 0:00:29
547000 -- (-231.235) (-226.889) (-226.581) [-231.054] * (-226.764) [-228.875] (-228.302) (-226.802) -- 0:00:29
547500 -- (-229.085) (-228.062) [-227.942] (-228.758) * (-227.083) [-230.951] (-228.431) (-226.721) -- 0:00:29
548000 -- (-227.950) (-229.259) [-229.671] (-225.936) * (-230.696) [-228.367] (-226.282) (-227.899) -- 0:00:29
548500 -- (-230.172) (-229.966) [-228.896] (-227.244) * [-229.324] (-227.856) (-229.206) (-227.666) -- 0:00:29
549000 -- (-227.841) (-231.842) [-230.032] (-229.784) * (-227.286) [-228.273] (-227.074) (-226.876) -- 0:00:29
549500 -- [-226.543] (-229.016) (-226.640) (-229.753) * (-228.260) (-228.042) (-228.307) [-226.882] -- 0:00:29
550000 -- (-227.947) [-227.158] (-228.390) (-225.774) * (-228.242) (-226.643) [-228.295] (-227.108) -- 0:00:29
Average standard deviation of split frequencies: 0.008614
550500 -- (-231.539) [-226.554] (-227.404) (-229.027) * (-229.963) [-227.670] (-227.622) (-228.448) -- 0:00:29
551000 -- (-229.846) [-226.543] (-227.614) (-229.136) * (-232.230) (-229.440) [-225.923] (-227.785) -- 0:00:29
551500 -- [-230.582] (-227.504) (-228.378) (-228.347) * (-227.531) [-228.000] (-227.865) (-226.616) -- 0:00:29
552000 -- [-229.314] (-230.130) (-230.687) (-229.046) * (-228.893) (-226.576) (-227.030) [-226.305] -- 0:00:29
552500 -- (-227.371) (-230.047) [-231.298] (-227.432) * [-228.568] (-230.217) (-228.407) (-228.567) -- 0:00:29
553000 -- (-227.109) (-226.482) (-237.831) [-227.053] * [-226.660] (-229.807) (-231.289) (-230.753) -- 0:00:29
553500 -- (-227.647) (-226.746) [-226.971] (-227.966) * (-230.838) (-225.858) [-231.417] (-230.916) -- 0:00:29
554000 -- (-228.472) [-226.544] (-227.287) (-227.182) * (-226.930) (-228.303) [-227.334] (-231.103) -- 0:00:28
554500 -- [-227.176] (-228.397) (-227.189) (-230.576) * (-230.815) [-226.637] (-228.232) (-230.114) -- 0:00:28
555000 -- (-227.945) (-229.331) [-228.476] (-230.467) * (-225.890) (-225.976) (-225.953) [-228.513] -- 0:00:28
Average standard deviation of split frequencies: 0.008030
555500 -- [-226.649] (-225.714) (-229.103) (-228.335) * (-226.449) [-226.849] (-231.275) (-225.736) -- 0:00:28
556000 -- (-234.464) (-227.917) (-228.014) [-229.215] * (-228.784) [-227.184] (-228.228) (-228.974) -- 0:00:28
556500 -- (-228.270) [-227.392] (-227.006) (-229.266) * (-228.023) [-227.526] (-228.953) (-228.984) -- 0:00:28
557000 -- (-228.590) (-227.522) (-227.161) [-227.845] * (-227.015) (-228.784) (-227.746) [-228.608] -- 0:00:28
557500 -- [-226.641] (-227.341) (-227.105) (-226.628) * (-229.499) (-226.594) (-229.858) [-228.636] -- 0:00:28
558000 -- (-228.847) (-229.744) (-228.436) [-227.685] * (-227.916) (-229.756) (-226.739) [-228.311] -- 0:00:28
558500 -- (-228.382) [-231.719] (-228.435) (-227.234) * [-226.762] (-226.095) (-231.166) (-228.507) -- 0:00:28
559000 -- (-228.651) [-226.478] (-227.524) (-227.839) * (-225.983) [-225.695] (-226.588) (-227.896) -- 0:00:28
559500 -- (-225.940) [-227.608] (-226.173) (-226.047) * (-230.467) (-226.822) [-226.058] (-227.000) -- 0:00:28
560000 -- (-228.549) (-227.694) (-227.558) [-229.445] * [-228.174] (-226.272) (-228.822) (-226.498) -- 0:00:28
Average standard deviation of split frequencies: 0.007617
560500 -- (-227.371) [-229.768] (-227.388) (-230.107) * [-227.236] (-227.447) (-226.036) (-230.952) -- 0:00:28
561000 -- (-232.613) [-226.970] (-226.985) (-226.947) * (-226.440) (-233.907) [-226.742] (-228.786) -- 0:00:28
561500 -- (-226.956) (-228.726) [-231.228] (-229.402) * (-228.942) [-229.373] (-226.325) (-230.374) -- 0:00:28
562000 -- (-227.446) [-229.995] (-229.731) (-229.217) * (-227.299) [-226.751] (-226.783) (-226.899) -- 0:00:28
562500 -- [-226.884] (-227.785) (-230.931) (-230.608) * (-227.686) [-232.974] (-226.260) (-227.682) -- 0:00:28
563000 -- (-230.718) (-228.395) (-230.217) [-226.231] * (-227.120) [-229.586] (-225.883) (-225.572) -- 0:00:28
563500 -- (-228.593) (-228.723) (-232.774) [-232.219] * [-229.287] (-236.483) (-226.660) (-226.013) -- 0:00:28
564000 -- (-227.369) (-228.228) [-228.051] (-227.004) * [-227.982] (-226.351) (-227.345) (-225.849) -- 0:00:28
564500 -- (-227.397) [-226.361] (-226.821) (-228.249) * [-228.238] (-226.225) (-227.397) (-227.311) -- 0:00:28
565000 -- (-231.340) (-230.102) [-226.207] (-229.928) * (-229.278) (-228.421) [-228.746] (-225.777) -- 0:00:28
Average standard deviation of split frequencies: 0.007692
565500 -- (-227.046) [-226.715] (-226.561) (-230.917) * [-228.827] (-229.643) (-229.483) (-226.354) -- 0:00:28
566000 -- (-229.382) (-227.216) [-226.451] (-229.651) * [-227.750] (-226.740) (-226.506) (-225.677) -- 0:00:28
566500 -- [-226.322] (-228.263) (-228.764) (-228.360) * [-226.018] (-226.083) (-228.777) (-227.086) -- 0:00:28
567000 -- (-227.381) (-228.273) (-227.380) [-231.562] * (-227.718) (-226.843) (-231.819) [-227.940] -- 0:00:28
567500 -- (-228.286) (-228.771) (-229.768) [-228.404] * (-228.730) [-226.818] (-227.763) (-236.707) -- 0:00:28
568000 -- (-229.249) (-228.990) (-227.656) [-227.839] * (-229.512) (-232.343) (-229.317) [-226.622] -- 0:00:28
568500 -- (-226.364) (-226.502) [-226.013] (-229.522) * (-227.480) (-230.208) [-228.154] (-230.127) -- 0:00:28
569000 -- [-227.915] (-229.814) (-225.900) (-227.614) * (-226.529) [-229.142] (-227.275) (-232.319) -- 0:00:28
569500 -- (-227.398) (-225.967) (-225.880) [-228.837] * (-226.407) (-228.559) (-228.518) [-226.800] -- 0:00:27
570000 -- (-228.026) (-228.671) [-228.273] (-226.572) * (-227.845) (-227.325) (-228.504) [-225.853] -- 0:00:27
Average standard deviation of split frequencies: 0.007228
570500 -- (-235.071) (-226.926) [-226.124] (-227.024) * (-229.751) (-227.033) (-228.281) [-226.492] -- 0:00:27
571000 -- (-228.187) (-231.684) [-228.030] (-228.748) * (-231.022) (-227.918) (-227.520) [-226.518] -- 0:00:27
571500 -- (-226.326) (-231.579) (-228.782) [-228.539] * [-232.462] (-228.684) (-228.640) (-226.466) -- 0:00:27
572000 -- (-228.135) (-229.854) [-226.805] (-228.863) * (-226.686) [-226.074] (-225.789) (-227.302) -- 0:00:27
572500 -- [-231.507] (-226.720) (-226.355) (-228.512) * (-226.354) (-227.402) [-226.923] (-227.246) -- 0:00:27
573000 -- (-227.495) [-227.880] (-225.627) (-228.688) * [-226.699] (-228.786) (-226.998) (-227.776) -- 0:00:27
573500 -- (-227.886) [-226.959] (-226.083) (-233.526) * (-227.646) (-227.385) [-227.002] (-229.261) -- 0:00:27
574000 -- (-228.448) [-227.119] (-230.403) (-227.317) * (-226.917) (-227.387) [-228.764] (-229.098) -- 0:00:27
574500 -- [-229.222] (-228.386) (-226.390) (-229.882) * (-228.484) (-226.868) [-229.904] (-230.925) -- 0:00:28
575000 -- (-228.556) (-227.578) [-226.353] (-227.629) * [-228.494] (-226.422) (-226.812) (-228.463) -- 0:00:28
Average standard deviation of split frequencies: 0.007468
575500 -- (-226.272) [-225.631] (-231.133) (-229.189) * (-226.154) (-229.362) [-230.670] (-229.599) -- 0:00:28
576000 -- (-227.133) (-227.983) (-227.495) [-230.020] * (-226.193) (-232.458) (-228.605) [-227.694] -- 0:00:27
576500 -- (-226.427) [-228.650] (-227.789) (-228.626) * [-226.329] (-227.375) (-229.049) (-232.738) -- 0:00:27
577000 -- (-226.391) [-230.043] (-227.302) (-229.186) * [-228.715] (-227.535) (-227.599) (-226.573) -- 0:00:27
577500 -- (-228.358) (-230.343) [-226.935] (-229.661) * [-227.861] (-232.905) (-230.035) (-226.867) -- 0:00:27
578000 -- (-228.965) (-229.427) [-226.190] (-229.141) * (-227.533) (-228.728) [-228.954] (-225.833) -- 0:00:27
578500 -- [-227.250] (-226.380) (-226.732) (-227.088) * [-227.300] (-226.746) (-226.739) (-227.468) -- 0:00:27
579000 -- [-227.036] (-227.935) (-227.130) (-226.152) * (-227.076) (-226.750) [-226.819] (-228.889) -- 0:00:27
579500 -- [-228.439] (-226.855) (-228.050) (-227.601) * (-227.162) (-227.760) [-227.597] (-229.563) -- 0:00:27
580000 -- (-226.932) (-226.417) (-227.424) [-225.722] * [-226.305] (-240.331) (-227.103) (-227.232) -- 0:00:27
Average standard deviation of split frequencies: 0.007104
580500 -- [-226.956] (-226.831) (-228.268) (-227.072) * [-227.348] (-230.225) (-227.844) (-229.125) -- 0:00:27
581000 -- (-226.884) (-231.350) (-226.305) [-229.633] * (-227.048) (-229.337) (-228.191) [-226.657] -- 0:00:27
581500 -- [-229.535] (-233.076) (-231.361) (-227.227) * (-225.814) (-229.642) (-230.657) [-228.245] -- 0:00:27
582000 -- (-226.660) (-233.444) (-230.267) [-228.907] * (-227.607) [-232.272] (-228.450) (-232.609) -- 0:00:27
582500 -- (-230.472) [-226.643] (-226.850) (-228.430) * (-234.879) (-229.760) (-228.620) [-228.050] -- 0:00:27
583000 -- (-231.951) (-230.314) [-229.222] (-227.803) * (-226.597) (-226.294) (-230.346) [-226.419] -- 0:00:27
583500 -- (-228.745) [-228.777] (-229.659) (-228.199) * (-226.108) (-230.329) (-226.476) [-227.134] -- 0:00:27
584000 -- (-226.801) [-226.334] (-225.585) (-226.717) * (-229.676) (-228.211) [-228.321] (-228.570) -- 0:00:27
584500 -- (-228.632) (-225.955) (-228.070) [-227.318] * (-226.398) (-226.895) [-228.022] (-227.734) -- 0:00:27
585000 -- (-226.277) [-226.934] (-229.563) (-228.886) * (-226.881) [-227.623] (-228.917) (-228.887) -- 0:00:26
Average standard deviation of split frequencies: 0.006719
585500 -- (-228.298) (-227.331) (-229.494) [-227.206] * [-228.762] (-230.275) (-227.865) (-226.565) -- 0:00:26
586000 -- [-231.726] (-227.317) (-228.108) (-226.562) * (-226.933) (-228.634) (-226.098) [-226.689] -- 0:00:26
586500 -- (-227.592) (-226.058) (-227.782) [-226.190] * (-226.051) (-232.339) [-227.032] (-227.670) -- 0:00:26
587000 -- (-230.160) (-226.802) [-227.297] (-226.941) * (-227.346) (-228.566) (-228.189) [-227.036] -- 0:00:26
587500 -- (-227.498) (-230.868) [-227.862] (-227.640) * (-227.214) [-229.424] (-227.967) (-229.296) -- 0:00:26
588000 -- (-228.804) (-227.915) (-226.167) [-228.168] * (-226.727) (-226.962) (-230.441) [-226.193] -- 0:00:26
588500 -- (-228.696) (-227.994) [-226.820] (-226.997) * (-228.018) (-226.716) (-229.224) [-226.746] -- 0:00:26
589000 -- (-226.966) (-227.008) [-227.368] (-227.355) * (-230.568) [-227.585] (-228.619) (-229.341) -- 0:00:26
589500 -- [-227.333] (-228.616) (-227.842) (-227.232) * (-228.255) [-227.271] (-230.439) (-225.658) -- 0:00:27
590000 -- (-228.604) [-226.115] (-227.423) (-225.841) * [-230.050] (-227.437) (-229.844) (-227.407) -- 0:00:27
Average standard deviation of split frequencies: 0.008380
590500 -- (-230.163) (-230.112) [-225.810] (-227.682) * (-229.268) (-227.820) (-228.029) [-227.492] -- 0:00:27
591000 -- (-229.684) (-228.256) [-229.557] (-227.427) * (-229.300) [-228.096] (-229.058) (-226.025) -- 0:00:26
591500 -- (-228.459) (-227.588) [-226.756] (-228.099) * (-228.471) (-229.789) (-228.198) [-226.571] -- 0:00:26
592000 -- (-232.402) (-228.446) [-228.318] (-226.931) * [-227.801] (-228.162) (-228.130) (-233.772) -- 0:00:26
592500 -- (-228.596) [-228.417] (-232.981) (-227.696) * (-227.245) (-234.529) (-227.098) [-228.360] -- 0:00:26
593000 -- (-229.438) (-227.765) (-227.866) [-227.081] * (-228.182) [-229.722] (-230.528) (-228.614) -- 0:00:26
593500 -- [-226.721] (-230.700) (-226.269) (-230.202) * [-226.591] (-227.034) (-226.010) (-227.785) -- 0:00:26
594000 -- [-227.790] (-234.768) (-228.836) (-228.465) * (-226.643) [-227.679] (-227.329) (-228.474) -- 0:00:26
594500 -- (-227.344) (-234.747) [-226.071] (-232.068) * (-225.984) (-229.274) (-229.685) [-227.303] -- 0:00:26
595000 -- [-228.194] (-227.296) (-226.345) (-228.333) * (-227.118) [-228.969] (-233.938) (-227.580) -- 0:00:26
Average standard deviation of split frequencies: 0.009145
595500 -- [-231.157] (-227.754) (-226.591) (-232.816) * (-229.190) (-228.085) (-228.556) [-228.035] -- 0:00:26
596000 -- (-233.606) [-226.485] (-227.551) (-228.763) * (-231.956) (-226.565) (-226.462) [-227.351] -- 0:00:26
596500 -- (-229.876) [-226.216] (-227.684) (-228.704) * (-232.054) (-228.897) [-228.201] (-229.262) -- 0:00:26
597000 -- (-236.710) (-228.757) (-227.542) [-227.419] * [-229.010] (-227.559) (-228.404) (-229.221) -- 0:00:26
597500 -- (-226.924) (-231.590) [-226.425] (-228.014) * (-227.419) (-226.322) (-227.099) [-226.138] -- 0:00:26
598000 -- [-227.689] (-229.060) (-227.635) (-230.049) * (-227.361) [-226.061] (-226.950) (-230.953) -- 0:00:26
598500 -- (-227.630) [-229.233] (-227.183) (-226.324) * (-228.103) (-226.804) [-226.072] (-229.685) -- 0:00:26
599000 -- (-227.749) (-230.493) [-227.180] (-228.286) * (-227.442) (-226.346) [-226.276] (-230.012) -- 0:00:26
599500 -- (-228.026) [-227.776] (-226.117) (-226.248) * (-227.600) [-225.698] (-226.275) (-226.922) -- 0:00:26
600000 -- [-227.411] (-232.575) (-227.257) (-230.681) * (-227.058) [-228.043] (-226.486) (-226.685) -- 0:00:25
Average standard deviation of split frequencies: 0.008976
600500 -- (-226.897) (-229.023) [-227.400] (-228.525) * (-227.329) (-226.020) (-228.577) [-227.486] -- 0:00:25
601000 -- (-227.234) (-228.997) [-229.167] (-232.176) * [-226.656] (-226.614) (-226.785) (-226.530) -- 0:00:25
601500 -- (-232.649) (-227.807) (-232.994) [-226.987] * (-229.443) [-226.826] (-227.984) (-232.762) -- 0:00:25
602000 -- (-229.722) (-228.340) [-227.278] (-226.822) * (-228.007) (-226.789) [-226.673] (-226.879) -- 0:00:25
602500 -- (-227.897) (-227.312) (-226.450) [-226.282] * (-230.396) [-226.585] (-227.886) (-230.349) -- 0:00:25
603000 -- (-229.514) [-231.531] (-226.222) (-226.380) * (-228.892) [-227.174] (-232.144) (-228.521) -- 0:00:25
603500 -- (-226.067) (-230.662) [-227.413] (-227.449) * (-227.342) (-226.668) [-230.707] (-230.385) -- 0:00:25
604000 -- (-226.211) (-229.122) [-226.428] (-229.641) * (-226.628) (-232.140) (-231.687) [-229.812] -- 0:00:25
604500 -- [-228.274] (-227.140) (-229.682) (-226.421) * (-227.132) (-228.236) (-226.207) [-227.837] -- 0:00:25
605000 -- (-227.774) (-228.407) (-230.827) [-230.391] * (-227.004) (-229.513) (-227.598) [-226.995] -- 0:00:25
Average standard deviation of split frequencies: 0.008557
605500 -- (-226.667) (-227.410) [-227.322] (-226.341) * (-229.228) [-229.894] (-228.018) (-228.292) -- 0:00:25
606000 -- (-227.223) (-229.030) (-227.714) [-226.299] * [-227.238] (-227.927) (-228.504) (-227.659) -- 0:00:26
606500 -- (-226.078) [-228.130] (-226.474) (-225.825) * (-225.561) (-227.235) [-227.199] (-226.053) -- 0:00:25
607000 -- (-226.697) [-227.777] (-227.972) (-226.440) * (-225.896) (-226.960) [-226.533] (-226.489) -- 0:00:25
607500 -- (-227.678) (-226.867) (-225.672) [-225.984] * (-228.867) (-230.793) (-226.360) [-226.438] -- 0:00:25
608000 -- (-228.904) (-228.141) (-229.042) [-227.533] * (-228.752) (-227.563) (-228.152) [-225.948] -- 0:00:25
608500 -- (-227.784) (-227.256) (-227.256) [-227.998] * (-227.451) [-229.441] (-229.492) (-227.676) -- 0:00:25
609000 -- (-226.635) (-227.845) [-230.123] (-230.192) * (-227.077) [-228.812] (-231.229) (-229.030) -- 0:00:25
609500 -- (-226.483) (-231.102) [-228.018] (-227.778) * (-228.372) (-230.811) [-228.554] (-228.809) -- 0:00:25
610000 -- (-227.199) (-229.404) [-227.915] (-226.177) * (-228.278) (-226.067) [-228.062] (-231.584) -- 0:00:25
Average standard deviation of split frequencies: 0.008781
610500 -- [-230.845] (-227.910) (-228.602) (-227.004) * [-225.948] (-227.153) (-226.609) (-228.476) -- 0:00:25
611000 -- (-228.510) [-227.545] (-229.247) (-227.457) * (-227.833) [-228.256] (-228.518) (-226.993) -- 0:00:25
611500 -- (-227.391) [-227.081] (-227.456) (-227.992) * (-231.878) (-227.819) (-226.426) [-228.295] -- 0:00:25
612000 -- (-228.402) (-228.731) (-226.620) [-229.082] * (-234.658) (-226.726) (-226.171) [-226.857] -- 0:00:25
612500 -- [-226.262] (-228.739) (-226.963) (-227.045) * (-231.860) [-226.616] (-226.938) (-226.874) -- 0:00:25
613000 -- (-228.389) (-229.471) (-227.108) [-226.450] * (-226.848) (-226.400) [-229.934] (-227.287) -- 0:00:25
613500 -- (-227.861) (-228.462) [-227.660] (-225.735) * (-228.324) (-226.747) [-227.699] (-228.422) -- 0:00:25
614000 -- (-231.877) (-226.361) (-226.655) [-228.424] * (-234.125) (-228.702) [-228.269] (-227.144) -- 0:00:25
614500 -- (-227.743) [-226.454] (-226.217) (-226.684) * [-226.793] (-227.377) (-230.110) (-232.393) -- 0:00:25
615000 -- (-231.881) (-231.401) [-227.663] (-227.437) * (-227.511) [-225.898] (-230.691) (-226.928) -- 0:00:25
Average standard deviation of split frequencies: 0.009088
615500 -- (-233.316) [-228.817] (-230.360) (-229.213) * [-229.410] (-226.394) (-230.705) (-227.578) -- 0:00:24
616000 -- [-229.764] (-227.404) (-227.265) (-227.319) * (-227.434) (-228.816) [-231.683] (-232.280) -- 0:00:24
616500 -- (-226.799) (-226.588) (-229.414) [-226.533] * [-229.503] (-228.328) (-231.228) (-227.544) -- 0:00:24
617000 -- (-225.961) (-225.548) [-230.738] (-227.509) * (-226.553) (-226.918) [-227.932] (-227.589) -- 0:00:24
617500 -- (-228.401) [-226.573] (-233.417) (-227.966) * (-229.655) (-226.186) (-228.565) [-227.058] -- 0:00:24
618000 -- (-227.006) (-228.126) (-227.689) [-226.153] * (-227.555) (-228.692) [-229.674] (-226.661) -- 0:00:24
618500 -- (-228.828) [-225.760] (-230.328) (-227.212) * (-226.962) [-228.941] (-228.707) (-227.378) -- 0:00:24
619000 -- (-228.901) (-226.800) (-232.898) [-230.908] * (-227.642) (-229.573) (-228.364) [-226.996] -- 0:00:24
619500 -- (-227.586) (-226.748) [-226.491] (-226.203) * (-228.821) [-228.215] (-227.419) (-226.064) -- 0:00:24
620000 -- (-229.350) (-230.945) (-228.941) [-227.448] * [-226.225] (-230.516) (-227.165) (-225.804) -- 0:00:24
Average standard deviation of split frequencies: 0.009114
620500 -- (-228.864) (-226.869) [-228.109] (-227.446) * (-230.655) (-226.638) [-228.431] (-226.192) -- 0:00:25
621000 -- (-229.179) (-227.185) [-227.099] (-229.906) * (-229.607) [-226.149] (-228.325) (-226.442) -- 0:00:25
621500 -- (-227.947) [-226.233] (-226.111) (-227.828) * (-228.657) (-227.728) (-228.194) [-229.342] -- 0:00:24
622000 -- (-228.393) (-228.918) [-226.912] (-226.151) * (-229.708) (-229.133) [-230.008] (-226.378) -- 0:00:24
622500 -- [-226.043] (-228.982) (-226.627) (-226.530) * (-232.359) (-230.596) [-228.500] (-230.139) -- 0:00:24
623000 -- (-226.823) (-229.663) (-230.183) [-228.305] * (-226.234) [-230.790] (-227.882) (-229.161) -- 0:00:24
623500 -- (-226.735) (-229.659) (-228.639) [-228.770] * (-226.340) (-228.735) [-227.074] (-227.981) -- 0:00:24
624000 -- (-229.354) [-228.058] (-228.213) (-229.277) * (-227.233) (-233.053) [-228.112] (-230.415) -- 0:00:24
624500 -- [-229.642] (-231.203) (-228.462) (-226.578) * (-227.317) (-233.393) (-228.528) [-228.388] -- 0:00:24
625000 -- (-226.989) (-226.525) (-228.918) [-228.881] * (-226.262) (-227.634) (-231.488) [-230.322] -- 0:00:24
Average standard deviation of split frequencies: 0.008989
625500 -- (-227.367) [-228.153] (-231.620) (-233.863) * (-226.011) (-227.718) [-227.561] (-233.245) -- 0:00:24
626000 -- (-226.677) [-226.058] (-229.935) (-228.168) * [-226.823] (-227.902) (-227.057) (-226.570) -- 0:00:24
626500 -- (-227.329) (-225.672) [-226.995] (-226.918) * (-226.162) (-227.339) (-229.582) [-226.777] -- 0:00:24
627000 -- (-227.716) [-231.007] (-227.589) (-227.222) * [-227.028] (-227.827) (-226.765) (-228.502) -- 0:00:24
627500 -- (-230.416) [-229.946] (-228.727) (-227.803) * [-226.671] (-227.022) (-226.047) (-227.535) -- 0:00:24
628000 -- (-227.564) (-227.021) (-231.227) [-225.765] * (-228.296) (-227.522) [-228.924] (-228.662) -- 0:00:24
628500 -- [-229.903] (-226.145) (-234.349) (-225.777) * (-230.323) (-226.777) (-231.178) [-226.601] -- 0:00:24
629000 -- (-226.633) (-226.370) (-226.981) [-226.374] * (-229.849) [-228.141] (-232.817) (-227.289) -- 0:00:24
629500 -- (-227.557) (-234.139) (-227.067) [-228.124] * (-227.058) (-229.882) (-227.925) [-228.326] -- 0:00:24
630000 -- (-228.220) (-229.379) (-229.028) [-226.606] * [-226.068] (-229.622) (-232.441) (-225.738) -- 0:00:24
Average standard deviation of split frequencies: 0.009110
630500 -- [-226.180] (-229.387) (-226.491) (-231.214) * [-225.968] (-229.817) (-228.670) (-226.477) -- 0:00:24
631000 -- [-227.878] (-228.713) (-226.781) (-234.139) * [-227.057] (-226.438) (-228.085) (-229.645) -- 0:00:23
631500 -- [-229.574] (-228.359) (-228.507) (-229.666) * (-226.084) (-227.365) (-227.513) [-226.104] -- 0:00:23
632000 -- (-229.063) (-227.330) [-226.777] (-227.397) * (-228.936) (-226.735) (-228.715) [-228.272] -- 0:00:23
632500 -- (-228.448) (-229.086) (-228.565) [-225.519] * [-231.696] (-227.526) (-229.995) (-227.498) -- 0:00:23
633000 -- (-227.569) [-228.493] (-227.449) (-227.020) * [-232.603] (-230.203) (-227.352) (-226.438) -- 0:00:23
633500 -- (-228.816) [-233.279] (-226.051) (-226.713) * (-231.871) (-230.381) [-227.758] (-226.138) -- 0:00:24
634000 -- (-229.164) (-229.225) (-226.539) [-226.108] * (-231.869) (-226.498) (-226.405) [-226.308] -- 0:00:24
634500 -- (-228.600) (-230.649) [-226.809] (-230.344) * (-233.881) (-226.625) [-227.039] (-228.118) -- 0:00:24
635000 -- (-230.980) [-230.718] (-228.242) (-234.322) * (-234.204) (-228.215) (-228.736) [-229.449] -- 0:00:24
Average standard deviation of split frequencies: 0.009404
635500 -- (-226.513) [-229.072] (-227.649) (-233.145) * (-228.671) [-227.310] (-227.222) (-229.261) -- 0:00:24
636000 -- (-228.405) [-225.838] (-227.304) (-229.084) * (-232.369) (-230.656) (-227.497) [-227.401] -- 0:00:24
636500 -- (-228.426) (-228.217) (-230.652) [-230.592] * (-227.819) (-233.590) (-226.479) [-228.695] -- 0:00:23
637000 -- [-230.057] (-228.566) (-229.691) (-230.535) * (-231.150) [-227.522] (-226.958) (-232.761) -- 0:00:23
637500 -- (-227.255) (-229.894) (-226.010) [-226.174] * (-232.881) (-230.000) (-226.369) [-229.227] -- 0:00:23
638000 -- [-227.704] (-229.788) (-226.471) (-225.940) * (-229.579) (-230.510) (-232.987) [-227.627] -- 0:00:23
638500 -- [-226.251] (-229.640) (-227.186) (-225.952) * (-229.040) (-229.062) [-228.975] (-229.597) -- 0:00:23
639000 -- [-228.035] (-229.285) (-227.396) (-227.058) * (-228.351) (-229.254) (-230.107) [-230.373] -- 0:00:23
639500 -- [-229.472] (-228.784) (-228.880) (-228.610) * (-226.657) [-227.354] (-230.900) (-226.641) -- 0:00:23
640000 -- (-230.218) (-225.427) [-226.158] (-226.228) * (-228.469) (-229.918) [-225.769] (-228.250) -- 0:00:23
Average standard deviation of split frequencies: 0.009381
640500 -- (-228.441) (-228.416) (-228.211) [-228.030] * [-229.628] (-230.361) (-227.205) (-227.459) -- 0:00:23
641000 -- (-229.269) (-226.471) [-227.307] (-226.035) * (-231.811) [-227.060] (-226.517) (-228.503) -- 0:00:23
641500 -- (-230.039) [-226.835] (-230.192) (-225.928) * (-226.606) (-226.631) (-229.446) [-229.308] -- 0:00:23
642000 -- (-227.091) (-227.586) [-227.664] (-225.928) * (-226.050) (-227.303) (-225.685) [-227.477] -- 0:00:23
642500 -- (-228.742) [-229.707] (-229.026) (-228.253) * (-230.518) [-227.038] (-226.762) (-229.633) -- 0:00:23
643000 -- [-227.524] (-229.815) (-228.899) (-226.405) * (-229.622) (-226.757) [-228.476] (-228.741) -- 0:00:23
643500 -- (-226.988) (-231.038) (-231.743) [-227.924] * (-229.009) [-226.791] (-229.445) (-228.899) -- 0:00:23
644000 -- (-226.470) (-229.324) (-229.670) [-225.580] * (-227.451) (-227.517) (-229.618) [-226.590] -- 0:00:23
644500 -- [-227.332] (-226.381) (-227.895) (-228.130) * (-227.720) (-225.933) (-230.843) [-227.453] -- 0:00:23
645000 -- (-228.460) (-227.113) (-230.186) [-227.283] * (-226.067) (-226.451) (-225.871) [-230.059] -- 0:00:23
Average standard deviation of split frequencies: 0.008757
645500 -- (-229.354) (-231.475) (-228.082) [-226.497] * [-226.041] (-230.497) (-230.926) (-228.541) -- 0:00:23
646000 -- (-231.156) (-227.446) (-227.892) [-227.457] * (-227.172) (-227.574) (-237.019) [-228.854] -- 0:00:23
646500 -- (-228.940) (-232.852) (-227.700) [-227.276] * (-226.881) [-227.433] (-233.020) (-231.248) -- 0:00:23
647000 -- (-226.456) [-231.213] (-225.521) (-226.844) * (-229.531) (-227.304) [-230.660] (-233.811) -- 0:00:23
647500 -- [-225.495] (-227.088) (-226.126) (-231.996) * (-229.073) (-227.386) [-231.476] (-231.453) -- 0:00:23
648000 -- [-225.656] (-226.982) (-226.976) (-225.783) * (-227.577) (-226.353) (-232.768) [-229.088] -- 0:00:23
648500 -- [-227.041] (-229.170) (-229.493) (-226.395) * (-226.237) (-231.454) (-229.224) [-228.172] -- 0:00:23
649000 -- [-226.356] (-229.905) (-227.701) (-227.568) * (-228.672) (-228.840) (-235.898) [-226.137] -- 0:00:23
649500 -- (-230.235) [-227.841] (-227.491) (-228.750) * (-226.641) (-227.040) (-228.959) [-227.356] -- 0:00:23
650000 -- (-231.238) (-227.333) [-227.832] (-227.516) * (-226.071) (-227.575) (-228.598) [-227.772] -- 0:00:23
Average standard deviation of split frequencies: 0.008694
650500 -- [-227.764] (-229.262) (-227.560) (-225.708) * (-227.588) (-230.430) (-226.087) [-229.284] -- 0:00:23
651000 -- (-229.260) [-227.479] (-225.674) (-228.233) * (-227.847) (-229.443) (-227.479) [-229.509] -- 0:00:23
651500 -- [-228.024] (-227.435) (-226.908) (-228.812) * [-230.773] (-229.415) (-227.035) (-228.191) -- 0:00:23
652000 -- (-227.174) (-229.752) (-225.979) [-227.363] * (-229.423) [-227.069] (-227.475) (-228.406) -- 0:00:22
652500 -- [-225.659] (-227.862) (-227.022) (-230.396) * [-227.298] (-230.207) (-227.369) (-226.171) -- 0:00:22
653000 -- (-227.004) [-229.209] (-227.381) (-232.092) * [-226.158] (-227.979) (-230.122) (-228.750) -- 0:00:22
653500 -- (-228.266) (-232.838) [-226.412] (-230.209) * (-226.058) (-227.428) (-232.645) [-226.030] -- 0:00:22
654000 -- (-227.271) (-227.569) (-228.257) [-230.132] * (-228.398) [-228.344] (-228.316) (-226.606) -- 0:00:22
654500 -- (-229.016) (-231.039) [-226.307] (-226.072) * (-232.336) [-230.357] (-230.020) (-229.419) -- 0:00:22
655000 -- (-226.255) (-226.997) [-226.070] (-227.397) * (-229.523) (-231.335) [-227.668] (-230.045) -- 0:00:22
Average standard deviation of split frequencies: 0.007521
655500 -- (-229.787) [-227.283] (-229.867) (-226.118) * (-226.844) (-228.711) (-227.601) [-227.864] -- 0:00:22
656000 -- (-235.222) (-230.538) (-225.764) [-229.208] * (-227.187) [-228.453] (-229.668) (-226.893) -- 0:00:22
656500 -- [-230.110] (-225.897) (-229.892) (-229.100) * (-230.255) (-231.448) [-229.947] (-226.896) -- 0:00:22
657000 -- (-230.348) [-226.858] (-228.500) (-229.466) * [-227.696] (-226.001) (-228.699) (-226.472) -- 0:00:22
657500 -- [-226.346] (-225.976) (-230.438) (-227.310) * [-229.987] (-233.858) (-226.540) (-226.190) -- 0:00:22
658000 -- (-226.395) (-230.630) (-229.181) [-229.248] * [-230.162] (-229.316) (-226.540) (-226.614) -- 0:00:22
658500 -- (-226.354) [-229.181] (-231.450) (-227.583) * (-226.994) (-227.654) (-231.712) [-226.896] -- 0:00:22
659000 -- (-228.976) (-227.376) (-227.961) [-232.936] * (-229.684) (-227.058) (-226.434) [-226.423] -- 0:00:22
659500 -- (-228.816) (-226.963) [-230.812] (-235.074) * [-231.545] (-226.252) (-226.866) (-226.123) -- 0:00:22
660000 -- (-227.016) [-227.096] (-226.352) (-231.186) * (-229.545) [-228.081] (-230.156) (-227.123) -- 0:00:22
Average standard deviation of split frequencies: 0.007563
660500 -- (-227.816) (-227.721) [-230.744] (-231.106) * (-226.543) (-227.813) (-228.570) [-227.303] -- 0:00:22
661000 -- (-227.998) (-233.615) (-227.801) [-227.880] * (-230.738) (-227.438) (-226.184) [-229.008] -- 0:00:22
661500 -- [-226.734] (-227.279) (-228.772) (-231.765) * (-228.051) (-229.829) (-229.457) [-227.281] -- 0:00:22
662000 -- (-227.737) (-226.951) (-227.316) [-228.772] * (-225.710) (-226.191) (-227.550) [-226.395] -- 0:00:22
662500 -- (-229.910) (-225.916) [-229.057] (-226.256) * (-229.999) (-228.594) [-226.438] (-227.226) -- 0:00:22
663000 -- (-227.779) (-232.149) (-226.828) [-226.421] * (-227.109) (-225.903) [-227.584] (-229.339) -- 0:00:22
663500 -- (-228.135) [-226.868] (-226.763) (-227.338) * (-231.948) (-226.345) (-228.117) [-227.384] -- 0:00:22
664000 -- (-228.348) (-229.515) [-227.743] (-227.557) * (-227.246) (-227.455) (-226.509) [-227.322] -- 0:00:22
664500 -- (-226.410) (-233.548) [-227.872] (-226.191) * (-225.899) (-227.428) [-227.142] (-230.110) -- 0:00:22
665000 -- (-228.283) [-226.490] (-228.067) (-229.258) * (-226.575) (-231.951) [-227.500] (-232.044) -- 0:00:22
Average standard deviation of split frequencies: 0.007388
665500 -- (-231.293) (-225.727) [-230.524] (-227.024) * [-226.807] (-230.377) (-226.337) (-228.132) -- 0:00:22
666000 -- (-227.357) [-228.910] (-228.082) (-227.018) * (-227.577) (-226.654) (-229.702) [-227.917] -- 0:00:22
666500 -- (-226.099) (-226.690) (-226.827) [-232.089] * (-228.311) (-227.069) [-232.649] (-227.972) -- 0:00:22
667000 -- (-227.588) (-228.543) (-229.650) [-227.093] * (-227.449) (-227.702) (-226.134) [-227.947] -- 0:00:21
667500 -- [-228.428] (-230.840) (-228.672) (-229.585) * [-225.493] (-229.366) (-226.762) (-225.890) -- 0:00:21
668000 -- (-228.444) (-230.495) [-228.090] (-228.839) * (-229.610) (-230.167) (-226.357) [-226.169] -- 0:00:21
668500 -- (-227.414) (-228.948) (-232.415) [-227.773] * (-228.835) (-225.825) [-231.924] (-228.392) -- 0:00:21
669000 -- [-227.398] (-228.290) (-225.882) (-227.390) * (-227.329) [-227.777] (-225.887) (-230.940) -- 0:00:21
669500 -- (-227.328) [-228.171] (-226.229) (-227.084) * (-229.915) (-228.514) (-229.219) [-228.344] -- 0:00:21
670000 -- (-228.174) (-226.069) (-233.821) [-230.529] * (-226.475) (-227.218) [-228.999] (-226.715) -- 0:00:21
Average standard deviation of split frequencies: 0.007380
670500 -- (-227.348) [-227.003] (-226.438) (-228.482) * (-228.321) (-228.280) (-226.130) [-227.051] -- 0:00:21
671000 -- [-227.117] (-228.330) (-228.119) (-229.605) * (-234.174) [-229.639] (-227.917) (-229.614) -- 0:00:21
671500 -- (-226.463) (-230.494) (-231.073) [-226.747] * (-227.857) (-227.946) (-227.193) [-227.162] -- 0:00:21
672000 -- (-231.016) [-227.421] (-228.812) (-227.456) * (-231.336) [-226.754] (-227.278) (-233.868) -- 0:00:21
672500 -- (-227.375) [-228.912] (-229.268) (-231.003) * (-229.304) [-227.111] (-226.820) (-228.924) -- 0:00:21
673000 -- (-230.580) [-227.461] (-229.314) (-227.324) * (-227.894) (-228.138) [-227.567] (-228.437) -- 0:00:21
673500 -- (-231.174) (-229.881) [-226.386] (-227.154) * (-228.563) (-228.563) (-229.570) [-229.229] -- 0:00:21
674000 -- (-226.289) (-229.328) (-227.135) [-229.897] * (-227.334) (-230.411) (-226.719) [-227.461] -- 0:00:21
674500 -- (-226.844) [-226.227] (-228.724) (-229.155) * (-228.335) (-226.860) [-228.385] (-231.950) -- 0:00:21
675000 -- (-227.307) [-230.577] (-227.110) (-227.986) * (-229.881) (-229.321) [-228.920] (-225.886) -- 0:00:21
Average standard deviation of split frequencies: 0.007584
675500 -- (-227.798) (-227.472) [-228.177] (-230.148) * (-227.540) (-230.071) [-226.332] (-228.015) -- 0:00:21
676000 -- (-232.420) [-227.469] (-233.816) (-231.656) * [-227.776] (-229.996) (-228.622) (-228.112) -- 0:00:21
676500 -- (-229.232) [-227.529] (-229.092) (-229.009) * (-229.767) (-227.512) [-226.753] (-226.816) -- 0:00:21
677000 -- (-231.164) (-227.373) [-230.844] (-228.954) * (-230.703) (-226.272) [-228.112] (-226.318) -- 0:00:21
677500 -- (-230.668) (-226.567) (-227.199) [-227.485] * (-227.790) [-226.498] (-227.988) (-228.531) -- 0:00:21
678000 -- (-226.534) (-227.382) [-227.253] (-227.677) * (-227.415) (-230.325) [-226.138] (-230.967) -- 0:00:21
678500 -- (-231.476) (-227.939) (-225.992) [-226.626] * (-226.402) (-228.406) (-227.747) [-228.054] -- 0:00:21
679000 -- (-233.318) [-228.412] (-225.718) (-228.879) * (-227.397) (-227.695) (-227.014) [-228.651] -- 0:00:21
679500 -- [-226.585] (-228.262) (-229.404) (-226.966) * (-228.559) (-226.089) (-227.416) [-228.433] -- 0:00:21
680000 -- (-227.372) [-228.198] (-227.460) (-225.888) * (-227.337) [-225.976] (-228.398) (-227.022) -- 0:00:21
Average standard deviation of split frequencies: 0.007488
680500 -- [-225.950] (-226.150) (-226.754) (-227.239) * (-226.890) (-227.394) [-229.655] (-228.683) -- 0:00:21
681000 -- (-226.442) (-226.527) (-227.472) [-227.243] * (-228.391) [-227.143] (-228.866) (-227.578) -- 0:00:21
681500 -- (-227.077) (-230.471) [-226.689] (-228.332) * (-233.355) (-226.218) [-226.612] (-230.415) -- 0:00:21
682000 -- (-227.771) (-228.880) (-226.614) [-226.564] * (-228.290) (-227.102) (-227.370) [-228.747] -- 0:00:20
682500 -- (-233.904) (-228.962) [-228.485] (-226.988) * (-228.069) [-227.459] (-226.373) (-226.999) -- 0:00:20
683000 -- (-228.333) [-230.012] (-226.514) (-229.098) * [-227.073] (-228.879) (-227.023) (-227.449) -- 0:00:20
683500 -- (-227.162) (-227.890) [-225.538] (-229.977) * (-227.909) (-227.640) (-229.809) [-227.024] -- 0:00:20
684000 -- (-234.497) (-229.726) (-226.149) [-229.624] * (-226.485) [-230.059] (-230.927) (-226.964) -- 0:00:20
684500 -- (-227.049) (-229.178) (-227.760) [-229.400] * (-225.767) [-233.513] (-229.623) (-228.536) -- 0:00:20
685000 -- (-234.753) [-226.739] (-230.851) (-229.810) * (-227.625) (-227.952) (-227.452) [-228.093] -- 0:00:20
Average standard deviation of split frequencies: 0.007344
685500 -- (-230.439) (-228.314) [-231.205] (-227.461) * (-229.013) (-226.940) [-227.019] (-229.437) -- 0:00:20
686000 -- (-227.970) (-229.401) (-228.941) [-230.146] * (-227.060) (-232.542) (-227.843) [-226.962] -- 0:00:20
686500 -- (-233.604) (-232.645) (-227.509) [-227.256] * (-226.161) [-227.740] (-227.369) (-229.853) -- 0:00:20
687000 -- [-229.770] (-226.678) (-227.382) (-227.064) * (-226.158) (-227.004) [-228.850] (-225.993) -- 0:00:20
687500 -- (-227.205) (-229.305) (-232.473) [-230.659] * (-226.548) (-228.084) [-230.767] (-227.233) -- 0:00:20
688000 -- (-228.639) [-227.476] (-233.205) (-225.438) * [-226.942] (-231.472) (-229.429) (-231.731) -- 0:00:20
688500 -- (-229.475) [-229.141] (-228.669) (-226.898) * (-228.879) (-230.972) [-226.544] (-227.916) -- 0:00:20
689000 -- (-233.453) (-226.564) [-226.676] (-226.515) * [-226.817] (-227.485) (-231.274) (-227.201) -- 0:00:20
689500 -- (-233.007) (-225.552) [-226.289] (-227.251) * [-227.283] (-230.187) (-225.781) (-230.792) -- 0:00:20
690000 -- (-229.053) (-226.191) (-228.660) [-226.707] * (-230.863) (-228.325) [-228.398] (-226.544) -- 0:00:20
Average standard deviation of split frequencies: 0.007892
690500 -- [-229.058] (-226.258) (-226.920) (-228.140) * (-227.238) [-228.232] (-226.811) (-228.941) -- 0:00:20
691000 -- (-229.426) [-225.844] (-226.246) (-228.452) * [-227.838] (-227.997) (-227.193) (-231.492) -- 0:00:20
691500 -- (-231.308) (-228.814) [-226.967] (-226.429) * (-227.155) [-228.288] (-228.596) (-226.643) -- 0:00:20
692000 -- (-227.351) [-226.536] (-227.856) (-226.685) * (-232.163) [-228.161] (-228.798) (-228.548) -- 0:00:20
692500 -- (-229.371) [-226.552] (-226.554) (-228.849) * (-226.870) (-226.840) [-229.813] (-231.149) -- 0:00:20
693000 -- (-227.183) (-233.205) [-226.905] (-228.473) * [-227.422] (-226.383) (-230.980) (-229.321) -- 0:00:20
693500 -- [-229.161] (-230.941) (-227.065) (-228.116) * (-229.984) (-228.104) (-225.657) [-228.003] -- 0:00:20
694000 -- (-228.274) [-227.116] (-227.617) (-226.530) * (-227.153) (-227.102) (-230.840) [-228.327] -- 0:00:20
694500 -- (-228.936) (-226.182) (-232.566) [-226.156] * (-228.355) (-226.727) [-227.750] (-228.123) -- 0:00:20
695000 -- (-226.393) (-229.334) (-227.272) [-227.318] * (-226.736) (-228.073) [-227.028] (-229.106) -- 0:00:20
Average standard deviation of split frequencies: 0.007831
695500 -- [-225.899] (-229.691) (-226.534) (-226.331) * [-227.297] (-229.383) (-226.536) (-228.618) -- 0:00:20
696000 -- (-227.454) (-230.183) [-226.952] (-227.129) * [-230.736] (-228.168) (-227.758) (-227.844) -- 0:00:20
696500 -- [-227.090] (-227.162) (-226.924) (-229.263) * [-232.825] (-230.003) (-227.810) (-228.716) -- 0:00:20
697000 -- (-226.382) (-226.952) (-228.239) [-228.836] * (-227.820) (-230.240) (-227.350) [-233.878] -- 0:00:19
697500 -- (-229.284) (-229.030) [-227.593] (-227.392) * [-229.073] (-228.008) (-230.134) (-231.524) -- 0:00:19
698000 -- (-230.167) [-226.480] (-229.874) (-226.908) * (-226.711) [-225.835] (-233.611) (-227.697) -- 0:00:19
698500 -- (-232.736) (-230.157) [-227.241] (-225.928) * (-228.302) (-226.861) (-227.353) [-228.112] -- 0:00:19
699000 -- (-229.032) (-227.881) (-227.851) [-226.490] * (-226.107) (-228.775) [-226.448] (-230.838) -- 0:00:19
699500 -- (-230.870) [-229.244] (-226.169) (-228.773) * [-228.954] (-226.519) (-228.214) (-229.024) -- 0:00:19
700000 -- (-226.629) [-228.204] (-226.501) (-226.125) * [-229.186] (-226.271) (-234.161) (-229.234) -- 0:00:19
Average standard deviation of split frequencies: 0.008116
700500 -- [-227.300] (-228.879) (-227.059) (-231.499) * (-228.396) [-227.974] (-229.101) (-227.515) -- 0:00:19
701000 -- (-227.598) [-226.207] (-226.822) (-233.089) * (-227.206) (-226.690) [-227.474] (-229.252) -- 0:00:19
701500 -- [-227.085] (-228.204) (-228.162) (-229.536) * [-230.095] (-227.762) (-227.203) (-226.870) -- 0:00:19
702000 -- (-231.487) [-229.332] (-228.171) (-231.790) * (-227.731) (-226.864) (-231.095) [-230.041] -- 0:00:19
702500 -- (-230.325) (-226.665) (-228.129) [-228.599] * (-228.080) (-227.965) [-228.822] (-229.889) -- 0:00:19
703000 -- (-229.720) (-226.704) (-232.780) [-227.381] * [-227.099] (-229.713) (-226.916) (-229.962) -- 0:00:19
703500 -- (-227.776) [-228.820] (-228.809) (-226.711) * (-228.802) (-228.971) [-226.476] (-228.745) -- 0:00:19
704000 -- (-225.621) (-230.368) [-226.299] (-226.857) * [-227.179] (-229.052) (-226.760) (-228.658) -- 0:00:19
704500 -- (-227.493) (-232.905) [-225.653] (-228.706) * (-228.625) [-226.298] (-225.804) (-231.821) -- 0:00:19
705000 -- [-227.735] (-226.370) (-230.677) (-230.067) * [-229.884] (-226.004) (-226.970) (-226.101) -- 0:00:19
Average standard deviation of split frequencies: 0.008013
705500 -- [-227.724] (-225.866) (-231.089) (-229.785) * [-227.362] (-228.969) (-225.849) (-231.247) -- 0:00:19
706000 -- (-227.400) [-227.467] (-227.735) (-227.550) * (-227.291) (-228.626) (-226.742) [-229.355] -- 0:00:19
706500 -- (-226.816) [-227.378] (-226.999) (-226.183) * (-226.365) [-227.819] (-227.502) (-231.821) -- 0:00:19
707000 -- (-228.638) (-230.454) (-226.818) [-228.582] * (-229.709) (-228.859) [-227.226] (-230.964) -- 0:00:19
707500 -- (-228.103) (-229.233) [-227.926] (-229.640) * (-231.212) (-229.933) (-227.295) [-228.012] -- 0:00:19
708000 -- (-233.837) (-227.127) [-228.117] (-232.338) * (-226.888) (-226.048) [-227.427] (-231.387) -- 0:00:19
708500 -- (-233.433) [-227.392] (-226.805) (-228.253) * (-228.640) [-226.108] (-227.791) (-229.210) -- 0:00:19
709000 -- (-229.820) [-226.041] (-226.304) (-229.407) * (-228.367) [-229.831] (-226.750) (-227.410) -- 0:00:19
709500 -- (-229.848) (-228.104) [-227.569] (-228.356) * (-231.888) (-229.172) (-227.609) [-229.860] -- 0:00:19
710000 -- (-228.677) (-228.650) (-228.903) [-226.884] * (-229.765) [-230.068] (-231.276) (-228.121) -- 0:00:19
Average standard deviation of split frequencies: 0.008292
710500 -- (-228.846) [-228.177] (-229.468) (-229.971) * [-226.897] (-228.938) (-227.188) (-229.063) -- 0:00:19
711000 -- [-227.511] (-227.142) (-226.008) (-227.323) * (-227.789) (-228.929) (-226.469) [-227.914] -- 0:00:19
711500 -- (-227.541) [-227.804] (-226.220) (-227.076) * [-231.112] (-233.433) (-226.511) (-228.264) -- 0:00:19
712000 -- (-228.377) (-230.869) [-229.031] (-226.485) * (-226.501) (-233.466) (-230.626) [-229.832] -- 0:00:19
712500 -- (-232.582) [-228.438] (-228.719) (-227.217) * (-228.145) (-228.816) (-228.359) [-232.203] -- 0:00:18
713000 -- [-229.169] (-229.574) (-230.665) (-227.347) * (-230.773) (-226.377) (-227.645) [-227.147] -- 0:00:18
713500 -- (-227.989) [-227.915] (-226.850) (-227.503) * (-226.975) [-235.910] (-232.867) (-229.756) -- 0:00:18
714000 -- (-225.867) (-228.206) (-229.216) [-228.182] * [-227.548] (-226.923) (-235.289) (-227.820) -- 0:00:18
714500 -- (-228.569) [-229.524] (-229.840) (-228.888) * (-227.951) [-230.178] (-225.921) (-226.512) -- 0:00:18
715000 -- (-226.484) (-228.734) (-234.279) [-230.281] * (-226.761) (-227.311) (-226.896) [-228.060] -- 0:00:18
Average standard deviation of split frequencies: 0.008520
715500 -- [-228.854] (-228.314) (-228.586) (-230.143) * (-231.575) [-226.099] (-227.495) (-227.452) -- 0:00:18
716000 -- (-229.395) (-228.353) (-227.207) [-228.147] * [-230.074] (-227.126) (-229.899) (-231.197) -- 0:00:18
716500 -- (-225.997) (-231.465) (-225.924) [-227.052] * [-232.000] (-227.237) (-226.889) (-229.324) -- 0:00:18
717000 -- (-227.360) [-226.512] (-227.023) (-226.048) * (-227.061) [-227.815] (-229.884) (-232.070) -- 0:00:18
717500 -- (-228.246) (-226.783) [-228.518] (-230.366) * (-225.926) (-227.849) (-227.685) [-227.929] -- 0:00:18
718000 -- (-228.290) (-229.953) [-227.702] (-227.172) * (-228.039) [-227.958] (-228.140) (-229.727) -- 0:00:18
718500 -- (-230.765) (-229.540) (-227.033) [-226.695] * [-227.928] (-226.736) (-230.172) (-227.235) -- 0:00:18
719000 -- [-228.443] (-227.078) (-229.467) (-226.755) * [-227.971] (-232.554) (-227.792) (-228.855) -- 0:00:18
719500 -- [-226.547] (-227.543) (-227.077) (-226.549) * (-227.776) (-232.177) (-228.958) [-227.604] -- 0:00:18
720000 -- (-225.908) [-228.306] (-226.567) (-229.373) * [-226.598] (-231.359) (-227.809) (-228.235) -- 0:00:18
Average standard deviation of split frequencies: 0.009004
720500 -- [-229.937] (-226.914) (-225.945) (-227.998) * [-226.387] (-226.476) (-229.723) (-232.250) -- 0:00:18
721000 -- (-225.609) [-227.185] (-225.807) (-228.218) * (-230.360) (-228.447) (-227.282) [-227.601] -- 0:00:18
721500 -- (-226.255) (-227.414) (-228.081) [-228.713] * (-228.298) (-227.162) [-226.888] (-228.961) -- 0:00:18
722000 -- [-227.241] (-226.199) (-227.632) (-227.320) * (-227.616) [-227.137] (-229.005) (-228.289) -- 0:00:18
722500 -- (-226.142) [-228.403] (-225.899) (-228.348) * (-226.836) (-230.211) [-226.145] (-228.120) -- 0:00:18
723000 -- (-227.058) [-227.527] (-229.654) (-226.666) * (-226.536) (-235.743) [-227.230] (-228.895) -- 0:00:18
723500 -- (-227.613) [-229.150] (-228.810) (-226.614) * (-226.553) [-227.095] (-230.275) (-229.966) -- 0:00:18
724000 -- (-228.813) (-227.383) (-228.146) [-227.067] * (-227.369) [-226.614] (-226.964) (-227.287) -- 0:00:18
724500 -- (-227.120) [-227.192] (-226.505) (-227.052) * (-230.495) (-229.906) [-227.808] (-228.014) -- 0:00:18
725000 -- (-226.716) (-228.730) (-228.515) [-228.379] * (-229.483) (-227.990) [-230.614] (-226.311) -- 0:00:18
Average standard deviation of split frequencies: 0.008747
725500 -- (-226.673) (-226.563) [-227.639] (-229.326) * (-227.369) (-227.619) [-226.596] (-227.696) -- 0:00:18
726000 -- (-227.672) (-233.397) (-227.287) [-226.525] * (-227.040) (-228.451) (-227.370) [-226.775] -- 0:00:18
726500 -- (-226.686) (-228.272) [-228.463] (-226.948) * [-227.825] (-229.000) (-228.023) (-226.738) -- 0:00:18
727000 -- [-226.970] (-227.818) (-232.429) (-230.153) * [-226.473] (-229.835) (-228.891) (-228.471) -- 0:00:18
727500 -- (-227.014) [-232.114] (-226.968) (-229.290) * (-233.697) (-228.724) [-226.105] (-229.599) -- 0:00:17
728000 -- (-228.791) [-227.419] (-228.556) (-225.788) * (-231.860) (-227.052) [-227.335] (-226.888) -- 0:00:17
728500 -- [-226.630] (-227.124) (-230.561) (-226.996) * (-231.415) (-226.609) [-229.990] (-226.786) -- 0:00:17
729000 -- [-226.300] (-227.669) (-227.121) (-227.134) * [-229.907] (-228.526) (-226.275) (-228.782) -- 0:00:17
729500 -- [-230.315] (-227.457) (-231.301) (-228.146) * (-226.681) (-225.857) (-226.842) [-226.782] -- 0:00:17
730000 -- (-228.906) [-227.416] (-229.751) (-234.471) * [-227.042] (-227.879) (-231.021) (-229.710) -- 0:00:17
Average standard deviation of split frequencies: 0.008805
730500 -- (-227.760) (-227.924) [-226.961] (-226.994) * [-227.548] (-227.847) (-229.313) (-229.413) -- 0:00:17
731000 -- (-226.318) (-229.418) (-227.384) [-228.402] * (-227.093) (-226.020) [-228.301] (-227.304) -- 0:00:17
731500 -- (-227.118) (-228.743) (-229.558) [-230.732] * (-225.639) (-228.779) (-227.876) [-226.674] -- 0:00:17
732000 -- (-228.853) (-227.267) [-226.405] (-228.154) * (-229.506) [-226.486] (-230.682) (-228.697) -- 0:00:17
732500 -- [-230.655] (-230.659) (-227.206) (-226.623) * (-226.295) (-230.642) [-225.942] (-229.991) -- 0:00:17
733000 -- [-232.085] (-228.611) (-226.544) (-226.800) * (-226.544) [-226.383] (-230.025) (-227.006) -- 0:00:17
733500 -- [-229.631] (-227.292) (-231.905) (-226.558) * (-228.059) (-228.674) (-226.892) [-227.818] -- 0:00:17
734000 -- (-226.823) (-228.328) (-229.438) [-228.428] * [-227.456] (-227.551) (-230.303) (-232.492) -- 0:00:17
734500 -- (-229.963) (-226.399) (-228.106) [-226.681] * (-227.601) (-228.720) (-226.921) [-229.053] -- 0:00:17
735000 -- (-228.686) (-229.490) (-227.251) [-226.457] * (-228.265) (-227.681) (-231.920) [-227.345] -- 0:00:17
Average standard deviation of split frequencies: 0.009042
735500 -- (-229.114) [-228.992] (-228.299) (-229.475) * (-228.670) (-228.571) (-227.808) [-230.017] -- 0:00:17
736000 -- [-225.583] (-227.319) (-225.888) (-228.908) * (-234.178) (-227.024) (-225.947) [-226.382] -- 0:00:17
736500 -- (-226.892) [-226.776] (-226.472) (-227.201) * (-231.509) [-225.935] (-227.516) (-227.457) -- 0:00:17
737000 -- (-226.650) (-228.902) [-230.302] (-226.607) * [-229.757] (-227.389) (-226.252) (-227.924) -- 0:00:17
737500 -- (-229.546) (-229.187) [-228.122] (-228.384) * (-227.236) (-227.402) [-226.372] (-229.276) -- 0:00:17
738000 -- (-229.536) [-226.268] (-226.475) (-228.626) * (-226.149) (-232.447) (-226.663) [-229.273] -- 0:00:17
738500 -- (-227.322) (-229.362) (-227.711) [-226.305] * (-227.793) [-228.691] (-226.872) (-230.646) -- 0:00:16
739000 -- (-230.478) [-226.701] (-226.891) (-231.021) * (-226.570) (-228.544) (-228.564) [-226.478] -- 0:00:16
739500 -- [-227.461] (-227.939) (-225.900) (-228.821) * (-228.042) [-227.546] (-229.216) (-228.112) -- 0:00:17
740000 -- (-227.104) (-229.260) [-227.968] (-228.774) * [-228.717] (-233.554) (-227.179) (-227.490) -- 0:00:17
Average standard deviation of split frequencies: 0.008723
740500 -- (-226.224) (-229.119) (-226.525) [-229.407] * (-235.129) [-231.169] (-226.900) (-230.556) -- 0:00:17
741000 -- (-225.943) (-229.858) [-227.441] (-231.663) * (-229.224) [-227.580] (-226.848) (-227.063) -- 0:00:17
741500 -- (-226.444) (-228.657) (-225.891) [-229.238] * (-228.619) (-227.441) (-226.376) [-228.265] -- 0:00:17
742000 -- (-230.220) (-226.168) [-228.691] (-230.417) * [-229.593] (-230.375) (-229.498) (-232.507) -- 0:00:17
742500 -- [-229.289] (-226.713) (-226.631) (-228.187) * (-227.846) [-228.499] (-227.180) (-230.130) -- 0:00:16
743000 -- (-229.148) (-230.244) (-225.894) [-227.147] * (-228.058) [-225.959] (-227.669) (-230.705) -- 0:00:16
743500 -- [-227.759] (-228.257) (-227.659) (-230.004) * (-231.368) (-229.996) [-227.911] (-231.962) -- 0:00:16
744000 -- [-226.296] (-228.359) (-228.270) (-230.513) * [-228.316] (-226.123) (-226.772) (-228.091) -- 0:00:16
744500 -- (-229.401) (-226.463) [-227.757] (-227.979) * (-232.081) [-226.968] (-226.281) (-227.442) -- 0:00:16
745000 -- (-225.884) (-227.647) (-228.144) [-227.216] * [-229.913] (-229.376) (-226.193) (-227.725) -- 0:00:16
Average standard deviation of split frequencies: 0.009330
745500 -- (-230.207) (-226.959) [-228.750] (-226.474) * (-227.367) [-226.605] (-226.802) (-230.014) -- 0:00:16
746000 -- (-227.643) [-227.001] (-229.414) (-226.297) * (-228.441) (-226.280) (-228.219) [-227.717] -- 0:00:16
746500 -- (-227.189) [-226.710] (-228.560) (-229.273) * (-226.647) (-226.630) (-231.195) [-226.964] -- 0:00:16
747000 -- (-228.198) [-226.292] (-227.335) (-232.735) * (-226.707) [-227.768] (-227.335) (-232.785) -- 0:00:16
747500 -- (-228.749) (-227.423) (-231.115) [-227.803] * (-228.751) [-230.531] (-231.615) (-228.597) -- 0:00:16
748000 -- (-226.406) (-226.849) [-226.865] (-232.467) * (-229.436) (-226.859) (-227.343) [-225.669] -- 0:00:16
748500 -- (-226.136) (-231.923) [-227.847] (-232.312) * (-227.587) (-229.547) (-232.061) [-226.337] -- 0:00:16
749000 -- (-229.119) (-230.862) [-225.563] (-227.382) * (-227.488) [-225.656] (-228.922) (-226.979) -- 0:00:16
749500 -- [-226.630] (-227.603) (-234.173) (-226.981) * (-226.726) (-228.589) (-228.793) [-226.195] -- 0:00:16
750000 -- (-227.496) [-226.125] (-228.182) (-227.363) * (-227.325) [-226.800] (-232.880) (-225.739) -- 0:00:16
Average standard deviation of split frequencies: 0.008866
750500 -- (-233.270) [-227.540] (-227.134) (-228.819) * (-229.460) (-229.514) [-227.744] (-229.341) -- 0:00:16
751000 -- [-230.203] (-227.963) (-226.854) (-226.963) * (-229.137) (-228.354) (-227.341) [-227.878] -- 0:00:16
751500 -- [-232.264] (-228.621) (-226.382) (-226.536) * [-230.040] (-227.310) (-228.915) (-236.343) -- 0:00:16
752000 -- (-227.134) [-228.149] (-226.395) (-227.364) * [-228.412] (-228.645) (-227.548) (-226.721) -- 0:00:16
752500 -- (-229.645) (-232.048) (-226.410) [-227.098] * (-232.338) [-225.831] (-227.331) (-229.128) -- 0:00:16
753000 -- (-233.009) (-226.715) (-226.864) [-229.108] * (-227.480) (-226.865) [-231.213] (-228.540) -- 0:00:16
753500 -- (-228.707) (-233.823) (-227.129) [-226.691] * (-227.562) [-227.200] (-227.716) (-227.394) -- 0:00:16
754000 -- (-227.729) (-228.368) [-226.689] (-229.591) * (-228.642) [-227.385] (-227.028) (-227.625) -- 0:00:15
754500 -- [-227.568] (-230.748) (-231.394) (-226.757) * (-227.774) (-230.835) [-227.947] (-227.598) -- 0:00:15
755000 -- (-227.427) [-230.368] (-228.110) (-228.447) * (-227.280) (-231.399) (-227.045) [-226.644] -- 0:00:15
Average standard deviation of split frequencies: 0.007981
755500 -- [-227.255] (-227.011) (-225.545) (-231.029) * [-229.494] (-230.706) (-229.377) (-228.865) -- 0:00:16
756000 -- (-226.924) [-228.562] (-228.878) (-229.493) * [-227.909] (-228.458) (-229.805) (-231.148) -- 0:00:16
756500 -- (-227.587) (-227.015) (-228.159) [-228.968] * (-230.944) (-226.519) (-228.061) [-229.778] -- 0:00:16
757000 -- (-230.728) (-227.747) (-228.376) [-226.860] * [-231.024] (-228.857) (-230.958) (-227.329) -- 0:00:16
757500 -- (-231.325) (-229.033) [-226.740] (-228.742) * (-228.920) (-228.026) [-227.877] (-230.837) -- 0:00:16
758000 -- (-230.112) (-230.914) (-230.990) [-229.501] * [-227.110] (-227.823) (-227.772) (-227.962) -- 0:00:15
758500 -- (-228.161) [-227.761] (-227.503) (-229.980) * (-225.982) (-227.259) (-226.972) [-227.430] -- 0:00:15
759000 -- (-225.764) (-226.882) [-226.066] (-227.753) * (-226.281) (-228.298) (-229.631) [-229.376] -- 0:00:15
759500 -- [-226.550] (-225.711) (-227.369) (-226.595) * (-225.815) (-228.460) (-231.058) [-226.683] -- 0:00:15
760000 -- (-233.582) (-226.325) [-226.791] (-226.995) * (-227.502) [-227.025] (-234.141) (-227.748) -- 0:00:15
Average standard deviation of split frequencies: 0.008637
760500 -- (-228.826) (-226.840) (-225.954) [-227.175] * (-227.186) (-232.901) [-226.555] (-226.414) -- 0:00:15
761000 -- [-228.905] (-227.476) (-227.003) (-228.363) * [-226.712] (-229.271) (-227.725) (-231.371) -- 0:00:15
761500 -- (-227.766) (-228.334) [-228.535] (-227.198) * (-226.661) (-226.135) [-229.095] (-227.109) -- 0:00:15
762000 -- (-226.463) (-228.506) (-226.236) [-226.508] * [-230.820] (-226.164) (-232.705) (-227.194) -- 0:00:15
762500 -- [-227.909] (-227.450) (-228.037) (-226.236) * (-229.768) (-232.099) (-232.852) [-226.165] -- 0:00:15
763000 -- (-227.145) (-227.266) [-227.066] (-229.703) * (-231.587) (-226.435) (-232.696) [-228.673] -- 0:00:15
763500 -- [-227.603] (-226.038) (-228.451) (-233.303) * [-228.810] (-231.014) (-229.146) (-229.338) -- 0:00:15
764000 -- (-227.700) (-231.024) [-228.894] (-229.629) * (-226.923) [-231.144] (-228.509) (-227.907) -- 0:00:15
764500 -- [-230.259] (-229.198) (-231.378) (-226.732) * (-230.179) (-232.197) [-227.555] (-228.687) -- 0:00:15
765000 -- [-228.598] (-228.018) (-226.648) (-226.610) * (-226.728) (-228.927) (-226.560) [-229.060] -- 0:00:15
Average standard deviation of split frequencies: 0.008347
765500 -- [-227.305] (-227.101) (-227.694) (-227.780) * (-226.989) (-228.524) [-227.202] (-230.020) -- 0:00:15
766000 -- (-229.445) [-230.771] (-227.174) (-229.469) * (-226.039) (-231.966) (-230.715) [-228.787] -- 0:00:15
766500 -- (-230.190) (-227.203) (-229.483) [-226.481] * (-226.456) (-230.911) (-226.495) [-226.279] -- 0:00:15
767000 -- (-229.230) (-228.391) (-230.229) [-227.360] * (-226.709) [-228.200] (-227.305) (-229.147) -- 0:00:15
767500 -- [-227.979] (-229.379) (-229.163) (-228.099) * (-229.422) (-226.635) [-226.558] (-232.384) -- 0:00:15
768000 -- [-230.131] (-226.738) (-227.096) (-226.654) * (-228.214) (-227.574) [-227.412] (-228.180) -- 0:00:15
768500 -- [-228.987] (-227.039) (-226.840) (-229.097) * [-227.750] (-226.484) (-231.133) (-230.823) -- 0:00:15
769000 -- (-227.490) (-228.968) (-233.150) [-227.174] * [-228.299] (-227.444) (-226.690) (-230.281) -- 0:00:15
769500 -- (-226.805) [-226.249] (-230.916) (-227.327) * [-229.577] (-226.789) (-228.528) (-225.688) -- 0:00:14
770000 -- (-227.283) [-226.382] (-226.899) (-231.519) * (-228.098) [-225.903] (-227.608) (-226.928) -- 0:00:14
Average standard deviation of split frequencies: 0.008640
770500 -- (-231.055) [-229.095] (-229.425) (-231.213) * (-228.924) (-227.480) (-227.678) [-226.639] -- 0:00:14
771000 -- (-230.553) [-226.785] (-227.114) (-226.725) * [-232.837] (-226.937) (-228.172) (-228.110) -- 0:00:15
771500 -- (-227.336) (-225.939) (-228.179) [-228.804] * [-227.365] (-226.280) (-230.335) (-227.623) -- 0:00:15
772000 -- (-234.775) (-232.724) (-229.193) [-228.306] * (-231.066) (-226.175) [-230.146] (-227.082) -- 0:00:15
772500 -- (-227.498) (-228.438) (-226.497) [-226.249] * (-228.748) (-226.178) (-230.792) [-226.470] -- 0:00:15
773000 -- (-227.762) [-225.991] (-227.313) (-230.437) * (-229.266) (-226.650) [-230.424] (-227.253) -- 0:00:14
773500 -- (-229.366) (-231.876) [-225.749] (-228.429) * (-226.339) (-226.363) [-229.216] (-230.088) -- 0:00:14
774000 -- (-228.520) (-226.883) (-226.044) [-227.680] * (-225.868) (-228.454) (-227.539) [-227.337] -- 0:00:14
774500 -- (-230.649) (-227.566) [-227.433] (-227.662) * [-226.722] (-229.084) (-233.092) (-230.510) -- 0:00:14
775000 -- (-228.790) (-231.766) (-226.490) [-225.471] * (-227.303) (-227.727) (-227.366) [-227.124] -- 0:00:14
Average standard deviation of split frequencies: 0.008049
775500 -- (-229.377) [-227.120] (-226.277) (-229.047) * (-230.005) [-228.047] (-228.121) (-227.090) -- 0:00:14
776000 -- [-232.401] (-226.606) (-226.741) (-226.727) * (-226.441) [-228.133] (-228.486) (-225.721) -- 0:00:14
776500 -- [-229.767] (-229.126) (-228.690) (-228.686) * (-227.189) (-228.024) (-227.584) [-227.122] -- 0:00:14
777000 -- (-229.072) [-228.666] (-227.637) (-226.793) * (-228.748) (-228.088) [-228.718] (-227.243) -- 0:00:14
777500 -- (-227.283) (-227.573) (-230.857) [-227.299] * (-228.834) [-226.190] (-229.989) (-226.583) -- 0:00:14
778000 -- (-225.908) [-228.091] (-228.025) (-228.099) * (-228.367) [-226.194] (-227.329) (-230.869) -- 0:00:14
778500 -- [-226.544] (-229.853) (-234.705) (-227.737) * (-229.915) [-225.647] (-226.243) (-230.753) -- 0:00:14
779000 -- (-225.966) (-230.373) [-229.007] (-228.404) * (-227.032) [-226.403] (-229.125) (-230.103) -- 0:00:14
779500 -- [-227.518] (-229.524) (-228.216) (-226.705) * (-227.634) [-226.558] (-231.002) (-227.838) -- 0:00:14
780000 -- (-228.284) (-227.569) [-226.483] (-227.162) * (-228.789) (-226.515) [-226.958] (-228.599) -- 0:00:14
Average standard deviation of split frequencies: 0.007737
780500 -- (-228.499) (-226.957) [-226.742] (-230.030) * (-229.099) (-228.228) (-226.214) [-228.071] -- 0:00:14
781000 -- (-229.667) (-226.338) [-227.010] (-231.635) * [-226.135] (-229.922) (-226.511) (-227.745) -- 0:00:14
781500 -- (-231.884) [-229.228] (-228.688) (-226.813) * (-227.984) (-232.571) (-227.096) [-226.288] -- 0:00:14
782000 -- (-229.969) [-227.039] (-227.583) (-226.165) * (-232.032) (-234.615) (-232.073) [-226.470] -- 0:00:14
782500 -- (-228.798) [-227.199] (-227.384) (-227.868) * (-229.496) (-228.229) [-230.814] (-228.677) -- 0:00:14
783000 -- (-226.188) (-228.297) (-228.212) [-226.199] * [-229.742] (-228.777) (-226.227) (-231.250) -- 0:00:14
783500 -- (-226.317) (-228.657) (-227.558) [-228.029] * (-226.014) (-227.620) [-227.503] (-230.072) -- 0:00:14
784000 -- [-229.669] (-227.214) (-227.795) (-226.694) * (-228.129) (-230.509) (-231.819) [-227.197] -- 0:00:14
784500 -- [-228.219] (-228.999) (-227.223) (-226.951) * [-227.110] (-235.046) (-230.616) (-228.438) -- 0:00:14
785000 -- (-226.621) [-228.653] (-227.566) (-227.423) * [-226.913] (-230.442) (-228.708) (-229.515) -- 0:00:13
Average standard deviation of split frequencies: 0.007459
785500 -- (-234.362) [-232.655] (-228.178) (-226.080) * [-227.356] (-226.013) (-227.563) (-226.177) -- 0:00:14
786000 -- (-229.831) (-226.668) (-227.489) [-225.955] * (-227.275) (-227.367) (-227.730) [-226.675] -- 0:00:14
786500 -- (-227.417) (-225.805) [-229.974] (-228.370) * (-227.695) (-226.032) (-232.218) [-225.991] -- 0:00:14
787000 -- (-229.305) (-225.955) (-227.179) [-227.901] * [-225.980] (-227.494) (-229.914) (-228.479) -- 0:00:14
787500 -- (-229.145) [-226.797] (-228.309) (-229.557) * (-226.572) (-226.561) (-226.789) [-226.864] -- 0:00:14
788000 -- [-231.550] (-229.107) (-229.479) (-226.268) * [-227.681] (-228.900) (-232.980) (-231.499) -- 0:00:13
788500 -- (-230.751) (-225.835) [-227.884] (-228.043) * (-226.789) (-228.510) [-229.960] (-231.541) -- 0:00:13
789000 -- (-229.089) (-225.655) (-227.236) [-227.151] * (-228.803) (-227.169) (-234.694) [-226.764] -- 0:00:13
789500 -- [-226.537] (-225.907) (-229.176) (-226.872) * (-226.713) (-229.530) (-226.978) [-229.254] -- 0:00:13
790000 -- (-229.000) (-227.341) [-226.209] (-229.467) * (-230.525) [-226.930] (-227.295) (-227.146) -- 0:00:13
Average standard deviation of split frequencies: 0.007229
790500 -- [-227.470] (-232.021) (-228.099) (-229.586) * (-226.565) [-228.010] (-227.014) (-228.531) -- 0:00:13
791000 -- (-230.262) [-230.954] (-226.561) (-227.085) * [-226.804] (-228.706) (-228.723) (-228.391) -- 0:00:13
791500 -- (-228.182) [-228.834] (-232.385) (-227.805) * [-226.578] (-229.551) (-228.239) (-229.700) -- 0:00:13
792000 -- (-227.574) (-227.240) (-232.996) [-225.749] * (-226.459) [-226.341] (-230.822) (-230.874) -- 0:00:13
792500 -- (-227.018) [-230.977] (-233.117) (-229.672) * (-226.912) (-226.907) [-229.384] (-228.500) -- 0:00:13
793000 -- [-227.224] (-228.218) (-231.183) (-226.914) * (-227.735) [-228.427] (-228.253) (-230.172) -- 0:00:13
793500 -- [-230.566] (-227.561) (-228.718) (-227.706) * (-226.750) [-226.196] (-231.999) (-235.023) -- 0:00:13
794000 -- (-226.550) (-233.345) (-228.693) [-228.163] * (-232.239) (-225.805) (-227.481) [-227.629] -- 0:00:13
794500 -- [-228.754] (-227.849) (-230.466) (-225.764) * (-228.986) (-231.076) (-230.915) [-227.046] -- 0:00:13
795000 -- (-229.154) (-226.386) [-228.788] (-226.348) * (-226.891) (-226.312) [-226.804] (-230.022) -- 0:00:13
Average standard deviation of split frequencies: 0.006810
795500 -- (-227.973) (-227.074) [-228.315] (-227.748) * [-229.069] (-226.269) (-231.762) (-226.196) -- 0:00:13
796000 -- (-229.803) (-227.344) (-231.864) [-230.515] * [-225.808] (-230.041) (-233.095) (-226.633) -- 0:00:13
796500 -- (-230.797) (-228.234) [-229.834] (-231.891) * (-225.858) (-232.257) (-226.771) [-227.184] -- 0:00:13
797000 -- (-231.011) [-226.208] (-229.308) (-229.328) * (-229.311) (-229.206) [-226.004] (-226.566) -- 0:00:13
797500 -- [-226.091] (-226.764) (-226.282) (-228.472) * (-226.461) [-233.491] (-226.705) (-226.659) -- 0:00:13
798000 -- (-230.261) [-226.625] (-226.752) (-227.458) * (-227.059) (-231.254) [-226.213] (-228.242) -- 0:00:13
798500 -- (-228.137) [-228.337] (-228.260) (-225.825) * (-226.233) [-228.634] (-225.875) (-227.076) -- 0:00:13
799000 -- (-229.332) (-228.287) (-228.623) [-226.870] * (-226.919) (-228.772) (-231.778) [-226.809] -- 0:00:13
799500 -- [-228.821] (-227.099) (-230.267) (-225.517) * (-228.777) [-228.817] (-228.871) (-226.632) -- 0:00:13
800000 -- [-229.091] (-226.868) (-228.878) (-226.666) * (-226.861) (-233.510) (-228.569) [-226.653] -- 0:00:12
Average standard deviation of split frequencies: 0.007139
800500 -- (-229.994) (-226.068) (-228.580) [-226.490] * (-227.418) [-227.507] (-227.401) (-227.053) -- 0:00:13
801000 -- (-226.627) [-226.198] (-227.748) (-228.393) * (-230.486) [-228.323] (-227.620) (-229.059) -- 0:00:13
801500 -- (-226.101) (-228.517) (-230.520) [-226.874] * (-227.303) (-227.822) (-227.333) [-227.551] -- 0:00:13
802000 -- [-227.291] (-226.336) (-234.355) (-226.291) * (-226.613) (-226.678) [-231.114] (-227.518) -- 0:00:13
802500 -- [-226.718] (-227.784) (-231.414) (-228.241) * (-227.763) (-228.311) [-231.635] (-230.291) -- 0:00:13
803000 -- [-228.047] (-227.433) (-226.841) (-235.289) * (-227.998) [-226.915] (-226.696) (-226.410) -- 0:00:13
803500 -- [-229.201] (-229.625) (-228.910) (-232.884) * (-226.438) [-227.989] (-227.593) (-225.949) -- 0:00:12
804000 -- (-231.727) [-229.876] (-228.560) (-234.050) * (-229.704) (-226.668) (-228.175) [-226.458] -- 0:00:12
804500 -- (-228.641) [-228.256] (-225.710) (-229.303) * (-226.948) (-226.960) (-230.595) [-227.129] -- 0:00:12
805000 -- (-230.346) (-226.292) (-226.305) [-225.568] * (-227.083) [-228.425] (-227.843) (-226.997) -- 0:00:12
Average standard deviation of split frequencies: 0.007092
805500 -- (-230.322) (-228.159) [-226.363] (-225.512) * (-229.175) (-227.022) [-228.182] (-230.772) -- 0:00:12
806000 -- [-227.122] (-227.551) (-228.754) (-227.029) * [-229.546] (-230.856) (-228.143) (-234.992) -- 0:00:12
806500 -- (-228.446) (-226.752) [-227.938] (-226.923) * (-230.417) [-227.732] (-231.666) (-230.295) -- 0:00:12
807000 -- (-226.282) [-227.904] (-226.045) (-227.657) * [-229.565] (-227.372) (-235.156) (-232.025) -- 0:00:12
807500 -- [-225.853] (-226.766) (-227.278) (-227.602) * [-228.990] (-229.463) (-227.698) (-229.314) -- 0:00:12
808000 -- (-229.083) (-226.139) (-228.111) [-229.252] * (-227.840) [-227.894] (-228.648) (-229.406) -- 0:00:12
808500 -- (-227.881) (-231.490) [-229.309] (-226.387) * (-227.687) (-226.775) [-225.600] (-228.267) -- 0:00:12
809000 -- (-229.121) (-227.036) [-227.943] (-226.089) * (-226.559) [-226.095] (-227.436) (-226.309) -- 0:00:12
809500 -- (-231.827) (-226.809) (-226.279) [-226.206] * (-229.694) [-227.162] (-226.303) (-228.597) -- 0:00:12
810000 -- (-230.305) (-226.009) [-226.409] (-226.983) * [-228.123] (-228.431) (-227.122) (-226.415) -- 0:00:12
Average standard deviation of split frequencies: 0.007123
810500 -- (-228.225) (-232.391) [-227.598] (-227.454) * [-228.999] (-228.013) (-227.410) (-227.988) -- 0:00:12
811000 -- [-225.926] (-230.036) (-228.525) (-231.452) * (-227.807) (-228.041) (-227.812) [-229.104] -- 0:00:12
811500 -- [-227.477] (-232.463) (-228.069) (-229.549) * (-225.848) (-226.397) [-226.691] (-227.937) -- 0:00:12
812000 -- (-228.219) [-226.486] (-228.370) (-231.236) * (-226.380) (-227.480) [-226.505] (-226.414) -- 0:00:12
812500 -- (-226.653) (-228.312) (-229.454) [-228.149] * [-227.657] (-236.019) (-227.170) (-226.381) -- 0:00:12
813000 -- (-231.027) (-231.336) (-228.144) [-227.384] * (-230.950) [-227.265] (-228.070) (-226.992) -- 0:00:12
813500 -- (-231.436) (-231.584) (-227.401) [-227.951] * (-228.864) (-228.368) [-227.273] (-228.419) -- 0:00:12
814000 -- (-228.014) (-228.573) (-227.572) [-226.985] * (-225.908) [-228.966] (-228.708) (-234.328) -- 0:00:12
814500 -- (-228.225) (-233.315) (-227.083) [-231.178] * [-227.965] (-228.351) (-228.888) (-230.519) -- 0:00:12
815000 -- (-227.674) [-226.275] (-226.154) (-226.780) * (-226.399) (-230.222) (-228.675) [-231.453] -- 0:00:12
Average standard deviation of split frequencies: 0.006969
815500 -- (-227.223) [-227.323] (-226.242) (-228.188) * (-228.065) [-227.275] (-226.137) (-230.895) -- 0:00:11
816000 -- (-226.588) [-228.588] (-226.248) (-232.183) * (-225.875) [-226.369] (-233.237) (-229.766) -- 0:00:11
816500 -- (-226.155) (-228.646) [-225.774] (-227.250) * (-226.478) (-227.200) [-226.286] (-236.406) -- 0:00:12
817000 -- (-230.275) [-226.586] (-226.105) (-226.721) * [-227.165] (-229.909) (-227.706) (-235.629) -- 0:00:12
817500 -- [-226.875] (-227.024) (-226.488) (-227.884) * [-227.395] (-230.325) (-226.822) (-228.816) -- 0:00:12
818000 -- (-227.477) (-225.815) (-227.656) [-228.434] * [-227.547] (-230.095) (-228.140) (-228.551) -- 0:00:12
818500 -- [-227.853] (-228.017) (-228.652) (-229.979) * (-230.260) (-231.025) (-226.766) [-226.811] -- 0:00:11
819000 -- (-231.414) (-226.883) (-228.509) [-229.624] * (-227.072) (-227.983) [-227.704] (-227.175) -- 0:00:11
819500 -- (-226.823) (-227.072) (-227.380) [-226.900] * (-232.671) (-226.630) (-227.863) [-226.660] -- 0:00:11
820000 -- (-226.910) (-228.979) [-229.821] (-226.486) * [-228.040] (-227.551) (-230.610) (-227.410) -- 0:00:11
Average standard deviation of split frequencies: 0.006857
820500 -- [-226.340] (-231.024) (-228.665) (-229.887) * [-228.002] (-228.416) (-227.374) (-226.563) -- 0:00:11
821000 -- (-228.124) [-232.835] (-228.716) (-225.726) * (-229.145) [-229.134] (-229.015) (-230.762) -- 0:00:11
821500 -- (-233.435) (-230.374) (-231.036) [-226.228] * (-227.363) [-226.977] (-226.867) (-227.862) -- 0:00:11
822000 -- [-227.867] (-228.182) (-228.376) (-227.892) * (-226.303) (-235.406) (-226.815) [-226.918] -- 0:00:11
822500 -- (-227.747) (-229.606) [-227.137] (-226.330) * [-226.779] (-227.188) (-229.829) (-227.596) -- 0:00:11
823000 -- (-226.096) [-227.339] (-231.883) (-235.065) * (-225.743) [-227.022] (-226.718) (-229.257) -- 0:00:11
823500 -- (-228.964) [-227.462] (-228.013) (-227.890) * (-227.108) [-228.194] (-226.572) (-230.351) -- 0:00:11
824000 -- (-230.493) (-227.590) (-230.146) [-227.310] * (-225.794) (-226.117) (-228.738) [-227.366] -- 0:00:11
824500 -- (-230.126) (-230.122) [-228.631] (-227.139) * (-226.392) (-227.879) (-227.812) [-227.047] -- 0:00:11
825000 -- (-228.261) (-226.447) (-231.788) [-226.116] * (-227.038) (-229.953) (-229.415) [-226.402] -- 0:00:11
Average standard deviation of split frequencies: 0.007241
825500 -- (-230.232) [-231.732] (-229.860) (-227.182) * (-227.303) [-226.268] (-230.400) (-226.661) -- 0:00:11
826000 -- (-234.254) (-231.896) [-228.971] (-230.125) * (-226.274) [-228.837] (-233.739) (-229.181) -- 0:00:11
826500 -- (-229.638) [-231.860] (-227.617) (-229.203) * (-227.533) (-227.772) (-230.343) [-226.080] -- 0:00:11
827000 -- (-227.550) [-228.536] (-229.050) (-228.367) * [-228.679] (-229.642) (-228.435) (-226.535) -- 0:00:11
827500 -- [-226.557] (-228.389) (-228.954) (-228.194) * [-227.607] (-226.699) (-227.408) (-226.872) -- 0:00:11
828000 -- (-228.899) (-232.815) (-229.938) [-226.680] * (-226.314) (-230.019) (-228.885) [-227.708] -- 0:00:11
828500 -- (-228.490) [-232.520] (-229.657) (-229.643) * [-226.046] (-225.845) (-228.306) (-230.187) -- 0:00:11
829000 -- [-227.601] (-227.598) (-226.091) (-228.445) * (-228.409) (-227.067) (-228.472) [-227.085] -- 0:00:11
829500 -- (-226.523) (-231.668) (-227.517) [-229.282] * [-227.833] (-228.815) (-227.399) (-226.241) -- 0:00:11
830000 -- (-233.926) [-227.400] (-228.668) (-226.724) * (-229.135) (-227.988) [-227.417] (-229.272) -- 0:00:11
Average standard deviation of split frequencies: 0.006739
830500 -- (-225.527) (-227.613) [-226.637] (-227.581) * (-229.546) (-226.195) (-230.416) [-226.938] -- 0:00:11
831000 -- (-227.655) [-226.868] (-228.514) (-228.609) * (-226.523) (-227.849) (-226.947) [-229.203] -- 0:00:10
831500 -- (-232.836) (-228.116) [-227.659] (-229.640) * (-228.225) (-229.164) [-226.686] (-230.510) -- 0:00:11
832000 -- (-226.630) (-227.635) (-226.139) [-227.570] * (-231.450) [-225.648] (-232.574) (-229.866) -- 0:00:11
832500 -- (-230.636) (-228.395) (-226.149) [-227.198] * (-230.886) (-226.496) [-228.891] (-226.510) -- 0:00:11
833000 -- (-229.372) (-230.040) [-228.862] (-226.936) * (-229.830) (-229.889) (-228.351) [-227.555] -- 0:00:11
833500 -- (-230.733) (-230.925) [-227.446] (-225.798) * (-227.213) [-228.052] (-230.884) (-227.209) -- 0:00:10
834000 -- (-231.177) (-225.949) (-227.208) [-228.321] * (-225.907) (-229.375) [-228.687] (-231.119) -- 0:00:10
834500 -- (-227.921) [-226.631] (-230.200) (-227.253) * [-227.926] (-228.787) (-235.898) (-229.393) -- 0:00:10
835000 -- [-230.337] (-227.636) (-228.716) (-227.204) * (-227.563) (-230.948) [-227.626] (-229.465) -- 0:00:10
Average standard deviation of split frequencies: 0.006090
835500 -- (-231.630) (-228.703) [-228.860] (-227.627) * (-228.129) (-227.492) [-227.794] (-228.630) -- 0:00:10
836000 -- (-228.534) (-228.020) (-228.925) [-227.174] * (-227.754) (-231.412) (-229.438) [-233.269] -- 0:00:10
836500 -- (-231.898) (-228.948) [-228.724] (-229.336) * (-227.120) (-226.199) [-226.650] (-227.085) -- 0:00:10
837000 -- (-228.984) [-228.864] (-229.161) (-232.374) * (-227.298) (-230.259) (-227.490) [-226.948] -- 0:00:10
837500 -- (-226.529) (-232.527) (-227.593) [-227.310] * (-230.477) (-227.214) (-226.396) [-227.551] -- 0:00:10
838000 -- (-226.220) (-231.862) (-230.960) [-228.774] * [-227.143] (-228.504) (-225.966) (-226.376) -- 0:00:10
838500 -- (-226.932) (-230.439) [-228.685] (-229.077) * [-226.488] (-231.180) (-226.305) (-226.685) -- 0:00:10
839000 -- [-229.678] (-228.483) (-232.388) (-225.624) * (-227.807) [-227.466] (-227.670) (-225.858) -- 0:00:10
839500 -- [-228.144] (-227.318) (-226.555) (-230.299) * (-228.886) (-227.109) (-227.087) [-226.111] -- 0:00:10
840000 -- (-227.998) [-226.586] (-227.849) (-226.706) * (-228.013) (-226.701) (-226.749) [-226.596] -- 0:00:10
Average standard deviation of split frequencies: 0.006093
840500 -- (-227.561) [-227.666] (-226.917) (-227.251) * (-226.913) (-226.067) (-226.626) [-227.076] -- 0:00:10
841000 -- (-226.963) (-230.169) (-228.178) [-230.404] * (-232.701) (-227.702) (-235.509) [-227.870] -- 0:00:10
841500 -- [-228.112] (-229.681) (-228.885) (-227.273) * (-228.190) [-226.427] (-226.975) (-227.918) -- 0:00:10
842000 -- [-226.449] (-228.418) (-227.374) (-229.345) * (-230.910) (-226.771) (-226.510) [-228.168] -- 0:00:10
842500 -- (-225.923) (-226.555) (-228.339) [-229.855] * (-228.844) (-228.076) [-226.754] (-229.529) -- 0:00:10
843000 -- (-228.228) [-229.467] (-227.733) (-230.837) * [-227.857] (-228.173) (-226.792) (-227.783) -- 0:00:10
843500 -- (-228.912) (-227.945) [-228.201] (-227.525) * (-227.450) [-227.667] (-227.811) (-232.556) -- 0:00:10
844000 -- (-228.965) (-228.884) (-228.291) [-226.279] * [-227.227] (-228.918) (-227.014) (-229.719) -- 0:00:10
844500 -- [-227.966] (-227.681) (-227.443) (-227.123) * [-226.402] (-227.388) (-228.039) (-226.433) -- 0:00:10
845000 -- (-227.092) (-226.966) (-228.427) [-227.174] * (-227.638) (-227.296) [-230.301] (-233.870) -- 0:00:10
Average standard deviation of split frequencies: 0.006512
845500 -- (-229.557) (-227.829) [-227.430] (-228.226) * (-228.651) (-227.498) (-230.524) [-227.347] -- 0:00:10
846000 -- [-227.236] (-231.059) (-230.175) (-229.407) * (-228.760) [-228.968] (-230.524) (-230.626) -- 0:00:10
846500 -- [-229.236] (-228.662) (-228.671) (-228.651) * [-232.131] (-226.933) (-227.006) (-230.621) -- 0:00:09
847000 -- [-227.781] (-228.717) (-226.117) (-226.788) * [-228.660] (-227.630) (-231.283) (-227.445) -- 0:00:10
847500 -- (-229.640) (-228.372) (-229.285) [-229.203] * [-228.152] (-227.292) (-226.808) (-226.129) -- 0:00:10
848000 -- (-230.133) (-232.589) [-229.415] (-227.692) * (-225.859) [-226.171] (-229.755) (-227.279) -- 0:00:10
848500 -- [-227.355] (-227.031) (-226.043) (-227.345) * [-226.921] (-225.942) (-229.119) (-229.336) -- 0:00:09
849000 -- (-229.374) [-227.889] (-227.969) (-226.702) * (-226.350) [-227.309] (-229.923) (-227.743) -- 0:00:09
849500 -- (-226.340) (-228.394) (-237.489) [-227.454] * (-228.407) (-226.658) (-231.335) [-227.766] -- 0:00:09
850000 -- (-229.795) [-227.560] (-242.162) (-227.481) * [-227.832] (-229.953) (-227.326) (-228.596) -- 0:00:09
Average standard deviation of split frequencies: 0.006685
850500 -- (-228.192) (-225.901) [-227.731] (-231.057) * [-228.362] (-226.975) (-227.180) (-228.966) -- 0:00:09
851000 -- (-226.406) (-229.857) [-226.837] (-226.868) * (-228.850) [-226.438] (-226.164) (-230.016) -- 0:00:09
851500 -- (-227.292) (-226.886) [-227.550] (-228.231) * (-226.228) (-226.440) [-230.661] (-228.000) -- 0:00:09
852000 -- [-226.978] (-232.451) (-232.707) (-233.199) * [-226.560] (-226.672) (-226.319) (-229.847) -- 0:00:09
852500 -- (-225.643) [-227.865] (-229.856) (-230.524) * (-233.889) (-228.353) [-226.690] (-226.796) -- 0:00:09
853000 -- (-227.382) (-230.055) (-228.075) [-227.254] * (-233.812) (-228.959) [-227.042] (-228.062) -- 0:00:09
853500 -- (-233.885) (-227.752) [-226.843] (-229.085) * [-228.492] (-226.861) (-229.508) (-226.622) -- 0:00:09
854000 -- (-228.050) (-231.400) (-228.053) [-226.240] * (-227.103) (-227.166) [-226.560] (-226.880) -- 0:00:09
854500 -- (-228.970) (-225.878) [-227.117] (-232.301) * [-226.273] (-227.736) (-228.649) (-228.220) -- 0:00:09
855000 -- (-226.128) (-226.408) [-228.291] (-228.065) * [-226.064] (-226.817) (-225.865) (-226.563) -- 0:00:09
Average standard deviation of split frequencies: 0.006608
855500 -- (-227.192) [-228.297] (-227.924) (-230.259) * (-226.596) (-227.101) [-227.823] (-230.412) -- 0:00:09
856000 -- [-226.250] (-227.456) (-226.813) (-227.669) * (-226.411) (-227.040) [-228.067] (-227.722) -- 0:00:09
856500 -- [-226.924] (-227.883) (-229.085) (-228.772) * (-227.735) (-227.073) (-230.607) [-230.804] -- 0:00:09
857000 -- [-227.506] (-225.878) (-230.786) (-227.139) * (-227.067) [-226.699] (-229.851) (-226.446) -- 0:00:09
857500 -- [-226.541] (-228.080) (-228.027) (-226.714) * (-227.151) (-227.464) (-228.811) [-228.057] -- 0:00:09
858000 -- (-231.496) [-226.525] (-231.205) (-229.950) * (-228.474) (-225.784) (-229.856) [-227.204] -- 0:00:09
858500 -- (-229.029) (-227.013) [-227.374] (-229.222) * (-228.125) (-226.108) (-226.508) [-227.765] -- 0:00:09
859000 -- (-228.352) (-228.762) [-226.395] (-234.341) * (-227.942) (-227.075) [-225.568] (-228.718) -- 0:00:09
859500 -- [-228.165] (-230.392) (-226.393) (-226.463) * [-227.359] (-230.064) (-226.624) (-227.236) -- 0:00:09
860000 -- [-228.343] (-227.848) (-226.358) (-227.365) * (-227.172) (-228.845) (-228.555) [-228.246] -- 0:00:09
Average standard deviation of split frequencies: 0.006317
860500 -- (-228.731) (-226.142) [-226.414] (-226.395) * (-227.967) (-230.683) [-227.415] (-227.177) -- 0:00:09
861000 -- (-227.704) (-229.772) (-226.268) [-227.687] * (-234.750) (-228.330) (-225.780) [-226.806] -- 0:00:09
861500 -- [-228.945] (-227.138) (-227.160) (-229.628) * (-233.043) [-228.400] (-231.022) (-230.113) -- 0:00:09
862000 -- (-231.288) (-227.344) [-226.101] (-226.388) * (-227.978) (-229.881) [-229.176] (-226.865) -- 0:00:09
862500 -- (-227.184) (-228.367) [-231.493] (-227.295) * [-225.946] (-230.272) (-229.592) (-231.019) -- 0:00:09
863000 -- [-228.041] (-226.083) (-228.645) (-227.599) * (-226.754) (-227.806) [-228.057] (-229.796) -- 0:00:09
863500 -- (-227.669) [-227.487] (-227.598) (-226.825) * [-227.985] (-226.983) (-231.408) (-227.983) -- 0:00:09
864000 -- (-226.394) (-231.037) [-226.010] (-225.880) * [-226.162] (-226.929) (-231.439) (-226.997) -- 0:00:08
864500 -- (-228.210) (-230.308) [-227.413] (-228.794) * (-225.955) (-227.685) [-227.044] (-227.792) -- 0:00:08
865000 -- (-227.154) (-227.307) (-229.165) [-228.186] * (-232.188) [-227.298] (-227.108) (-228.350) -- 0:00:08
Average standard deviation of split frequencies: 0.005879
865500 -- (-230.622) [-226.468] (-229.729) (-227.813) * (-231.051) (-228.892) [-226.495] (-228.113) -- 0:00:08
866000 -- (-233.128) [-228.193] (-227.593) (-230.972) * [-229.290] (-229.348) (-228.979) (-228.372) -- 0:00:08
866500 -- [-227.721] (-228.232) (-228.498) (-228.402) * [-225.738] (-231.014) (-228.346) (-231.291) -- 0:00:08
867000 -- (-227.309) (-226.081) (-228.012) [-226.672] * (-227.615) (-228.158) (-226.120) [-228.463] -- 0:00:08
867500 -- [-227.254] (-230.059) (-226.454) (-227.874) * [-230.673] (-226.852) (-231.080) (-230.910) -- 0:00:08
868000 -- (-226.931) (-225.752) [-228.955] (-229.399) * (-229.770) [-228.027] (-227.218) (-227.733) -- 0:00:08
868500 -- [-226.571] (-232.215) (-227.493) (-226.756) * [-228.240] (-226.070) (-227.397) (-227.179) -- 0:00:08
869000 -- (-226.913) (-232.001) [-228.478] (-230.220) * [-229.067] (-229.616) (-227.998) (-227.104) -- 0:00:08
869500 -- (-230.088) (-230.359) [-226.631] (-231.703) * (-228.099) (-228.307) (-229.861) [-226.177] -- 0:00:08
870000 -- (-231.159) (-227.065) [-226.365] (-230.295) * (-227.950) (-234.665) (-229.204) [-227.401] -- 0:00:08
Average standard deviation of split frequencies: 0.005739
870500 -- [-228.404] (-227.835) (-228.993) (-227.921) * (-226.763) [-227.915] (-227.754) (-231.571) -- 0:00:08
871000 -- (-227.302) (-228.555) (-231.859) [-228.469] * (-226.511) [-231.610] (-226.541) (-229.552) -- 0:00:08
871500 -- (-228.111) (-229.408) (-231.738) [-232.184] * (-230.497) (-228.603) [-229.363] (-229.824) -- 0:00:08
872000 -- (-227.611) [-227.180] (-228.046) (-228.206) * (-231.185) [-229.177] (-229.170) (-230.169) -- 0:00:08
872500 -- (-231.596) (-226.281) (-231.765) [-227.302] * (-228.001) (-228.098) (-228.413) [-227.121] -- 0:00:08
873000 -- (-229.166) (-226.261) (-225.814) [-228.293] * [-226.493] (-226.348) (-228.994) (-227.626) -- 0:00:08
873500 -- (-229.330) (-227.461) (-229.287) [-229.987] * [-227.352] (-227.777) (-228.348) (-227.498) -- 0:00:08
874000 -- (-228.783) (-228.062) [-227.338] (-233.818) * (-230.881) [-229.820] (-230.631) (-227.289) -- 0:00:08
874500 -- (-228.076) (-226.536) (-226.514) [-233.661] * (-228.606) (-228.872) (-226.000) [-226.230] -- 0:00:08
875000 -- (-230.714) [-232.185] (-227.349) (-230.208) * (-227.940) (-231.117) (-231.686) [-228.671] -- 0:00:08
Average standard deviation of split frequencies: 0.005884
875500 -- (-226.541) (-229.972) [-227.949] (-231.788) * (-228.179) [-225.636] (-227.868) (-228.116) -- 0:00:08
876000 -- (-230.494) [-226.931] (-231.136) (-225.612) * (-237.016) [-227.705] (-227.607) (-229.720) -- 0:00:08
876500 -- [-227.596] (-226.755) (-227.423) (-227.123) * (-227.472) (-227.407) [-227.988] (-228.733) -- 0:00:08
877000 -- (-228.948) [-226.726] (-226.098) (-231.773) * (-229.233) [-229.143] (-230.873) (-227.043) -- 0:00:08
877500 -- [-229.374] (-226.927) (-227.085) (-232.817) * (-225.848) [-228.035] (-231.929) (-228.746) -- 0:00:08
878000 -- (-229.173) [-227.782] (-230.020) (-228.492) * [-225.840] (-226.071) (-227.287) (-227.365) -- 0:00:08
878500 -- (-227.505) (-228.631) [-225.985] (-227.166) * [-227.096] (-228.179) (-233.606) (-228.680) -- 0:00:08
879000 -- [-225.880] (-228.956) (-230.303) (-228.195) * [-227.179] (-230.106) (-229.027) (-228.189) -- 0:00:07
879500 -- (-226.418) (-227.161) [-229.149] (-227.946) * (-226.789) [-232.787] (-226.110) (-228.645) -- 0:00:07
880000 -- (-226.297) [-226.846] (-229.777) (-229.510) * (-227.724) [-229.710] (-226.557) (-231.812) -- 0:00:07
Average standard deviation of split frequencies: 0.006290
880500 -- [-229.809] (-229.565) (-230.729) (-235.119) * (-229.853) (-229.249) [-230.194] (-227.457) -- 0:00:07
881000 -- (-226.679) (-230.759) (-229.289) [-226.239] * [-227.405] (-226.416) (-226.842) (-227.379) -- 0:00:07
881500 -- (-228.013) (-227.795) [-227.625] (-226.480) * (-226.713) (-227.174) [-228.234] (-227.235) -- 0:00:07
882000 -- (-229.236) (-228.704) [-227.188] (-227.094) * [-226.473] (-226.515) (-232.384) (-230.485) -- 0:00:07
882500 -- [-226.872] (-226.999) (-227.074) (-226.695) * (-228.812) [-228.775] (-232.243) (-228.088) -- 0:00:07
883000 -- (-229.163) (-229.111) [-226.206] (-229.988) * (-231.835) [-230.654] (-228.358) (-227.390) -- 0:00:07
883500 -- (-233.605) (-227.907) (-229.396) [-227.982] * (-227.797) (-226.701) (-228.389) [-228.170] -- 0:00:07
884000 -- (-230.398) (-225.945) (-231.005) [-226.970] * (-231.485) (-225.756) [-226.509] (-226.998) -- 0:00:07
884500 -- (-227.833) [-226.297] (-231.934) (-226.905) * [-229.758] (-227.418) (-229.605) (-228.297) -- 0:00:07
885000 -- (-228.089) [-225.948] (-230.525) (-226.931) * (-227.265) (-230.002) (-227.205) [-230.085] -- 0:00:07
Average standard deviation of split frequencies: 0.006551
885500 -- (-230.776) (-226.602) (-228.418) [-226.656] * (-226.298) [-231.829] (-227.142) (-228.032) -- 0:00:07
886000 -- (-231.574) [-227.980] (-232.411) (-225.942) * [-229.105] (-229.567) (-226.273) (-228.886) -- 0:00:07
886500 -- (-227.065) (-226.859) [-231.878] (-225.714) * [-229.528] (-231.319) (-229.518) (-228.721) -- 0:00:07
887000 -- (-227.603) (-226.833) (-227.812) [-226.435] * (-228.535) [-227.238] (-227.808) (-229.397) -- 0:00:07
887500 -- (-226.325) (-231.586) [-227.627] (-230.502) * (-226.796) [-226.504] (-227.492) (-226.765) -- 0:00:07
888000 -- (-226.929) [-227.923] (-227.805) (-229.212) * (-230.018) (-226.496) [-226.655] (-226.751) -- 0:00:07
888500 -- [-227.296] (-231.509) (-227.296) (-226.704) * (-231.117) [-226.620] (-225.985) (-226.051) -- 0:00:07
889000 -- (-235.299) (-226.909) (-228.539) [-229.808] * (-226.136) (-227.415) (-226.358) [-228.766] -- 0:00:07
889500 -- (-232.445) (-227.047) [-229.288] (-231.592) * (-226.304) [-235.754] (-226.171) (-228.936) -- 0:00:07
890000 -- [-229.783] (-227.375) (-226.728) (-229.490) * (-227.860) (-227.072) (-226.909) [-232.493] -- 0:00:07
Average standard deviation of split frequencies: 0.006682
890500 -- (-227.205) [-230.917] (-226.255) (-227.044) * [-228.864] (-228.037) (-228.178) (-226.843) -- 0:00:07
891000 -- (-228.714) (-236.914) (-226.852) [-227.708] * (-230.853) (-228.436) (-227.376) [-228.231] -- 0:00:07
891500 -- (-226.478) (-226.801) [-227.681] (-230.042) * (-233.033) (-230.775) (-226.442) [-227.887] -- 0:00:07
892000 -- (-227.684) (-230.856) (-228.963) [-228.459] * [-227.340] (-227.709) (-229.405) (-227.702) -- 0:00:07
892500 -- (-228.124) (-228.977) [-226.418] (-227.570) * [-229.060] (-227.652) (-226.649) (-229.512) -- 0:00:07
893000 -- (-227.342) (-229.014) [-226.558] (-227.218) * (-230.250) [-227.886] (-228.859) (-226.619) -- 0:00:07
893500 -- [-228.582] (-225.805) (-233.465) (-231.247) * (-227.140) (-228.643) (-226.187) [-227.712] -- 0:00:07
894000 -- (-229.616) [-225.890] (-236.739) (-229.885) * (-227.960) (-226.482) [-226.556] (-229.595) -- 0:00:06
894500 -- (-229.829) [-226.680] (-226.326) (-229.558) * (-226.777) (-228.270) [-226.508] (-232.681) -- 0:00:06
895000 -- (-232.562) [-231.345] (-227.013) (-229.009) * [-231.537] (-228.170) (-228.892) (-235.548) -- 0:00:06
Average standard deviation of split frequencies: 0.006905
895500 -- [-232.128] (-227.731) (-225.924) (-228.647) * (-226.925) [-230.545] (-228.741) (-228.334) -- 0:00:06
896000 -- (-226.992) (-228.118) (-225.719) [-228.890] * [-230.400] (-226.480) (-228.421) (-226.273) -- 0:00:06
896500 -- (-226.880) (-232.673) [-225.770] (-230.803) * [-228.609] (-228.648) (-230.357) (-226.413) -- 0:00:06
897000 -- (-229.336) (-229.534) (-225.811) [-228.728] * [-229.099] (-229.900) (-228.416) (-229.333) -- 0:00:06
897500 -- (-226.226) [-230.720] (-227.737) (-228.095) * (-227.558) (-226.876) (-227.974) [-227.984] -- 0:00:06
898000 -- (-229.370) (-230.755) (-228.404) [-228.917] * (-228.036) [-226.753] (-230.259) (-225.805) -- 0:00:06
898500 -- [-227.166] (-231.336) (-226.856) (-232.178) * (-232.492) (-227.038) [-226.649] (-228.735) -- 0:00:06
899000 -- (-227.077) (-229.748) [-226.828] (-227.076) * (-227.506) [-226.807] (-228.099) (-228.245) -- 0:00:06
899500 -- (-228.336) (-233.584) [-226.283] (-227.451) * (-230.952) (-229.116) (-227.749) [-227.031] -- 0:00:06
900000 -- [-226.799] (-230.685) (-228.370) (-229.452) * (-228.058) (-226.054) (-226.546) [-228.792] -- 0:00:06
Average standard deviation of split frequencies: 0.006968
900500 -- (-225.990) (-226.172) [-227.845] (-227.905) * [-227.119] (-228.638) (-226.625) (-228.705) -- 0:00:06
901000 -- (-226.825) (-225.648) (-227.791) [-226.675] * [-228.463] (-228.957) (-228.003) (-230.096) -- 0:00:06
901500 -- [-229.078] (-227.863) (-230.260) (-226.652) * [-227.606] (-228.208) (-228.028) (-226.835) -- 0:00:06
902000 -- (-227.205) (-226.844) [-231.207] (-233.858) * (-228.302) (-228.098) (-230.678) [-229.070] -- 0:00:06
902500 -- [-226.577] (-227.005) (-228.689) (-234.220) * (-228.801) (-234.445) [-229.553] (-228.107) -- 0:00:06
903000 -- (-231.233) [-227.436] (-232.203) (-226.151) * (-228.050) [-231.470] (-227.875) (-226.315) -- 0:00:06
903500 -- (-236.944) (-229.049) (-227.224) [-227.624] * (-233.377) (-227.618) (-232.255) [-225.687] -- 0:00:06
904000 -- (-230.818) (-227.883) (-227.043) [-226.738] * (-228.008) (-226.776) (-226.302) [-228.209] -- 0:00:06
904500 -- [-227.172] (-228.574) (-226.141) (-230.616) * (-227.249) [-228.074] (-227.705) (-226.967) -- 0:00:06
905000 -- (-227.842) (-226.657) (-226.748) [-229.894] * (-226.930) [-227.293] (-235.427) (-229.315) -- 0:00:06
Average standard deviation of split frequencies: 0.006829
905500 -- (-227.472) [-226.818] (-228.591) (-230.091) * (-226.270) [-226.679] (-228.136) (-229.924) -- 0:00:06
906000 -- (-231.028) (-227.382) (-228.520) [-231.380] * (-228.911) (-230.332) [-226.582] (-228.389) -- 0:00:06
906500 -- [-225.777] (-228.286) (-227.086) (-230.393) * (-230.416) (-228.030) [-226.818] (-226.735) -- 0:00:06
907000 -- [-229.185] (-229.472) (-229.557) (-227.860) * (-227.093) (-227.819) [-228.829] (-228.289) -- 0:00:06
907500 -- (-227.050) (-227.393) [-228.010] (-226.448) * (-228.228) [-229.409] (-227.453) (-228.981) -- 0:00:06
908000 -- (-230.909) [-226.771] (-227.615) (-228.832) * [-226.137] (-229.597) (-228.555) (-230.201) -- 0:00:06
908500 -- (-226.548) (-227.002) [-229.127] (-226.922) * (-225.765) (-227.089) (-226.595) [-228.045] -- 0:00:06
909000 -- (-227.625) (-227.849) [-226.887] (-227.783) * (-228.611) [-229.399] (-226.044) (-231.287) -- 0:00:06
909500 -- [-226.764] (-226.393) (-229.985) (-225.662) * [-227.054] (-227.355) (-226.692) (-229.041) -- 0:00:05
910000 -- (-229.007) (-225.878) (-227.559) [-228.004] * (-231.160) [-226.474] (-226.235) (-229.388) -- 0:00:05
Average standard deviation of split frequencies: 0.007150
910500 -- (-230.248) (-227.476) (-227.625) [-227.224] * (-234.021) [-229.277] (-226.858) (-228.306) -- 0:00:05
911000 -- (-228.229) (-229.797) (-227.568) [-227.092] * (-230.005) [-226.144] (-230.749) (-230.580) -- 0:00:05
911500 -- (-227.311) (-227.255) [-230.598] (-231.359) * [-228.872] (-226.351) (-225.701) (-226.997) -- 0:00:05
912000 -- (-227.572) (-227.619) [-230.439] (-228.290) * (-226.096) (-227.548) [-229.440] (-227.045) -- 0:00:05
912500 -- (-226.429) (-227.109) [-228.741] (-228.985) * [-228.756] (-228.973) (-228.611) (-228.802) -- 0:00:05
913000 -- (-229.149) (-228.933) (-229.219) [-227.275] * (-227.584) [-228.651] (-229.294) (-227.617) -- 0:00:05
913500 -- (-229.824) (-228.449) [-230.864] (-228.679) * [-228.134] (-228.169) (-228.468) (-228.566) -- 0:00:05
914000 -- (-228.401) [-228.343] (-229.181) (-228.205) * (-227.021) (-229.799) (-227.658) [-230.303] -- 0:00:05
914500 -- [-227.183] (-230.160) (-227.294) (-227.556) * (-226.920) (-227.160) [-226.558] (-230.474) -- 0:00:05
915000 -- [-227.110] (-227.099) (-230.513) (-228.120) * (-227.133) (-227.192) (-225.997) [-226.804] -- 0:00:05
Average standard deviation of split frequencies: 0.007301
915500 -- (-229.042) [-230.908] (-231.268) (-228.852) * (-229.564) [-226.249] (-227.057) (-231.061) -- 0:00:05
916000 -- (-228.687) (-230.101) (-229.304) [-225.725] * (-228.804) (-229.177) (-231.821) [-228.324] -- 0:00:05
916500 -- (-225.790) (-230.120) (-229.152) [-230.195] * (-227.330) [-227.305] (-229.577) (-227.266) -- 0:00:05
917000 -- [-228.946] (-227.949) (-229.134) (-227.365) * [-227.283] (-225.717) (-227.323) (-227.944) -- 0:00:05
917500 -- (-228.869) (-227.817) (-226.931) [-229.141] * (-228.857) (-227.525) [-227.407] (-234.273) -- 0:00:05
918000 -- (-229.455) (-230.313) (-227.390) [-229.680] * (-230.402) [-228.538] (-227.605) (-229.406) -- 0:00:05
918500 -- (-226.790) (-230.832) [-226.422] (-227.886) * (-228.443) (-226.715) (-228.535) [-230.730] -- 0:00:05
919000 -- (-229.167) (-225.689) [-229.399] (-228.815) * (-226.441) [-231.777] (-228.299) (-228.402) -- 0:00:05
919500 -- (-227.293) [-226.795] (-229.794) (-227.036) * [-227.298] (-225.978) (-227.190) (-227.682) -- 0:00:05
920000 -- (-227.649) [-228.081] (-228.540) (-226.631) * [-226.923] (-227.291) (-229.095) (-227.551) -- 0:00:05
Average standard deviation of split frequencies: 0.007328
920500 -- (-227.305) [-228.193] (-229.044) (-226.701) * (-228.272) [-226.777] (-229.604) (-227.646) -- 0:00:05
921000 -- (-226.454) [-226.283] (-230.350) (-228.766) * (-226.056) (-228.589) (-226.884) [-228.695] -- 0:00:05
921500 -- (-227.566) [-229.309] (-226.191) (-228.041) * (-231.823) (-227.402) (-226.106) [-227.549] -- 0:00:05
922000 -- [-226.431] (-227.239) (-229.287) (-231.315) * (-229.899) [-227.290] (-226.770) (-231.024) -- 0:00:05
922500 -- [-230.104] (-227.273) (-229.329) (-227.158) * (-227.286) (-227.014) [-227.389] (-229.399) -- 0:00:05
923000 -- (-229.608) [-227.427] (-229.378) (-226.987) * (-226.378) (-229.709) [-227.185] (-227.472) -- 0:00:05
923500 -- (-231.446) [-228.409] (-228.059) (-228.646) * (-230.217) (-233.317) (-228.093) [-227.599] -- 0:00:05
924000 -- (-226.603) (-230.865) [-228.839] (-227.209) * [-229.037] (-228.877) (-227.274) (-230.178) -- 0:00:05
924500 -- (-226.495) [-229.202] (-230.883) (-232.069) * [-228.585] (-228.094) (-228.226) (-227.470) -- 0:00:04
925000 -- (-226.722) (-226.534) (-231.872) [-229.032] * (-228.304) [-226.944] (-226.021) (-229.186) -- 0:00:05
Average standard deviation of split frequencies: 0.006713
925500 -- [-228.345] (-226.356) (-230.954) (-230.263) * (-227.202) [-228.618] (-227.838) (-227.654) -- 0:00:04
926000 -- [-227.011] (-229.683) (-225.881) (-226.290) * (-227.613) (-226.545) (-227.486) [-225.964] -- 0:00:04
926500 -- (-227.490) (-229.083) [-228.577] (-234.952) * (-229.826) (-226.527) [-228.346] (-226.239) -- 0:00:04
927000 -- (-229.306) [-225.593] (-226.264) (-227.725) * (-227.662) (-227.095) [-226.355] (-226.791) -- 0:00:04
927500 -- (-226.350) [-230.308] (-225.830) (-229.209) * [-226.082] (-231.570) (-226.412) (-230.621) -- 0:00:04
928000 -- (-227.234) (-226.388) (-225.744) [-226.878] * [-227.416] (-228.991) (-225.910) (-227.316) -- 0:00:04
928500 -- (-232.643) [-228.545] (-228.346) (-232.023) * [-226.556] (-227.357) (-226.876) (-226.658) -- 0:00:04
929000 -- [-226.584] (-230.587) (-227.567) (-228.028) * (-230.325) (-233.937) [-226.947] (-229.149) -- 0:00:04
929500 -- (-228.902) (-226.665) (-227.941) [-228.398] * (-228.091) (-231.273) [-227.187] (-227.799) -- 0:00:04
930000 -- (-230.128) (-235.185) (-229.917) [-225.724] * (-227.718) (-226.485) [-226.406] (-225.823) -- 0:00:04
Average standard deviation of split frequencies: 0.006806
930500 -- [-227.698] (-228.417) (-229.798) (-225.886) * (-230.359) [-229.019] (-226.582) (-227.332) -- 0:00:04
931000 -- (-227.186) (-227.043) [-227.852] (-225.937) * (-228.229) (-226.740) [-227.975] (-228.707) -- 0:00:04
931500 -- (-226.777) (-226.109) [-227.268] (-226.691) * (-227.471) (-227.346) (-227.191) [-226.016] -- 0:00:04
932000 -- (-228.152) (-228.318) (-226.986) [-227.928] * (-229.262) (-225.570) [-228.503] (-227.797) -- 0:00:04
932500 -- (-231.177) [-227.791] (-230.488) (-234.299) * (-231.262) [-227.172] (-226.199) (-227.001) -- 0:00:04
933000 -- (-228.176) (-230.214) (-231.797) [-227.324] * (-227.873) (-226.433) [-227.795] (-228.108) -- 0:00:04
933500 -- (-228.904) [-228.269] (-226.150) (-225.808) * [-228.971] (-225.919) (-227.736) (-227.545) -- 0:00:04
934000 -- (-228.312) [-227.207] (-226.935) (-227.367) * [-226.776] (-226.023) (-227.817) (-226.483) -- 0:00:04
934500 -- (-229.284) (-228.337) [-226.787] (-227.361) * (-226.711) (-226.374) (-227.132) [-227.998] -- 0:00:04
935000 -- [-226.367] (-232.041) (-231.228) (-229.295) * (-232.641) [-231.878] (-226.324) (-230.232) -- 0:00:04
Average standard deviation of split frequencies: 0.007051
935500 -- (-228.246) (-227.794) (-231.867) [-227.519] * (-226.840) (-228.222) (-229.628) [-227.516] -- 0:00:04
936000 -- (-227.475) [-227.612] (-228.351) (-228.493) * (-232.822) (-226.957) (-227.064) [-231.992] -- 0:00:04
936500 -- [-226.861] (-226.268) (-229.094) (-226.766) * (-226.398) [-226.749] (-226.169) (-228.562) -- 0:00:04
937000 -- (-228.064) (-228.052) (-228.536) [-227.885] * [-229.854] (-227.137) (-226.864) (-226.398) -- 0:00:04
937500 -- (-225.992) [-226.573] (-227.173) (-229.393) * (-228.679) (-227.295) [-226.047] (-227.491) -- 0:00:04
938000 -- (-226.650) [-229.230] (-226.826) (-228.215) * (-228.557) (-227.492) [-226.869] (-229.270) -- 0:00:04
938500 -- (-229.593) (-232.099) [-227.027] (-230.046) * (-226.696) [-226.148] (-227.893) (-230.323) -- 0:00:04
939000 -- (-227.672) (-228.126) [-230.076] (-230.519) * (-226.026) (-229.467) (-227.936) [-230.337] -- 0:00:04
939500 -- (-229.892) (-227.563) (-229.190) [-226.962] * (-229.974) (-230.445) [-230.610] (-230.945) -- 0:00:04
940000 -- (-228.003) (-227.215) [-229.432] (-226.306) * [-226.362] (-226.395) (-226.429) (-226.448) -- 0:00:04
Average standard deviation of split frequencies: 0.006891
940500 -- (-226.876) (-226.206) [-228.447] (-227.355) * [-225.869] (-227.951) (-230.743) (-230.876) -- 0:00:03
941000 -- (-232.468) (-227.380) (-229.100) [-225.932] * [-226.580] (-226.276) (-230.916) (-225.674) -- 0:00:03
941500 -- (-233.017) (-227.390) (-226.120) [-226.593] * [-227.323] (-226.922) (-236.026) (-227.972) -- 0:00:03
942000 -- [-232.038] (-228.719) (-225.809) (-226.614) * [-227.061] (-229.328) (-227.566) (-228.435) -- 0:00:03
942500 -- (-231.767) [-228.856] (-226.863) (-226.896) * (-228.049) (-228.144) [-227.118] (-228.431) -- 0:00:03
943000 -- (-229.377) (-229.813) (-230.545) [-228.418] * (-228.756) (-230.619) (-227.828) [-227.805] -- 0:00:03
943500 -- (-228.202) (-230.808) [-229.541] (-229.632) * (-227.879) [-228.017] (-226.592) (-230.321) -- 0:00:03
944000 -- [-227.194] (-227.012) (-227.847) (-226.427) * [-230.397] (-230.304) (-230.042) (-228.722) -- 0:00:03
944500 -- (-227.651) (-226.632) [-227.940] (-230.550) * (-226.750) [-230.190] (-226.096) (-229.381) -- 0:00:03
945000 -- [-226.606] (-227.801) (-226.772) (-229.116) * (-225.816) (-234.061) [-226.928] (-227.580) -- 0:00:03
Average standard deviation of split frequencies: 0.006572
945500 -- (-226.512) [-226.855] (-232.095) (-230.853) * [-226.326] (-233.115) (-227.240) (-225.895) -- 0:00:03
946000 -- (-227.974) (-229.125) [-228.410] (-229.717) * [-228.140] (-228.078) (-232.421) (-229.503) -- 0:00:03
946500 -- [-227.312] (-227.367) (-229.293) (-226.542) * (-226.098) (-230.776) [-227.880] (-228.177) -- 0:00:03
947000 -- (-227.737) (-226.363) (-228.295) [-226.418] * (-230.189) [-226.286] (-226.822) (-227.337) -- 0:00:03
947500 -- (-228.355) (-229.776) [-226.915] (-229.621) * (-228.805) (-228.674) (-228.920) [-227.323] -- 0:00:03
948000 -- (-230.104) [-229.079] (-226.573) (-231.462) * [-229.426] (-230.484) (-226.338) (-227.574) -- 0:00:03
948500 -- (-230.907) [-227.638] (-229.212) (-229.406) * (-228.483) (-225.751) [-227.720] (-225.993) -- 0:00:03
949000 -- (-230.786) [-226.192] (-226.255) (-225.954) * (-229.396) [-227.247] (-231.051) (-228.966) -- 0:00:03
949500 -- (-227.041) (-226.866) [-228.114] (-227.053) * (-236.564) (-228.931) [-226.889] (-226.814) -- 0:00:03
950000 -- (-230.067) (-226.489) (-229.404) [-228.718] * (-228.835) (-227.826) (-226.638) [-227.644] -- 0:00:03
Average standard deviation of split frequencies: 0.006539
950500 -- (-227.191) (-229.253) [-226.973] (-227.433) * (-234.704) (-226.577) (-228.935) [-227.502] -- 0:00:03
951000 -- [-226.893] (-229.938) (-227.009) (-228.083) * (-227.871) (-227.405) (-226.382) [-227.753] -- 0:00:03
951500 -- [-227.118] (-227.969) (-229.412) (-230.466) * (-228.872) [-225.924] (-229.810) (-228.631) -- 0:00:03
952000 -- (-227.742) (-228.511) (-226.713) [-227.136] * (-227.709) (-227.390) [-230.164] (-227.223) -- 0:00:03
952500 -- (-227.439) (-231.437) (-227.236) [-229.012] * (-228.618) (-229.283) [-226.675] (-226.618) -- 0:00:03
953000 -- (-226.489) (-228.888) [-226.645] (-225.787) * (-227.965) [-229.106] (-228.225) (-226.221) -- 0:00:03
953500 -- (-226.236) (-231.286) (-228.430) [-227.672] * (-227.696) (-232.072) [-229.580] (-229.990) -- 0:00:03
954000 -- (-229.666) (-229.596) (-229.182) [-226.569] * (-228.829) [-228.050] (-229.072) (-226.666) -- 0:00:03
954500 -- [-229.185] (-228.715) (-228.758) (-226.431) * [-229.900] (-229.609) (-227.466) (-225.854) -- 0:00:03
955000 -- (-226.423) [-226.499] (-227.251) (-226.424) * (-228.943) (-232.730) (-230.336) [-227.041] -- 0:00:03
Average standard deviation of split frequencies: 0.006595
955500 -- [-226.821] (-227.439) (-226.420) (-229.216) * [-227.537] (-229.751) (-227.657) (-229.175) -- 0:00:02
956000 -- (-226.975) (-228.499) (-229.269) [-229.857] * (-227.711) [-229.886] (-230.632) (-229.463) -- 0:00:02
956500 -- (-228.464) (-228.537) (-230.519) [-229.775] * (-227.394) (-230.887) [-225.886] (-229.634) -- 0:00:02
957000 -- (-228.148) [-225.959] (-227.871) (-227.701) * [-227.351] (-235.063) (-226.046) (-232.117) -- 0:00:02
957500 -- (-229.446) (-226.028) (-226.291) [-232.139] * (-227.060) (-228.521) (-227.170) [-226.097] -- 0:00:02
958000 -- (-232.456) (-226.351) (-228.949) [-230.903] * (-236.679) [-229.252] (-229.375) (-226.791) -- 0:00:02
958500 -- (-230.440) (-231.454) [-226.018] (-229.189) * (-226.965) (-226.840) [-229.442] (-227.727) -- 0:00:02
959000 -- (-229.772) (-228.836) (-226.775) [-226.993] * (-228.462) (-229.210) (-231.092) [-230.520] -- 0:00:02
959500 -- (-230.129) [-228.631] (-227.954) (-227.834) * [-228.665] (-229.118) (-226.325) (-227.300) -- 0:00:02
960000 -- (-228.206) (-229.449) (-231.737) [-226.613] * [-230.316] (-230.779) (-228.922) (-227.808) -- 0:00:02
Average standard deviation of split frequencies: 0.006962
960500 -- [-227.404] (-228.200) (-228.287) (-226.168) * (-228.020) (-227.809) (-231.934) [-228.588] -- 0:00:02
961000 -- (-226.468) (-226.119) [-226.552] (-226.594) * (-227.049) (-227.408) (-228.228) [-227.595] -- 0:00:02
961500 -- [-228.416] (-226.073) (-225.820) (-232.584) * (-226.290) [-226.167] (-227.361) (-225.645) -- 0:00:02
962000 -- (-229.178) [-226.243] (-227.860) (-228.229) * [-227.735] (-229.008) (-229.261) (-226.681) -- 0:00:02
962500 -- (-232.014) (-226.873) [-230.761] (-227.508) * [-230.272] (-230.445) (-233.326) (-231.306) -- 0:00:02
963000 -- (-228.969) [-226.521] (-227.998) (-230.251) * [-226.111] (-229.309) (-230.878) (-230.702) -- 0:00:02
963500 -- (-227.360) (-227.834) (-227.087) [-227.024] * (-229.117) (-226.901) (-228.091) [-228.137] -- 0:00:02
964000 -- (-227.620) [-227.097] (-227.374) (-228.504) * (-229.476) (-228.865) (-228.867) [-225.643] -- 0:00:02
964500 -- [-226.795] (-230.462) (-227.700) (-227.727) * [-228.338] (-229.335) (-228.778) (-231.608) -- 0:00:02
965000 -- (-229.077) (-228.345) (-228.259) [-226.786] * (-230.046) [-227.265] (-227.651) (-228.003) -- 0:00:02
Average standard deviation of split frequencies: 0.006618
965500 -- [-228.050] (-227.657) (-230.327) (-226.028) * (-228.381) [-228.751] (-228.574) (-228.230) -- 0:00:02
966000 -- (-227.034) (-231.834) [-227.605] (-229.433) * [-228.484] (-227.597) (-231.782) (-227.809) -- 0:00:02
966500 -- (-228.353) (-229.186) (-228.435) [-226.805] * (-227.002) (-226.125) [-230.057] (-228.772) -- 0:00:02
967000 -- (-228.069) (-229.321) (-226.922) [-227.413] * (-226.084) [-229.211] (-226.777) (-227.018) -- 0:00:02
967500 -- (-231.165) [-229.032] (-228.819) (-227.581) * [-227.619] (-225.556) (-226.672) (-227.468) -- 0:00:02
968000 -- (-230.819) (-228.122) [-226.116] (-227.456) * [-226.682] (-225.924) (-226.101) (-228.542) -- 0:00:02
968500 -- [-227.395] (-228.499) (-228.182) (-229.787) * [-228.864] (-229.609) (-227.712) (-226.601) -- 0:00:02
969000 -- (-226.524) (-227.530) [-226.958] (-230.579) * [-225.820] (-229.023) (-225.737) (-231.895) -- 0:00:02
969500 -- (-230.667) (-227.744) (-229.858) [-229.123] * (-226.563) (-228.101) [-228.708] (-228.935) -- 0:00:02
970000 -- (-229.439) (-230.328) (-227.593) [-229.745] * [-226.519] (-228.405) (-226.500) (-228.090) -- 0:00:02
Average standard deviation of split frequencies: 0.006496
970500 -- (-228.420) (-228.190) (-230.160) [-229.528] * (-228.283) (-229.152) (-226.044) [-227.667] -- 0:00:01
971000 -- (-229.032) (-227.096) [-229.106] (-226.951) * (-231.108) (-227.717) (-230.834) [-225.609] -- 0:00:01
971500 -- (-228.099) (-226.794) (-229.370) [-227.612] * (-231.157) [-227.304] (-227.893) (-229.429) -- 0:00:01
972000 -- (-228.622) (-226.837) [-226.581] (-226.341) * (-228.807) [-228.607] (-234.750) (-227.794) -- 0:00:01
972500 -- [-230.006] (-229.368) (-226.605) (-226.517) * (-227.213) (-230.500) (-231.519) [-228.964] -- 0:00:01
973000 -- (-228.233) (-228.782) (-231.824) [-226.730] * (-226.699) [-229.699] (-227.364) (-227.596) -- 0:00:01
973500 -- (-232.532) (-232.055) (-226.431) [-227.193] * [-228.311] (-229.553) (-226.556) (-226.846) -- 0:00:01
974000 -- (-230.417) (-228.615) [-225.943] (-227.193) * (-227.011) (-231.676) [-226.583] (-228.941) -- 0:00:01
974500 -- (-228.870) (-228.351) [-228.327] (-231.686) * (-227.674) (-229.514) (-226.879) [-228.735] -- 0:00:01
975000 -- (-227.319) [-226.968] (-227.304) (-228.923) * [-228.510] (-229.944) (-226.162) (-232.559) -- 0:00:01
Average standard deviation of split frequencies: 0.006460
975500 -- (-233.800) (-226.809) (-231.575) [-227.797] * (-229.819) [-228.283] (-226.266) (-225.994) -- 0:00:01
976000 -- (-231.366) [-227.546] (-226.872) (-227.478) * (-228.306) [-227.697] (-229.872) (-228.288) -- 0:00:01
976500 -- (-227.686) [-229.550] (-227.523) (-225.753) * [-228.902] (-227.843) (-227.215) (-230.660) -- 0:00:01
977000 -- (-227.308) (-231.170) [-226.688] (-225.828) * [-228.572] (-227.613) (-227.138) (-226.610) -- 0:00:01
977500 -- (-227.211) (-229.152) (-230.039) [-225.802] * (-227.761) [-230.446] (-228.478) (-227.784) -- 0:00:01
978000 -- (-228.454) [-226.015] (-227.255) (-226.444) * (-227.463) [-233.412] (-225.783) (-229.757) -- 0:00:01
978500 -- (-229.138) (-228.494) (-227.412) [-231.106] * [-227.318] (-228.636) (-228.230) (-227.492) -- 0:00:01
979000 -- (-228.271) [-225.650] (-227.646) (-227.096) * (-228.750) (-231.525) (-231.266) [-225.952] -- 0:00:01
979500 -- (-226.156) (-230.262) (-227.526) [-228.288] * [-227.212] (-228.675) (-228.233) (-226.870) -- 0:00:01
980000 -- (-227.245) (-225.692) (-232.868) [-225.941] * (-229.706) (-228.085) [-227.500] (-230.673) -- 0:00:01
Average standard deviation of split frequencies: 0.005949
980500 -- [-225.632] (-226.580) (-228.814) (-226.120) * (-226.485) [-227.234] (-229.609) (-228.123) -- 0:00:01
981000 -- (-229.777) (-226.148) [-227.651] (-231.358) * [-228.465] (-227.515) (-227.808) (-227.956) -- 0:00:01
981500 -- (-226.877) [-227.642] (-228.120) (-230.890) * (-229.983) [-231.251] (-229.271) (-228.072) -- 0:00:01
982000 -- [-228.163] (-226.917) (-226.631) (-227.759) * (-227.276) (-227.105) (-227.568) [-228.847] -- 0:00:01
982500 -- (-229.842) [-226.796] (-226.659) (-227.249) * (-229.871) [-228.188] (-230.873) (-227.522) -- 0:00:01
983000 -- (-227.287) (-226.541) (-229.593) [-230.208] * (-229.791) [-227.119] (-232.058) (-229.654) -- 0:00:01
983500 -- (-226.454) (-226.581) [-229.291] (-227.426) * (-229.999) [-228.442] (-231.532) (-230.146) -- 0:00:01
984000 -- [-227.012] (-226.635) (-229.321) (-234.776) * (-227.943) (-227.265) [-231.167] (-226.324) -- 0:00:01
984500 -- (-228.060) (-228.312) (-226.980) [-230.616] * (-229.148) (-227.041) (-230.018) [-229.841] -- 0:00:01
985000 -- [-230.374] (-226.095) (-227.431) (-226.518) * (-229.555) [-226.577] (-228.073) (-227.553) -- 0:00:01
Average standard deviation of split frequencies: 0.005857
985500 -- (-229.910) [-226.454] (-231.196) (-227.812) * (-230.047) (-228.482) [-226.978] (-229.471) -- 0:00:00
986000 -- (-229.588) [-227.374] (-228.718) (-226.710) * [-231.550] (-226.716) (-228.546) (-234.602) -- 0:00:00
986500 -- (-226.886) (-227.041) (-229.690) [-226.129] * (-226.778) [-229.194] (-227.726) (-228.589) -- 0:00:00
987000 -- (-227.690) [-228.599] (-228.120) (-226.714) * (-229.206) [-228.501] (-225.989) (-227.500) -- 0:00:00
987500 -- [-227.009] (-229.021) (-234.528) (-228.007) * (-227.447) (-226.271) [-225.887] (-228.887) -- 0:00:00
988000 -- (-230.058) [-227.808] (-229.247) (-231.713) * (-226.253) (-229.310) [-226.195] (-227.655) -- 0:00:00
988500 -- [-226.308] (-227.990) (-228.822) (-231.440) * (-229.081) (-227.838) [-226.848] (-226.703) -- 0:00:00
989000 -- [-225.744] (-228.244) (-231.657) (-231.139) * (-226.151) [-226.657] (-228.049) (-228.294) -- 0:00:00
989500 -- [-225.784] (-240.792) (-228.579) (-226.456) * [-228.013] (-226.766) (-230.842) (-228.441) -- 0:00:00
990000 -- [-225.736] (-237.658) (-227.265) (-227.595) * (-228.104) (-226.761) (-227.077) [-229.216] -- 0:00:00
Average standard deviation of split frequencies: 0.005680
990500 -- (-226.023) (-233.030) [-227.477] (-231.500) * [-228.494] (-229.234) (-226.875) (-226.216) -- 0:00:00
991000 -- [-227.411] (-230.606) (-226.861) (-228.503) * (-235.400) (-228.961) [-235.110] (-229.399) -- 0:00:00
991500 -- (-227.699) (-229.529) [-226.650] (-228.557) * (-228.453) (-230.675) (-227.687) [-228.141] -- 0:00:00
992000 -- (-229.620) (-227.809) (-228.969) [-227.731] * (-227.788) (-225.914) (-230.281) [-226.698] -- 0:00:00
992500 -- (-226.795) [-227.563] (-228.228) (-228.023) * (-226.994) (-225.950) (-233.139) [-226.989] -- 0:00:00
993000 -- [-226.188] (-226.926) (-226.735) (-231.103) * (-228.948) (-228.561) (-232.190) [-226.244] -- 0:00:00
993500 -- (-232.222) (-228.776) (-228.630) [-230.408] * (-226.495) (-228.239) [-227.214] (-226.113) -- 0:00:00
994000 -- (-229.282) (-227.698) [-229.626] (-228.248) * (-227.100) (-227.869) [-227.645] (-228.371) -- 0:00:00
994500 -- (-228.070) (-226.750) (-229.063) [-226.907] * [-225.751] (-229.295) (-225.975) (-227.488) -- 0:00:00
995000 -- (-227.850) (-226.492) (-228.113) [-226.792] * (-226.540) (-227.077) (-225.703) [-227.887] -- 0:00:00
Average standard deviation of split frequencies: 0.005532
995500 -- (-227.544) [-227.832] (-227.652) (-226.843) * (-230.120) [-230.448] (-228.927) (-228.217) -- 0:00:00
996000 -- (-227.262) (-228.929) [-228.637] (-227.724) * (-229.431) [-234.459] (-227.759) (-228.538) -- 0:00:00
996500 -- (-229.540) (-234.351) [-226.509] (-227.228) * (-231.065) [-226.106] (-230.514) (-227.412) -- 0:00:00
997000 -- (-229.101) [-228.831] (-227.295) (-227.290) * (-230.045) (-226.523) [-229.907] (-227.005) -- 0:00:00
997500 -- (-227.890) (-227.029) [-226.736] (-227.743) * (-226.085) (-228.026) [-229.282] (-227.365) -- 0:00:00
998000 -- (-227.269) [-225.943] (-226.740) (-227.874) * (-226.760) [-229.733] (-229.359) (-229.509) -- 0:00:00
998500 -- (-227.504) (-230.144) (-227.260) [-231.266] * (-229.531) (-227.732) (-228.884) [-228.311] -- 0:00:00
999000 -- (-228.302) [-225.959] (-226.783) (-226.552) * (-226.163) [-226.560] (-228.418) (-226.124) -- 0:00:00
999500 -- (-227.763) (-231.187) [-227.949] (-229.475) * (-227.740) (-227.450) [-227.878] (-226.954) -- 0:00:00
1000000 -- (-230.227) (-225.914) (-226.262) [-225.505] * (-226.486) (-229.635) [-226.080] (-227.286) -- 0:00:00
Average standard deviation of split frequencies: 0.005800
Analysis completed in 1 mins 7 seconds
Analysis used 66.31 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -225.39
Likelihood of best state for "cold" chain of run 2 was -225.39
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 78 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
51.0 % ( 38 %) Dirichlet(Pi{all})
47.0 % ( 36 %) Slider(Pi{all})
79.2 % ( 56 %) Multiplier(Alpha{1,2})
77.4 % ( 59 %) Multiplier(Alpha{3})
28.4 % ( 25 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 35 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
50.6 % ( 39 %) Dirichlet(Pi{all})
47.8 % ( 36 %) Slider(Pi{all})
79.0 % ( 51 %) Multiplier(Alpha{1,2})
77.9 % ( 61 %) Multiplier(Alpha{3})
28.1 % ( 29 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 93 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.9 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166442 0.82 0.67
3 | 166578 167041 0.84
4 | 166490 166788 166661
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165788 0.82 0.67
3 | 166867 167034 0.83
4 | 166803 167173 166335
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -227.17
| 2 1 |
| 1 1|
| 1 1 1 |
| 2 2 2 2 2 * 2 1 |
|1 *1 1 12 1 1 2 222 1 2 |
| 1 1 2 2 11 |
| 21 1 121 1* 2 2 1 1 2 1 |
| 21 21 1 1 1 22 1 2 1 2 |
| *1 2 12 2 1 1 2 *2 |
| 2 2 2 1 2 1 1 221 1 2 2|
| 2 2 2 21 1 1 21 1 1 |
| 1 2 1 1 2 2 2 1 1 1 |
|2 1 2 2 |
| 2 22 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -228.69
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -227.15 -229.62
2 -227.20 -231.14
--------------------------------------
TOTAL -227.17 -230.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892980 0.094100 0.330173 1.474825 0.853939 1461.17 1481.09 1.000
r(A<->C){all} 0.164989 0.019142 0.000112 0.447357 0.128372 142.30 178.66 1.009
r(A<->G){all} 0.172423 0.022049 0.000428 0.473967 0.130686 143.39 224.24 1.003
r(A<->T){all} 0.171906 0.022366 0.000032 0.470901 0.131355 160.81 182.31 1.001
r(C<->G){all} 0.163079 0.018251 0.000045 0.426252 0.130941 241.82 345.73 1.000
r(C<->T){all} 0.166965 0.021293 0.000006 0.466400 0.124651 219.34 231.46 1.001
r(G<->T){all} 0.160637 0.019943 0.000048 0.454216 0.121588 116.71 197.72 1.003
pi(A){all} 0.295803 0.001178 0.229516 0.360310 0.295775 934.07 1162.52 1.000
pi(C){all} 0.254050 0.001150 0.192112 0.323018 0.252813 1257.45 1332.76 1.000
pi(G){all} 0.278570 0.001191 0.210810 0.343265 0.277271 1456.97 1457.79 1.000
pi(T){all} 0.171577 0.000803 0.119293 0.227825 0.169780 1271.78 1315.37 1.000
alpha{1,2} 0.400242 0.220805 0.000128 1.373620 0.238755 1142.97 1202.50 1.000
alpha{3} 0.452634 0.243734 0.000379 1.458966 0.291037 1142.43 1321.71 1.000
pinvar{all} 0.988966 0.000184 0.964666 0.999996 0.993128 1074.42 1222.35 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- ..*..*
9 -- ..*.*.
10 -- .**.**
11 -- .***.*
12 -- .*..*.
13 -- .**...
14 -- ..****
15 -- .*.*..
16 -- .*.***
17 -- ...**.
18 -- .****.
19 -- .*...*
20 -- ..**..
21 -- ....**
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 472 0.157229 0.002827 0.155230 0.159227 2
8 467 0.155563 0.011777 0.147235 0.163891 2
9 445 0.148235 0.006124 0.143904 0.152565 2
10 436 0.145237 0.001884 0.143904 0.146569 2
11 433 0.144237 0.005182 0.140573 0.147901 2
12 432 0.143904 0.005653 0.139907 0.147901 2
13 431 0.143571 0.017430 0.131246 0.155896 2
14 430 0.143238 0.000000 0.143238 0.143238 2
15 425 0.141572 0.008009 0.135909 0.147235 2
16 424 0.141239 0.004711 0.137908 0.144570 2
17 416 0.138574 0.000000 0.138574 0.138574 2
18 414 0.137908 0.004711 0.134577 0.141239 2
19 414 0.137908 0.001884 0.136576 0.139241 2
20 402 0.133911 0.005653 0.129913 0.137908 2
21 398 0.132578 0.002827 0.130580 0.134577 2
22 276 0.091939 0.014133 0.081945 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100936 0.010277 0.000003 0.311597 0.069175 1.000 2
length{all}[2] 0.099414 0.009705 0.000030 0.296933 0.069534 1.000 2
length{all}[3] 0.099315 0.009072 0.000001 0.291428 0.070995 1.000 2
length{all}[4] 0.098815 0.010254 0.000106 0.287616 0.068663 1.000 2
length{all}[5] 0.099936 0.009953 0.000042 0.301769 0.067816 1.000 2
length{all}[6] 0.096997 0.009394 0.000003 0.292153 0.066965 1.000 2
length{all}[7] 0.104995 0.009950 0.000314 0.293233 0.079732 1.006 2
length{all}[8] 0.104026 0.011348 0.000520 0.295135 0.072710 0.999 2
length{all}[9] 0.091110 0.009575 0.000067 0.274724 0.059576 0.998 2
length{all}[10] 0.100987 0.011076 0.000209 0.311005 0.067019 0.998 2
length{all}[11] 0.095588 0.010256 0.000099 0.266528 0.067863 0.998 2
length{all}[12] 0.094999 0.008319 0.000037 0.271971 0.065997 0.998 2
length{all}[13] 0.100234 0.012136 0.000115 0.316467 0.066815 1.000 2
length{all}[14] 0.097428 0.008596 0.000596 0.263066 0.067682 0.998 2
length{all}[15] 0.106082 0.010637 0.000157 0.312313 0.074755 0.998 2
length{all}[16] 0.100028 0.011801 0.000093 0.312211 0.063814 1.002 2
length{all}[17] 0.090050 0.008310 0.000154 0.270679 0.059999 0.998 2
length{all}[18] 0.104514 0.012029 0.000035 0.315589 0.068771 0.999 2
length{all}[19] 0.105159 0.009447 0.000315 0.302350 0.075561 1.000 2
length{all}[20] 0.096535 0.010877 0.000305 0.306256 0.063349 0.998 2
length{all}[21] 0.094629 0.010038 0.000304 0.270812 0.068142 0.998 2
length{all}[22] 0.107884 0.012191 0.001438 0.330144 0.071410 1.017 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005800
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.017
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 165
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 31 patterns at 55 / 55 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 31 patterns at 55 / 55 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
30256 bytes for conP
2728 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.098616 0.053650 0.100578 0.059341 0.040598 0.092754 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -238.985415
Iterating by ming2
Initial: fx= 238.985415
x= 0.09862 0.05365 0.10058 0.05934 0.04060 0.09275 0.30000 1.30000
1 h-m-p 0.0000 0.0007 131.8076 ++++ 225.916523 m 0.0007 15 | 1/8
2 h-m-p 0.0029 0.0146 25.0545 ------------.. | 1/8
3 h-m-p 0.0000 0.0002 121.1813 +++ 222.365121 m 0.0002 48 | 2/8
4 h-m-p 0.0014 0.0211 18.9413 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 108.5287 ++ 221.122678 m 0.0001 79 | 3/8
6 h-m-p 0.0006 0.0271 15.2376 -----------.. | 3/8
7 h-m-p 0.0000 0.0006 93.9116 +++ 215.604950 m 0.0006 111 | 4/8
8 h-m-p 0.0043 0.0403 11.1780 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 77.1850 ++ 214.952110 m 0.0001 143 | 5/8
10 h-m-p 0.0009 0.0766 7.0228 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 54.6344 ++ 214.842634 m 0.0000 174 | 6/8
12 h-m-p 0.5382 8.0000 0.0000 Y 214.842634 0 1.2500 185 | 6/8
13 h-m-p 0.1040 8.0000 0.0000 ----C 214.842634 0 0.0001 202
Out..
lnL = -214.842634
203 lfun, 203 eigenQcodon, 1218 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.078383 0.064555 0.052240 0.095724 0.078647 0.089537 0.299717 0.766237 0.529536
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.696210
np = 9
lnL0 = -239.571747
Iterating by ming2
Initial: fx= 239.571747
x= 0.07838 0.06455 0.05224 0.09572 0.07865 0.08954 0.29972 0.76624 0.52954
1 h-m-p 0.0000 0.0010 129.1135 ++++ 222.890209 m 0.0010 16 | 1/9
2 h-m-p 0.0002 0.0008 77.0634 ++ 219.478474 m 0.0008 28 | 2/9
3 h-m-p 0.0007 0.0034 65.6839 ++ 215.868662 m 0.0034 40 | 3/9
4 h-m-p 0.0000 0.0000 979.1056 ++ 215.838402 m 0.0000 52 | 4/9
5 h-m-p 0.0000 0.0016 261.9361 ++++ 215.118265 m 0.0016 66 | 4/9
6 h-m-p -0.0000 -0.0000 1046.2259
h-m-p: -6.86668734e-21 -3.43334367e-20 1.04622588e+03 215.118265
.. | 4/9
7 h-m-p 0.0000 0.0000 77.7212 ++ 214.900867 m 0.0000 87 | 5/9
8 h-m-p 0.0009 0.1520 2.2984 -----------.. | 5/9
9 h-m-p 0.0000 0.0000 55.0550 ++ 214.842645 m 0.0000 120 | 6/9
10 h-m-p 0.0299 8.0000 0.0000 --Y 214.842645 0 0.0005 134 | 6/9
11 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 214.842645 m 8.0000 178 | 6/9
13 h-m-p 0.0021 1.0304 0.3158 +++++ 214.842638 m 1.0304 196 | 7/9
14 h-m-p 1.4933 7.4665 0.0135 ++ 214.842638 m 7.4665 211 | 8/9
15 h-m-p 0.0266 8.0000 1.1916 ---------C 214.842638 0 0.0000 234 | 8/9
16 h-m-p 0.0273 8.0000 0.0000 Y 214.842638 0 0.0120 246 | 8/9
17 h-m-p 0.0285 8.0000 0.0000 ---Y 214.842638 0 0.0001 262
Out..
lnL = -214.842638
263 lfun, 789 eigenQcodon, 3156 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031676 0.048015 0.056021 0.054179 0.093809 0.102025 0.270414 1.643752 0.154972 0.403061 1.395842
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.930744
np = 11
lnL0 = -234.999933
Iterating by ming2
Initial: fx= 234.999933
x= 0.03168 0.04801 0.05602 0.05418 0.09381 0.10203 0.27041 1.64375 0.15497 0.40306 1.39584
1 h-m-p 0.0000 0.0006 122.0569 +++ 225.383437 m 0.0006 17 | 1/11
2 h-m-p 0.0003 0.0013 68.2534 ++ 220.914298 m 0.0013 31 | 2/11
3 h-m-p 0.0000 0.0000 4919.2433 ++ 219.553534 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 732.3151 ++ 219.226438 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0002 864.4354 ++ 215.253439 m 0.0002 73 | 5/11
6 h-m-p 0.0001 0.0003 262.7789 ++ 214.842658 m 0.0003 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0005 ---------N 214.842658 0 0.0000 110
Out..
lnL = -214.842658
111 lfun, 444 eigenQcodon, 1998 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -214.847500 S = -214.841832 -0.002166
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 31 patterns 0:02
did 20 / 31 patterns 0:02
did 30 / 31 patterns 0:02
did 31 / 31 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.057063 0.081160 0.062538 0.036808 0.014888 0.042253 0.247158 1.170123 1.419117
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.377808
np = 9
lnL0 = -230.588436
Iterating by ming2
Initial: fx= 230.588436
x= 0.05706 0.08116 0.06254 0.03681 0.01489 0.04225 0.24716 1.17012 1.41912
1 h-m-p 0.0000 0.0003 126.1855 +++ 225.973462 m 0.0003 15 | 1/9
2 h-m-p 0.0038 0.1035 8.5735 ------------.. | 1/9
3 h-m-p 0.0000 0.0004 117.6117 +++ 220.131925 m 0.0004 50 | 2/9
4 h-m-p 0.0098 0.2788 4.4610 -------------.. | 2/9
5 h-m-p 0.0000 0.0001 108.1344 ++ 218.945750 m 0.0001 85 | 3/9
6 h-m-p 0.0040 0.7717 2.3848 ------------.. | 3/9
7 h-m-p 0.0000 0.0003 94.0683 +++ 216.498007 m 0.0003 120 | 4/9
8 h-m-p 0.0097 1.3615 2.1700 -------------.. | 4/9
9 h-m-p 0.0000 0.0001 77.7349 ++ 215.888007 m 0.0001 155 | 5/9
10 h-m-p 0.0025 1.2710 2.3769 ------------.. | 5/9
11 h-m-p 0.0000 0.0003 55.0435 +++ 214.842655 m 0.0003 190 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 214.842655 m 8.0000 202 | 6/9
13 h-m-p 0.0225 8.0000 0.0006 +++++ 214.842655 m 8.0000 220 | 6/9
14 h-m-p 0.0030 0.8205 1.6069 ---------Y 214.842655 0 0.0000 244 | 6/9
15 h-m-p 0.0160 8.0000 0.0000 ------Y 214.842655 0 0.0000 262 | 6/9
16 h-m-p 0.0160 8.0000 0.0000 ---------Y 214.842655 0 0.0000 286
Out..
lnL = -214.842655
287 lfun, 3157 eigenQcodon, 17220 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010640 0.102635 0.014509 0.076218 0.103344 0.109988 0.248088 0.900000 0.204290 1.289162 1.300210
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 21.550345
np = 11
lnL0 = -234.005856
Iterating by ming2
Initial: fx= 234.005856
x= 0.01064 0.10263 0.01451 0.07622 0.10334 0.10999 0.24809 0.90000 0.20429 1.28916 1.30021
1 h-m-p 0.0000 0.0003 96.1744 +++ 231.494961 m 0.0003 17 | 1/11
2 h-m-p 0.0000 0.0001 124.4858 ++ 230.627140 m 0.0001 31 | 2/11
3 h-m-p 0.0003 0.0035 51.5314 ++ 219.402421 m 0.0035 45 | 3/11
4 h-m-p 0.0002 0.0012 70.0459 ++ 217.406519 m 0.0012 59 | 4/11
5 h-m-p 0.0114 0.0569 3.2018 -------------.. | 4/11
6 h-m-p 0.0000 0.0003 87.9360 +++ 215.258931 m 0.0003 99 | 5/11
7 h-m-p 0.0055 0.2792 3.4577 ------------.. | 5/11
8 h-m-p 0.0000 0.0000 78.8793 ++ 215.186338 m 0.0000 137 | 6/11
9 h-m-p 0.0002 0.0532 4.1745 +++++ 214.842653 m 0.0532 154 | 7/11
10 h-m-p 1.6000 8.0000 0.0003 ++ 214.842653 m 8.0000 168 | 7/11
11 h-m-p 0.0078 2.6416 0.2559 +++++ 214.842633 m 2.6416 189 | 8/11
12 h-m-p 1.6000 8.0000 0.0146 ++ 214.842633 m 8.0000 207 | 8/11
13 h-m-p 0.9086 4.5432 0.0967 C 214.842633 0 0.7328 224 | 8/11
14 h-m-p 1.6000 8.0000 0.0077 Y 214.842633 0 1.1688 241 | 8/11
15 h-m-p 1.6000 8.0000 0.0001 ++ 214.842633 m 8.0000 258 | 8/11
16 h-m-p 0.0021 0.7101 0.3893 +++++ 214.842632 m 0.7101 278 | 9/11
17 h-m-p 0.3620 8.0000 0.4047 +++ 214.842618 m 8.0000 296 | 9/11
18 h-m-p 1.6000 8.0000 0.3171 ++ 214.842616 m 8.0000 312 | 9/11
19 h-m-p 1.4018 8.0000 1.8096 ++ 214.842613 m 8.0000 328 | 9/11
20 h-m-p 1.6000 8.0000 0.9610 ++ 214.842613 m 8.0000 342 | 9/11
21 h-m-p 0.0526 6.6332 146.2064 +++
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464232e-161 2000 rounds
+ 214.842612 m 6.6332 360
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.794625e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464225e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464232e-161 2000 rounds
| 9/11
22 h-m-p 1.6000 8.0000 3.8136
QuantileBeta(0.15, 0.00500, 2.64806) = 9.499951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65425) = 9.473137e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.65579) = 9.466457e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.65618) = 9.464788e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.65628) = 9.464371e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.65630) = 9.464267e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464241e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
C 214.842612 0 0.0005 379
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.794636e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464235e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
| 9/11
23 h-m-p 0.1733 0.8667 0.0020
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464240e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
N 214.842612 0 0.0027 395
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.794636e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65644) = 9.463668e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65617) = 9.464817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
| 9/11
24 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
N 214.842612 0 1.6000 411
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
Out..
lnL = -214.842612
412 lfun, 4944 eigenQcodon, 27192 P(t)
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -214.841327 S = -214.841323 -0.000002
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 31 patterns 0:14
did 20 / 31 patterns 0:14
did 30 / 31 patterns 0:14
did 31 / 31 patterns 0:14
QuantileBeta(0.15, 0.00500, 2.65631) = 9.464242e-161 2000 rounds
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=55
NC_011896_1_WP_010908609_1_2037_MLBR_RS09670 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
NC_002677_1_NP_302288_1_1160_rpmG MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
NZ_CP029543_1_WP_010908609_1_2061_rpmG MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
NZ_AP014567_1_WP_010908609_1_2116_rpmG MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS
**************************************************
NC_011896_1_WP_010908609_1_2037_MLBR_RS09670 HRETR
NC_002677_1_NP_302288_1_1160_rpmG HRETR
NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520 HRETR
NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850 HRETR
NZ_CP029543_1_WP_010908609_1_2061_rpmG HRETR
NZ_AP014567_1_WP_010908609_1_2116_rpmG HRETR
*****
>NC_011896_1_WP_010908609_1_2037_MLBR_RS09670 ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC CATCGTGAGACACGG >NC_002677_1_NP_302288_1_1160_rpmG ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC CATCGTGAGACACGG >NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520 ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC CATCGTGAGACACGG >NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850 ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC CATCGTGAGACACGG >NZ_CP029543_1_WP_010908609_1_2061_rpmG ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC CATCGTGAGACACGG >NZ_AP014567_1_WP_010908609_1_2116_rpmG ATGGCTTCCAGTACCGATGTGCGGCCGAAAATAACAATGGCATGCGAGGT GTGCAAGCACCGTAACTATATCACCAAGAAGAACCGGCGTAACGACCCCG ACCGGATGGAGCTGAAGAAGTTCTGCCGAAATTGTGGTAAGCACCAGTCC CATCGTGAGACACGG
>NC_011896_1_WP_010908609_1_2037_MLBR_RS09670 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS HRETR >NC_002677_1_NP_302288_1_1160_rpmG MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS HRETR >NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS HRETR >NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850 MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS HRETR >NZ_CP029543_1_WP_010908609_1_2061_rpmG MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS HRETR >NZ_AP014567_1_WP_010908609_1_2116_rpmG MASSTDVRPKITMACEVCKHRNYITKKNRRNDPDRMELKKFCRNCGKHQS HRETR
#NEXUS
[ID: 0813676410]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908609_1_2037_MLBR_RS09670
NC_002677_1_NP_302288_1_1160_rpmG
NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520
NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850
NZ_CP029543_1_WP_010908609_1_2061_rpmG
NZ_AP014567_1_WP_010908609_1_2116_rpmG
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908609_1_2037_MLBR_RS09670,
2 NC_002677_1_NP_302288_1_1160_rpmG,
3 NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520,
4 NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850,
5 NZ_CP029543_1_WP_010908609_1_2061_rpmG,
6 NZ_AP014567_1_WP_010908609_1_2116_rpmG
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06917466,2:0.06953392,3:0.07099535,4:0.06866288,5:0.06781552,6:0.06696511);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06917466,2:0.06953392,3:0.07099535,4:0.06866288,5:0.06781552,6:0.06696511);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -227.15 -229.62
2 -227.20 -231.14
--------------------------------------
TOTAL -227.17 -230.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892980 0.094100 0.330173 1.474825 0.853939 1461.17 1481.09 1.000
r(A<->C){all} 0.164989 0.019142 0.000112 0.447357 0.128372 142.30 178.66 1.009
r(A<->G){all} 0.172423 0.022049 0.000428 0.473967 0.130686 143.39 224.24 1.003
r(A<->T){all} 0.171906 0.022366 0.000032 0.470901 0.131355 160.81 182.31 1.001
r(C<->G){all} 0.163079 0.018251 0.000045 0.426252 0.130941 241.82 345.73 1.000
r(C<->T){all} 0.166965 0.021293 0.000006 0.466400 0.124651 219.34 231.46 1.001
r(G<->T){all} 0.160637 0.019943 0.000048 0.454216 0.121588 116.71 197.72 1.003
pi(A){all} 0.295803 0.001178 0.229516 0.360310 0.295775 934.07 1162.52 1.000
pi(C){all} 0.254050 0.001150 0.192112 0.323018 0.252813 1257.45 1332.76 1.000
pi(G){all} 0.278570 0.001191 0.210810 0.343265 0.277271 1456.97 1457.79 1.000
pi(T){all} 0.171577 0.000803 0.119293 0.227825 0.169780 1271.78 1315.37 1.000
alpha{1,2} 0.400242 0.220805 0.000128 1.373620 0.238755 1142.97 1202.50 1.000
alpha{3} 0.452634 0.243734 0.000379 1.458966 0.291037 1142.43 1321.71 1.000
pinvar{all} 0.988966 0.000184 0.964666 0.999996 0.993128 1074.42 1222.35 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpmG/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 55
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 2 2 2 2 2 2 | TAC 0 0 0 0 0 0 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 1 1 1 1 1 1 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 1 1 1 1 1 1 | ACC 2 2 2 2 2 2 | AAC 3 3 3 3 3 3 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 0 0 0 0 0 0 | AAG 6 6 6 6 6 6 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 1 1 1 1 1 | Asp GAT 1 1 1 1 1 1 | Gly GGT 1 1 1 1 1 1
GTC 0 0 0 0 0 0 | GCC 0 0 0 0 0 0 | GAC 2 2 2 2 2 2 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 0 0 0 0 0 0
GTG 2 2 2 2 2 2 | GCG 0 0 0 0 0 0 | GAG 3 3 3 3 3 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908609_1_2037_MLBR_RS09670
position 1: T:0.14545 C:0.27273 A:0.38182 G:0.20000
position 2: T:0.16364 C:0.18182 A:0.40000 G:0.25455
position 3: T:0.20000 C:0.30909 A:0.10909 G:0.38182
Average T:0.16970 C:0.25455 A:0.29697 G:0.27879
#2: NC_002677_1_NP_302288_1_1160_rpmG
position 1: T:0.14545 C:0.27273 A:0.38182 G:0.20000
position 2: T:0.16364 C:0.18182 A:0.40000 G:0.25455
position 3: T:0.20000 C:0.30909 A:0.10909 G:0.38182
Average T:0.16970 C:0.25455 A:0.29697 G:0.27879
#3: NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520
position 1: T:0.14545 C:0.27273 A:0.38182 G:0.20000
position 2: T:0.16364 C:0.18182 A:0.40000 G:0.25455
position 3: T:0.20000 C:0.30909 A:0.10909 G:0.38182
Average T:0.16970 C:0.25455 A:0.29697 G:0.27879
#4: NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850
position 1: T:0.14545 C:0.27273 A:0.38182 G:0.20000
position 2: T:0.16364 C:0.18182 A:0.40000 G:0.25455
position 3: T:0.20000 C:0.30909 A:0.10909 G:0.38182
Average T:0.16970 C:0.25455 A:0.29697 G:0.27879
#5: NZ_CP029543_1_WP_010908609_1_2061_rpmG
position 1: T:0.14545 C:0.27273 A:0.38182 G:0.20000
position 2: T:0.16364 C:0.18182 A:0.40000 G:0.25455
position 3: T:0.20000 C:0.30909 A:0.10909 G:0.38182
Average T:0.16970 C:0.25455 A:0.29697 G:0.27879
#6: NZ_AP014567_1_WP_010908609_1_2116_rpmG
position 1: T:0.14545 C:0.27273 A:0.38182 G:0.20000
position 2: T:0.16364 C:0.18182 A:0.40000 G:0.25455
position 3: T:0.20000 C:0.30909 A:0.10909 G:0.38182
Average T:0.16970 C:0.25455 A:0.29697 G:0.27879
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 6 | TCC 12 | TAC 0 | TGC 18
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 18
CTC 0 | CCC 6 | CAC 12 | CGC 0
CTA 0 | CCA 0 | Gln Q CAA 0 | CGA 6
CTG 6 | CCG 6 | CAG 6 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 6
ATC 6 | ACC 12 | AAC 18 | AGC 0
ATA 6 | ACA 12 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 0 | AAG 36 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 6 | Asp D GAT 6 | Gly G GGT 6
GTC 0 | GCC 0 | GAC 12 | GGC 0
GTA 0 | GCA 6 | Glu E GAA 0 | GGA 0
GTG 12 | GCG 0 | GAG 18 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14545 C:0.27273 A:0.38182 G:0.20000
position 2: T:0.16364 C:0.18182 A:0.40000 G:0.25455
position 3: T:0.20000 C:0.30909 A:0.10909 G:0.38182
Average T:0.16970 C:0.25455 A:0.29697 G:0.27879
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -214.842634 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299717 1.300210
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908609_1_2037_MLBR_RS09670: 0.000004, NC_002677_1_NP_302288_1_1160_rpmG: 0.000004, NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520: 0.000004, NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850: 0.000004, NZ_CP029543_1_WP_010908609_1_2061_rpmG: 0.000004, NZ_AP014567_1_WP_010908609_1_2116_rpmG: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29972
omega (dN/dS) = 1.30021
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 142.5 22.5 1.3002 0.0000 0.0000 0.0 0.0
7..2 0.000 142.5 22.5 1.3002 0.0000 0.0000 0.0 0.0
7..3 0.000 142.5 22.5 1.3002 0.0000 0.0000 0.0 0.0
7..4 0.000 142.5 22.5 1.3002 0.0000 0.0000 0.0 0.0
7..5 0.000 142.5 22.5 1.3002 0.0000 0.0000 0.0 0.0
7..6 0.000 142.5 22.5 1.3002 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -214.842638 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.270414 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908609_1_2037_MLBR_RS09670: 0.000004, NC_002677_1_NP_302288_1_1160_rpmG: 0.000004, NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520: 0.000004, NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850: 0.000004, NZ_CP029543_1_WP_010908609_1_2061_rpmG: 0.000004, NZ_AP014567_1_WP_010908609_1_2116_rpmG: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.27041
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 142.9 22.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 142.9 22.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 142.9 22.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 142.9 22.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 142.9 22.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 142.9 22.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -214.842658 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.247158 0.701886 0.160066 0.056992 1.497619
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908609_1_2037_MLBR_RS09670: 0.000004, NC_002677_1_NP_302288_1_1160_rpmG: 0.000004, NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520: 0.000004, NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850: 0.000004, NZ_CP029543_1_WP_010908609_1_2061_rpmG: 0.000004, NZ_AP014567_1_WP_010908609_1_2116_rpmG: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.24716
MLEs of dN/dS (w) for site classes (K=3)
p: 0.70189 0.16007 0.13805
w: 0.05699 1.00000 1.49762
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 143.2 21.8 0.4068 0.0000 0.0000 0.0 0.0
7..2 0.000 143.2 21.8 0.4068 0.0000 0.0000 0.0 0.0
7..3 0.000 143.2 21.8 0.4068 0.0000 0.0000 0.0 0.0
7..4 0.000 143.2 21.8 0.4068 0.0000 0.0000 0.0 0.0
7..5 0.000 143.2 21.8 0.4068 0.0000 0.0000 0.0 0.0
7..6 0.000 143.2 21.8 0.4068 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908609_1_2037_MLBR_RS09670)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908609_1_2037_MLBR_RS09670)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -214.842655 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.248088 1.172763 1.423000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908609_1_2037_MLBR_RS09670: 0.000004, NC_002677_1_NP_302288_1_1160_rpmG: 0.000004, NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520: 0.000004, NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850: 0.000004, NZ_CP029543_1_WP_010908609_1_2061_rpmG: 0.000004, NZ_AP014567_1_WP_010908609_1_2116_rpmG: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.24809
Parameters in M7 (beta):
p = 1.17276 q = 1.42300
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.05624 0.14623 0.23028 0.31282 0.39576 0.48056 0.56878 0.66271 0.76661 0.89326
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 143.1 21.9 0.4513 0.0000 0.0000 0.0 0.0
7..2 0.000 143.1 21.9 0.4513 0.0000 0.0000 0.0 0.0
7..3 0.000 143.1 21.9 0.4513 0.0000 0.0000 0.0 0.0
7..4 0.000 143.1 21.9 0.4513 0.0000 0.0000 0.0 0.0
7..5 0.000 143.1 21.9 0.4513 0.0000 0.0000 0.0 0.0
7..6 0.000 143.1 21.9 0.4513 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -214.842612 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 2.656308 998.998270
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908609_1_2037_MLBR_RS09670: 0.000004, NC_002677_1_NP_302288_1_1160_rpmG: 0.000004, NZ_LVXE01000028_1_WP_010908609_1_1135_A3216_RS08520: 0.000004, NZ_LYPH01000031_1_WP_010908609_1_1217_A8144_RS05850: 0.000004, NZ_CP029543_1_WP_010908609_1_2061_rpmG: 0.000004, NZ_AP014567_1_WP_010908609_1_2116_rpmG: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 2.65631
(p1 = 0.99999) w = 998.99827
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 998.99827
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 146.5 18.5 998.9883 0.0000 0.0000 0.0 0.0
7..2 0.000 146.5 18.5 998.9883 0.0000 0.0000 0.0 0.0
7..3 0.000 146.5 18.5 998.9883 0.0000 0.0000 0.0 0.0
7..4 0.000 146.5 18.5 998.9883 0.0000 0.0000 0.0 0.0
7..5 0.000 146.5 18.5 998.9883 0.0000 0.0000 0.0 0.0
7..6 0.000 146.5 18.5 998.9883 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908609_1_2037_MLBR_RS09670)
Pr(w>1) post mean +- SE for w
1 M 1.000** 998.988
2 A 1.000** 998.988
3 S 1.000** 998.988
4 S 1.000** 998.988
5 T 1.000** 998.988
6 D 1.000** 998.988
7 V 1.000** 998.988
8 R 1.000** 998.988
9 P 1.000** 998.988
10 K 1.000** 998.988
11 I 1.000** 998.988
12 T 1.000** 998.988
13 M 1.000** 998.988
14 A 1.000** 998.988
15 C 1.000** 998.988
16 E 1.000** 998.988
17 V 1.000** 998.988
18 C 1.000** 998.988
19 K 1.000** 998.988
20 H 1.000** 998.988
21 R 1.000** 998.988
22 N 1.000** 998.988
23 Y 1.000** 998.988
24 I 1.000** 998.988
25 T 1.000** 998.988
26 K 1.000** 998.988
27 K 1.000** 998.988
28 N 1.000** 998.988
29 R 1.000** 998.988
30 R 1.000** 998.988
31 N 1.000** 998.988
32 D 1.000** 998.988
33 P 1.000** 998.988
34 D 1.000** 998.988
35 R 1.000** 998.988
36 M 1.000** 998.988
37 E 1.000** 998.988
38 L 1.000** 998.988
39 K 1.000** 998.988
40 K 1.000** 998.988
41 F 1.000** 998.988
42 C 1.000** 998.988
43 R 1.000** 998.988
44 N 1.000** 998.988
45 C 1.000** 998.988
46 G 1.000** 998.988
47 K 1.000** 998.988
48 H 1.000** 998.988
49 Q 1.000** 998.988
50 S 1.000** 998.988
51 H 1.000** 998.988
52 R 1.000** 998.988
53 E 1.000** 998.988
54 T 1.000** 998.988
55 R 1.000** 998.988
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908609_1_2037_MLBR_RS09670)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:14
Model 1: NearlyNeutral -214.842638 Model 2: PositiveSelection -214.842658 Model 0: one-ratio -214.842634 Model 7: beta -214.842655 Model 8: beta&w>1 -214.842612 Model 0 vs 1 7.999999979801942E-6 Model 2 vs 1 4.0000000012696546E-5 Model 8 vs 7 8.600000001024455E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
