--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:05:20 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpmI/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -260.56          -264.01
2       -260.55          -266.04
--------------------------------------
TOTAL     -260.55          -265.47
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.892706    0.084457    0.361475    1.470542    0.860392   1161.08   1331.04    1.001
r(A<->C){all}   0.168765    0.020473    0.000086    0.453337    0.126834    130.34    277.76    1.000
r(A<->G){all}   0.161664    0.019119    0.000059    0.435086    0.125719    158.74    197.89    1.008
r(A<->T){all}   0.167705    0.020977    0.000070    0.452850    0.128453    224.69    240.58    1.000
r(C<->G){all}   0.166912    0.019082    0.000139    0.437465    0.132201    255.98    271.31    1.003
r(C<->T){all}   0.156395    0.017698    0.000036    0.429743    0.121762    188.93    217.08    1.004
r(G<->T){all}   0.178560    0.021794    0.000053    0.471430    0.140978    192.73    327.62    1.000
pi(A){all}      0.239230    0.000910    0.180514    0.299419    0.238491   1130.77   1315.88    1.000
pi(C){all}      0.315046    0.001081    0.251174    0.377104    0.314444   1229.46   1264.85    1.000
pi(G){all}      0.297188    0.001059    0.236939    0.363530    0.296298   1199.58   1236.90    1.000
pi(T){all}      0.148536    0.000678    0.100978    0.200612    0.147031    997.60   1019.80    1.001
alpha{1,2}      0.422856    0.240358    0.000222    1.362852    0.253647   1414.54   1439.03    1.000
alpha{3}        0.436903    0.217933    0.000281    1.417373    0.289340   1244.60   1342.80    1.000
pinvar{all}     0.991023    0.000132    0.969171    0.999996    0.994734   1220.96   1284.30    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-249.399801
Model 2: PositiveSelection	-249.399752
Model 0: one-ratio	-249.39975
Model 7: beta	-249.399832
Model 8: beta&w>1	-249.399782


Model 0 vs 1	1.0199999996984843E-4

Model 2 vs 1	9.799999997994746E-5

Model 8 vs 7	1.0000000003174137E-4
>C1
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C2
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C3
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C4
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C5
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C6
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=64 

C1              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C2              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C3              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C4              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C5              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C6              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
                **************************************************

C1              SANDTQRVNSLLNG
C2              SANDTQRVNSLLNG
C3              SANDTQRVNSLLNG
C4              SANDTQRVNSLLNG
C5              SANDTQRVNSLLNG
C6              SANDTQRVNSLLNG
                **************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   64 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   64 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1920]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [1920]--->[1920]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.444 Mb, Max= 30.582 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C2              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C3              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C4              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C5              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C6              MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
                **************************************************

C1              SANDTQRVNSLLNG
C2              SANDTQRVNSLLNG
C3              SANDTQRVNSLLNG
C4              SANDTQRVNSLLNG
C5              SANDTQRVNSLLNG
C6              SANDTQRVNSLLNG
                **************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
C2              ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
C3              ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
C4              ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
C5              ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
C6              ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
                **************************************************

C1              CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
C2              CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
C3              CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
C4              CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
C5              CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
C6              CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
                **************************************************

C1              AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
C2              AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
C3              AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
C4              AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
C5              AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
C6              AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
                **************************************************

C1              TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
C2              TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
C3              TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
C4              TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
C5              TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
C6              TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
                ******************************************



>C1
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C2
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C3
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C4
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C5
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C6
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C1
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C2
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C3
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C4
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C5
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C6
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 192 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579791831
      Setting output file names to "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1364270936
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0146483075
      Seed = 1800838567
      Swapseed = 1579791831
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -429.705182 -- -24.965149
         Chain 2 -- -429.705141 -- -24.965149
         Chain 3 -- -429.705182 -- -24.965149
         Chain 4 -- -429.705206 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -429.705141 -- -24.965149
         Chain 2 -- -429.705206 -- -24.965149
         Chain 3 -- -429.705182 -- -24.965149
         Chain 4 -- -429.705206 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-429.705] (-429.705) (-429.705) (-429.705) * [-429.705] (-429.705) (-429.705) (-429.705) 
        500 -- [-265.712] (-264.740) (-288.256) (-271.905) * (-274.776) (-271.603) [-268.208] (-266.741) -- 0:00:00
       1000 -- (-270.227) [-273.920] (-272.685) (-274.640) * (-265.877) [-268.053] (-271.526) (-273.636) -- 0:00:00
       1500 -- [-271.027] (-275.568) (-278.255) (-275.390) * (-265.057) [-263.786] (-276.014) (-274.184) -- 0:00:00
       2000 -- [-269.456] (-276.912) (-272.226) (-270.750) * (-266.766) (-266.756) [-266.015] (-269.177) -- 0:00:00
       2500 -- (-281.408) (-271.274) (-276.619) [-269.315] * (-271.919) (-273.516) [-268.902] (-269.451) -- 0:00:00
       3000 -- [-272.035] (-271.911) (-271.038) (-265.747) * (-277.891) [-267.743] (-267.619) (-268.114) -- 0:00:00
       3500 -- (-267.478) (-279.089) [-273.178] (-269.761) * (-265.924) (-274.032) [-269.437] (-266.295) -- 0:00:00
       4000 -- (-272.534) (-268.609) (-267.989) [-263.810] * [-273.542] (-265.188) (-267.901) (-271.762) -- 0:00:00
       4500 -- (-268.511) (-273.401) (-269.223) [-268.006] * [-270.114] (-274.543) (-268.247) (-272.029) -- 0:00:00
       5000 -- (-268.256) (-265.426) (-266.590) [-266.426] * (-271.383) [-274.571] (-275.278) (-272.813) -- 0:00:00

      Average standard deviation of split frequencies: 0.081983

       5500 -- (-276.942) (-276.388) [-267.042] (-266.995) * (-270.487) (-269.699) (-273.892) [-271.027] -- 0:00:00
       6000 -- [-269.219] (-270.935) (-268.510) (-275.000) * (-273.939) (-267.831) (-271.649) [-269.439] -- 0:00:00
       6500 -- [-271.169] (-269.061) (-272.289) (-279.514) * (-267.445) [-274.859] (-271.477) (-265.144) -- 0:00:00
       7000 -- (-269.219) (-263.840) [-271.725] (-275.265) * (-278.339) (-272.369) [-272.100] (-272.639) -- 0:00:00
       7500 -- (-274.452) (-260.521) [-268.263] (-272.824) * (-270.275) (-269.502) [-266.788] (-271.997) -- 0:00:00
       8000 -- (-267.655) (-262.866) [-270.644] (-285.572) * (-277.346) (-270.152) (-277.829) [-272.032] -- 0:00:00
       8500 -- (-268.618) (-261.609) (-270.416) [-278.488] * (-284.044) (-276.108) (-276.332) [-269.519] -- 0:00:00
       9000 -- [-267.671] (-259.721) (-271.038) (-272.554) * [-270.440] (-273.259) (-268.068) (-279.477) -- 0:00:00
       9500 -- (-269.189) [-261.674] (-268.671) (-272.417) * [-270.242] (-278.500) (-274.338) (-276.058) -- 0:00:00
      10000 -- (-271.659) (-261.284) [-271.290] (-268.281) * (-270.782) (-273.292) [-271.125] (-273.309) -- 0:00:00

      Average standard deviation of split frequencies: 0.090493

      10500 -- [-269.812] (-261.271) (-274.835) (-259.843) * (-281.526) (-281.882) [-267.438] (-275.800) -- 0:00:00
      11000 -- (-269.338) (-261.258) (-275.948) [-259.591] * [-271.100] (-275.051) (-273.463) (-275.287) -- 0:00:00
      11500 -- [-269.333] (-260.082) (-269.618) (-265.202) * (-268.298) (-274.800) (-269.896) [-268.092] -- 0:00:00
      12000 -- (-269.207) (-269.735) (-264.944) [-260.184] * (-264.147) [-270.122] (-272.883) (-273.098) -- 0:00:00
      12500 -- (-272.100) (-260.129) (-259.615) [-259.705] * [-261.537] (-262.286) (-274.229) (-270.983) -- 0:00:00
      13000 -- (-278.345) (-259.383) [-261.085] (-260.730) * (-261.112) (-266.063) [-269.447] (-262.440) -- 0:00:00
      13500 -- (-275.579) (-263.226) [-261.084] (-262.594) * (-263.679) (-260.695) [-268.550] (-260.705) -- 0:00:00
      14000 -- (-276.770) (-263.855) [-259.147] (-262.682) * [-261.847] (-259.524) (-270.849) (-262.474) -- 0:00:00
      14500 -- [-262.449] (-259.464) (-262.789) (-263.407) * (-259.382) (-261.934) (-285.175) [-259.589] -- 0:01:07
      15000 -- (-263.800) [-260.973] (-261.433) (-262.400) * (-260.759) [-261.908] (-269.916) (-260.835) -- 0:01:05

      Average standard deviation of split frequencies: 0.091662

      15500 -- (-259.418) (-260.399) (-260.320) [-262.587] * (-264.189) [-259.119] (-263.259) (-264.021) -- 0:01:03
      16000 -- (-259.337) (-260.552) (-259.449) [-262.713] * (-259.942) (-260.381) [-275.254] (-259.856) -- 0:01:01
      16500 -- (-259.208) (-266.690) [-259.965] (-268.070) * (-263.747) [-260.785] (-266.445) (-260.583) -- 0:00:59
      17000 -- (-260.219) (-263.314) [-260.417] (-260.203) * [-262.352] (-263.469) (-270.519) (-259.823) -- 0:00:57
      17500 -- (-260.773) [-262.621] (-259.983) (-260.399) * (-261.369) (-260.142) (-267.183) [-260.952] -- 0:00:56
      18000 -- (-258.841) (-260.487) [-260.765] (-261.813) * [-261.054] (-259.824) (-274.800) (-259.833) -- 0:00:54
      18500 -- (-259.379) (-259.395) (-263.044) [-259.906] * (-259.151) [-259.813] (-273.591) (-260.305) -- 0:00:53
      19000 -- (-265.549) [-263.313] (-260.463) (-260.932) * (-262.594) (-259.843) (-273.544) [-261.948] -- 0:00:51
      19500 -- (-263.436) [-264.210] (-261.059) (-260.734) * [-265.926] (-260.445) (-270.269) (-261.364) -- 0:00:50
      20000 -- (-262.267) (-264.073) (-261.332) [-260.809] * [-259.250] (-260.260) (-273.329) (-261.272) -- 0:00:49

      Average standard deviation of split frequencies: 0.076480

      20500 -- (-263.276) (-262.602) [-259.885] (-261.101) * (-260.341) (-260.754) (-287.029) [-260.536] -- 0:00:47
      21000 -- (-259.646) (-260.082) [-260.818] (-262.689) * [-260.996] (-260.405) (-278.281) (-260.091) -- 0:00:46
      21500 -- (-261.733) [-260.545] (-260.053) (-260.726) * (-259.267) [-261.537] (-272.648) (-260.895) -- 0:00:45
      22000 -- (-260.852) (-261.405) [-261.263] (-260.914) * (-259.399) [-259.808] (-266.672) (-261.668) -- 0:00:44
      22500 -- (-261.120) [-259.835] (-262.272) (-261.670) * [-259.889] (-266.076) (-260.870) (-259.871) -- 0:00:43
      23000 -- (-261.902) [-260.583] (-261.799) (-262.713) * [-259.667] (-266.543) (-261.095) (-259.796) -- 0:00:42
      23500 -- (-262.656) [-261.054] (-264.315) (-263.597) * (-260.957) (-264.331) (-263.087) [-260.771] -- 0:00:41
      24000 -- (-262.853) (-258.920) [-272.467] (-260.445) * (-259.837) (-260.449) [-264.219] (-260.336) -- 0:00:40
      24500 -- (-260.831) (-259.821) [-261.086] (-260.350) * (-265.806) (-261.536) (-262.995) [-260.629] -- 0:00:39
      25000 -- (-263.693) (-260.510) (-263.391) [-259.546] * (-262.086) [-261.422] (-263.225) (-260.973) -- 0:00:39

      Average standard deviation of split frequencies: 0.067344

      25500 -- (-265.570) (-261.438) [-263.758] (-260.634) * [-260.701] (-259.656) (-260.663) (-263.998) -- 0:00:38
      26000 -- (-264.469) [-261.890] (-264.589) (-261.482) * (-261.137) [-264.070] (-260.466) (-260.884) -- 0:00:37
      26500 -- [-262.380] (-261.646) (-264.357) (-259.740) * [-261.528] (-268.172) (-263.312) (-264.533) -- 0:00:36
      27000 -- [-263.773] (-261.058) (-263.575) (-259.350) * [-263.386] (-265.117) (-261.436) (-259.632) -- 0:00:36
      27500 -- [-259.463] (-262.715) (-260.636) (-260.937) * (-262.276) (-264.493) (-263.097) [-259.262] -- 0:00:35
      28000 -- [-259.802] (-261.999) (-261.819) (-260.393) * (-261.355) (-263.091) (-267.090) [-261.870] -- 0:00:34
      28500 -- (-260.887) (-265.366) [-260.266] (-261.292) * [-262.714] (-259.471) (-271.311) (-262.213) -- 0:00:34
      29000 -- (-260.860) (-260.672) [-261.465] (-265.912) * (-261.107) [-261.119] (-263.473) (-263.406) -- 0:00:33
      29500 -- (-259.806) (-262.544) (-260.387) [-262.867] * (-261.991) (-263.649) (-259.967) [-260.599] -- 0:00:32
      30000 -- [-259.958] (-260.262) (-261.885) (-259.610) * (-268.828) [-260.698] (-263.633) (-261.801) -- 0:00:32

      Average standard deviation of split frequencies: 0.049733

      30500 -- (-260.919) [-260.430] (-260.289) (-262.992) * (-267.975) [-259.240] (-262.510) (-260.559) -- 0:00:31
      31000 -- (-263.255) (-261.826) (-259.701) [-263.055] * (-263.384) (-259.925) [-264.262] (-261.107) -- 0:00:31
      31500 -- (-262.112) [-259.997] (-262.279) (-262.013) * (-264.561) (-261.011) (-262.451) [-259.590] -- 0:01:01
      32000 -- (-259.805) (-263.048) [-261.262] (-261.525) * (-266.990) (-260.844) [-263.626] (-260.135) -- 0:01:00
      32500 -- (-262.274) (-259.929) [-261.070] (-259.884) * (-262.208) [-259.546] (-264.014) (-260.248) -- 0:00:59
      33000 -- [-262.685] (-260.648) (-262.948) (-261.891) * [-265.470] (-263.751) (-263.352) (-261.494) -- 0:00:58
      33500 -- (-262.569) (-261.381) [-261.842] (-262.192) * (-261.693) (-261.272) [-259.861] (-260.786) -- 0:00:57
      34000 -- (-260.437) (-260.703) [-261.727] (-267.889) * (-259.699) (-259.985) (-262.877) [-260.001] -- 0:00:56
      34500 -- (-260.315) (-260.455) [-263.101] (-261.418) * (-263.199) [-260.939] (-261.935) (-263.889) -- 0:00:55
      35000 -- (-260.351) (-260.683) [-262.357] (-262.033) * (-263.570) (-261.195) (-266.028) [-265.641] -- 0:00:55

      Average standard deviation of split frequencies: 0.042557

      35500 -- [-260.935] (-262.412) (-260.651) (-263.614) * (-262.081) [-261.383] (-260.179) (-265.367) -- 0:00:54
      36000 -- [-264.503] (-259.391) (-259.732) (-260.772) * [-259.479] (-262.093) (-263.629) (-261.389) -- 0:00:53
      36500 -- (-262.153) (-259.662) (-259.582) [-259.328] * [-259.493] (-260.298) (-261.230) (-261.434) -- 0:00:52
      37000 -- (-260.476) (-261.073) (-261.118) [-259.098] * (-260.694) [-259.804] (-263.393) (-260.234) -- 0:00:52
      37500 -- (-258.936) (-265.770) (-262.961) [-258.963] * (-261.518) [-261.190] (-260.907) (-260.268) -- 0:00:51
      38000 -- [-262.214] (-263.833) (-261.423) (-259.248) * (-261.711) (-260.861) [-262.667] (-262.002) -- 0:00:50
      38500 -- (-259.570) (-259.626) [-260.593] (-259.271) * (-260.337) (-263.812) (-260.470) [-260.385] -- 0:00:49
      39000 -- (-261.628) (-260.432) (-263.563) [-265.255] * (-263.301) (-262.331) (-265.313) [-261.186] -- 0:00:49
      39500 -- [-261.358] (-263.748) (-264.433) (-265.759) * [-261.586] (-260.195) (-262.091) (-261.029) -- 0:00:48
      40000 -- [-261.145] (-261.731) (-261.790) (-260.542) * (-262.973) [-259.748] (-262.300) (-264.683) -- 0:00:48

      Average standard deviation of split frequencies: 0.047527

      40500 -- (-260.492) [-264.051] (-263.653) (-259.631) * (-262.100) [-260.475] (-261.497) (-260.841) -- 0:00:47
      41000 -- (-258.988) (-261.772) (-264.092) [-260.737] * [-259.433] (-261.252) (-260.504) (-260.020) -- 0:00:46
      41500 -- (-262.306) [-259.476] (-260.837) (-259.048) * (-261.118) (-259.534) (-260.355) [-261.673] -- 0:00:46
      42000 -- (-263.994) (-260.381) (-263.640) [-259.805] * [-260.737] (-265.189) (-266.543) (-262.316) -- 0:00:45
      42500 -- [-259.522] (-261.029) (-262.152) (-260.782) * (-263.244) [-264.316] (-262.966) (-260.556) -- 0:00:45
      43000 -- [-261.166] (-262.949) (-260.062) (-260.486) * (-263.286) (-265.478) [-261.738] (-260.404) -- 0:00:44
      43500 -- (-260.312) (-262.856) (-260.108) [-261.545] * [-260.820] (-265.559) (-259.144) (-260.522) -- 0:00:43
      44000 -- [-260.885] (-262.540) (-264.440) (-260.361) * (-261.366) (-262.608) (-259.937) [-261.005] -- 0:00:43
      44500 -- [-259.301] (-261.342) (-261.052) (-259.857) * (-260.575) [-261.626] (-260.377) (-263.258) -- 0:00:42
      45000 -- [-259.409] (-262.802) (-260.405) (-259.970) * [-259.949] (-261.245) (-263.107) (-261.658) -- 0:00:42

      Average standard deviation of split frequencies: 0.044556

      45500 -- (-260.629) [-260.076] (-262.312) (-262.414) * [-259.462] (-261.118) (-260.685) (-262.275) -- 0:00:41
      46000 -- (-264.590) (-261.181) (-263.056) [-259.835] * (-262.506) (-262.902) [-262.200] (-261.708) -- 0:00:41
      46500 -- (-262.819) (-261.813) [-259.282] (-259.765) * (-261.516) (-263.690) [-260.689] (-262.194) -- 0:01:01
      47000 -- (-260.428) (-262.772) [-262.060] (-260.126) * (-262.028) [-261.863] (-261.424) (-268.817) -- 0:01:00
      47500 -- (-260.439) (-261.099) [-260.827] (-259.692) * (-264.189) (-260.682) (-261.040) [-267.102] -- 0:01:00
      48000 -- (-259.427) (-264.274) (-261.436) [-260.820] * (-265.702) [-259.942] (-262.045) (-261.342) -- 0:00:59
      48500 -- (-262.351) [-270.585] (-261.195) (-262.755) * (-262.081) (-262.094) (-260.516) [-261.759] -- 0:00:58
      49000 -- [-261.007] (-261.469) (-262.025) (-266.624) * [-260.517] (-259.799) (-260.510) (-259.488) -- 0:00:58
      49500 -- (-260.886) [-260.126] (-260.942) (-264.804) * [-261.262] (-262.512) (-261.119) (-260.237) -- 0:00:57
      50000 -- (-261.419) (-259.491) [-260.362] (-263.622) * (-259.907) (-260.353) [-259.979] (-263.552) -- 0:00:57

      Average standard deviation of split frequencies: 0.042333

      50500 -- (-263.067) (-260.022) [-260.837] (-260.333) * (-260.590) [-262.317] (-260.597) (-264.438) -- 0:00:56
      51000 -- (-261.033) (-265.984) (-260.032) [-264.152] * (-264.740) (-260.979) (-266.362) [-259.750] -- 0:00:55
      51500 -- (-260.412) (-260.813) [-260.257] (-259.338) * (-260.157) (-260.336) (-260.806) [-260.217] -- 0:00:55
      52000 -- [-259.799] (-260.283) (-260.551) (-260.888) * (-259.398) (-259.278) (-260.877) [-263.856] -- 0:00:54
      52500 -- (-261.619) (-261.535) (-262.187) [-262.190] * [-259.248] (-259.294) (-261.137) (-261.173) -- 0:00:54
      53000 -- (-263.290) (-264.907) (-262.201) [-259.287] * (-260.092) [-261.281] (-263.077) (-261.354) -- 0:00:53
      53500 -- (-262.248) [-266.207] (-262.548) (-264.260) * [-259.424] (-260.978) (-262.090) (-259.525) -- 0:00:53
      54000 -- [-261.026] (-260.373) (-260.942) (-262.223) * (-262.173) [-262.034] (-267.128) (-261.318) -- 0:00:52
      54500 -- (-260.821) (-260.881) [-261.179] (-261.307) * (-260.526) (-263.627) [-260.631] (-260.146) -- 0:00:52
      55000 -- [-259.847] (-260.428) (-259.295) (-259.813) * (-263.503) [-262.856] (-261.667) (-261.153) -- 0:00:51

      Average standard deviation of split frequencies: 0.036879

      55500 -- [-259.813] (-260.043) (-261.377) (-263.602) * [-265.741] (-263.473) (-263.530) (-262.321) -- 0:00:51
      56000 -- (-259.046) (-261.853) [-259.642] (-260.753) * (-262.185) [-261.693] (-265.185) (-261.432) -- 0:00:50
      56500 -- (-260.310) (-259.520) (-260.962) [-259.774] * [-260.959] (-261.113) (-262.155) (-263.688) -- 0:00:50
      57000 -- (-262.823) (-263.547) (-262.170) [-261.189] * (-261.150) [-259.396] (-262.735) (-263.138) -- 0:00:49
      57500 -- (-263.202) (-260.640) [-263.528] (-261.930) * (-260.508) (-263.581) (-261.195) [-260.564] -- 0:00:49
      58000 -- [-261.895] (-259.387) (-262.332) (-261.919) * (-260.083) (-262.749) [-259.919] (-259.605) -- 0:00:48
      58500 -- (-259.993) (-260.005) [-260.678] (-263.191) * (-261.055) (-260.796) [-259.637] (-261.904) -- 0:00:48
      59000 -- (-260.657) (-259.009) [-260.641] (-265.276) * (-260.394) (-261.655) (-260.877) [-264.951] -- 0:00:47
      59500 -- [-261.213] (-260.069) (-263.939) (-265.327) * (-261.578) [-260.479] (-260.363) (-264.935) -- 0:00:47
      60000 -- [-263.256] (-261.886) (-261.360) (-261.654) * (-263.394) (-259.461) (-260.434) [-263.967] -- 0:00:47

      Average standard deviation of split frequencies: 0.030673

      60500 -- (-261.532) (-265.476) [-259.801] (-260.221) * (-261.271) (-263.080) [-261.571] (-261.310) -- 0:00:46
      61000 -- [-259.821] (-263.600) (-260.255) (-260.820) * (-262.466) (-263.911) (-259.437) [-262.926] -- 0:00:46
      61500 -- (-265.374) (-260.715) (-260.534) [-261.448] * (-262.545) [-258.947] (-264.984) (-262.298) -- 0:00:45
      62000 -- [-259.512] (-263.576) (-259.750) (-260.102) * (-262.316) (-263.483) [-259.509] (-265.402) -- 0:01:00
      62500 -- (-259.216) (-265.472) (-262.544) [-260.018] * [-260.497] (-261.019) (-261.642) (-262.172) -- 0:01:00
      63000 -- (-261.246) (-260.730) [-260.403] (-261.388) * (-262.777) [-263.672] (-261.520) (-264.495) -- 0:00:59
      63500 -- [-259.514] (-261.206) (-260.421) (-262.393) * [-261.014] (-262.890) (-264.260) (-263.683) -- 0:00:58
      64000 -- (-259.545) (-262.092) (-261.583) [-261.138] * (-262.456) (-263.885) [-263.683] (-265.267) -- 0:00:58
      64500 -- (-266.742) (-260.170) (-259.125) [-261.377] * (-260.219) [-261.497] (-263.669) (-261.740) -- 0:00:58
      65000 -- (-259.558) (-261.919) [-262.553] (-265.616) * (-261.501) (-260.331) [-260.070] (-266.398) -- 0:00:57

      Average standard deviation of split frequencies: 0.027596

      65500 -- [-259.200] (-260.663) (-262.753) (-262.221) * (-264.044) [-262.666] (-262.793) (-260.280) -- 0:00:57
      66000 -- [-259.870] (-263.128) (-261.345) (-260.812) * [-261.482] (-269.911) (-260.136) (-260.538) -- 0:00:56
      66500 -- (-260.700) (-260.209) (-261.151) [-259.651] * (-261.954) (-263.920) [-261.194] (-266.258) -- 0:00:56
      67000 -- [-259.444] (-261.350) (-260.899) (-259.743) * [-265.339] (-265.841) (-262.070) (-261.739) -- 0:00:55
      67500 -- (-259.256) [-259.849] (-265.615) (-261.929) * (-263.626) [-263.138] (-259.332) (-261.205) -- 0:00:55
      68000 -- (-263.725) (-263.622) (-268.055) [-261.282] * (-263.724) (-262.465) (-262.366) [-259.349] -- 0:00:54
      68500 -- (-268.777) (-262.608) (-264.725) [-259.969] * (-261.346) (-260.292) [-261.553] (-259.514) -- 0:00:54
      69000 -- (-265.787) (-263.211) [-261.901] (-259.362) * (-262.076) (-261.342) [-261.907] (-260.216) -- 0:00:53
      69500 -- (-263.608) (-260.375) [-259.721] (-262.332) * (-263.695) (-261.147) [-264.683] (-261.789) -- 0:00:53
      70000 -- (-261.358) [-259.000] (-260.741) (-259.845) * (-265.859) (-259.127) [-261.337] (-260.731) -- 0:00:53

      Average standard deviation of split frequencies: 0.027636

      70500 -- [-262.312] (-260.384) (-263.136) (-261.067) * (-259.632) (-259.920) (-266.280) [-259.585] -- 0:00:52
      71000 -- (-264.235) (-262.099) (-261.206) [-262.534] * (-260.115) (-261.394) (-263.860) [-259.743] -- 0:00:52
      71500 -- (-260.533) [-260.762] (-265.304) (-262.140) * (-259.665) (-263.891) [-262.534] (-259.993) -- 0:00:51
      72000 -- (-265.406) (-260.881) (-259.787) [-261.077] * (-261.365) [-261.192] (-262.296) (-261.937) -- 0:00:51
      72500 -- [-260.738] (-259.380) (-263.277) (-260.792) * (-261.206) (-260.664) (-263.090) [-260.994] -- 0:00:51
      73000 -- (-261.697) [-263.998] (-263.310) (-261.932) * (-260.385) (-263.825) [-262.818] (-259.343) -- 0:00:50
      73500 -- (-260.749) (-259.655) [-260.161] (-260.862) * (-261.310) [-262.082] (-265.641) (-259.549) -- 0:00:50
      74000 -- (-260.830) (-260.620) [-263.313] (-260.907) * (-262.377) (-261.100) [-260.326] (-259.723) -- 0:00:50
      74500 -- [-260.067] (-260.029) (-266.470) (-262.397) * (-263.332) [-260.968] (-260.540) (-263.725) -- 0:00:49
      75000 -- (-262.785) [-259.849] (-262.230) (-261.695) * [-261.592] (-261.002) (-259.946) (-260.895) -- 0:00:49

      Average standard deviation of split frequencies: 0.023880

      75500 -- (-269.970) (-262.859) (-259.380) [-260.128] * [-260.426] (-266.166) (-260.421) (-260.962) -- 0:00:48
      76000 -- (-262.157) (-263.935) (-264.375) [-263.012] * (-260.292) (-261.850) [-261.668] (-261.283) -- 0:00:48
      76500 -- (-259.546) (-264.669) (-263.951) [-263.742] * [-263.181] (-260.850) (-260.178) (-259.995) -- 0:00:48
      77000 -- (-261.737) (-260.101) (-264.223) [-260.311] * (-261.100) (-260.493) [-260.225] (-263.600) -- 0:00:59
      77500 -- [-261.140] (-259.690) (-260.589) (-271.535) * [-261.123] (-260.886) (-260.647) (-260.762) -- 0:00:59
      78000 -- [-259.824] (-260.643) (-261.271) (-262.201) * (-259.886) (-260.704) [-259.164] (-260.825) -- 0:00:59
      78500 -- (-260.767) (-259.756) [-261.177] (-260.987) * (-261.513) (-260.411) (-259.390) [-260.506] -- 0:00:58
      79000 -- (-260.012) (-261.293) [-260.605] (-261.330) * [-260.777] (-260.830) (-262.929) (-260.195) -- 0:00:58
      79500 -- [-260.320] (-262.579) (-261.493) (-262.751) * (-261.272) [-261.400] (-261.533) (-260.162) -- 0:00:57
      80000 -- (-264.025) (-263.723) (-261.759) [-263.729] * (-261.003) (-264.603) [-262.916] (-259.970) -- 0:00:57

      Average standard deviation of split frequencies: 0.024836

      80500 -- [-260.881] (-262.776) (-261.544) (-262.810) * (-262.333) (-265.971) [-263.236] (-260.781) -- 0:00:57
      81000 -- (-260.728) (-262.129) [-260.974] (-263.861) * (-261.104) [-260.593] (-260.910) (-265.599) -- 0:00:56
      81500 -- (-261.244) (-259.339) [-260.660] (-261.210) * (-260.283) (-260.665) (-261.269) [-262.888] -- 0:00:56
      82000 -- [-261.996] (-263.761) (-261.812) (-261.897) * (-260.409) (-259.671) [-260.479] (-263.503) -- 0:00:55
      82500 -- (-262.421) [-263.814] (-259.460) (-261.114) * (-263.378) (-259.914) [-260.878] (-262.508) -- 0:00:55
      83000 -- (-261.827) (-261.212) [-263.771] (-261.317) * (-263.836) (-260.193) [-261.782] (-261.635) -- 0:00:55
      83500 -- [-263.268] (-261.477) (-260.114) (-264.353) * [-261.757] (-261.612) (-261.594) (-260.350) -- 0:00:54
      84000 -- (-259.772) [-260.320] (-261.372) (-263.710) * (-260.176) (-261.865) [-260.968] (-263.652) -- 0:00:54
      84500 -- (-261.577) (-260.085) [-260.991] (-263.109) * (-258.943) (-260.669) [-260.361] (-259.286) -- 0:00:54
      85000 -- (-262.127) (-261.513) [-261.501] (-261.336) * (-260.172) (-264.455) [-260.285] (-259.904) -- 0:00:53

      Average standard deviation of split frequencies: 0.024275

      85500 -- [-261.064] (-264.658) (-262.016) (-262.795) * (-261.417) [-262.017] (-262.710) (-259.256) -- 0:00:53
      86000 -- [-260.301] (-259.922) (-259.216) (-260.858) * (-262.716) [-259.377] (-260.495) (-260.482) -- 0:00:53
      86500 -- (-260.819) [-261.944] (-266.906) (-260.578) * (-262.588) [-260.821] (-261.201) (-260.061) -- 0:00:52
      87000 -- [-261.013] (-262.082) (-268.121) (-265.300) * (-262.691) (-262.070) (-261.865) [-262.972] -- 0:00:52
      87500 -- (-263.832) [-260.548] (-260.029) (-268.481) * [-263.110] (-265.858) (-261.834) (-262.064) -- 0:00:52
      88000 -- [-260.750] (-260.252) (-260.099) (-267.975) * (-261.843) (-263.042) (-259.767) [-263.318] -- 0:00:51
      88500 -- (-260.145) [-264.247] (-268.337) (-261.208) * [-260.399] (-262.876) (-261.275) (-261.805) -- 0:00:51
      89000 -- (-259.516) (-259.845) (-261.437) [-259.413] * (-262.796) (-263.032) [-261.617] (-260.386) -- 0:00:51
      89500 -- (-260.467) [-260.862] (-262.360) (-259.873) * (-265.858) [-259.957] (-264.972) (-259.447) -- 0:00:50
      90000 -- (-260.165) (-263.998) (-260.912) [-260.053] * (-259.834) (-260.435) (-260.494) [-260.442] -- 0:00:50

      Average standard deviation of split frequencies: 0.023137

      90500 -- (-261.130) [-261.006] (-260.640) (-262.068) * [-263.138] (-260.600) (-261.486) (-263.717) -- 0:00:50
      91000 -- [-260.709] (-260.892) (-259.470) (-268.036) * [-261.163] (-262.887) (-262.324) (-260.147) -- 0:00:49
      91500 -- (-260.773) [-262.663] (-262.431) (-264.224) * [-263.007] (-259.701) (-259.832) (-264.918) -- 0:00:49
      92000 -- (-267.629) [-268.448] (-260.851) (-261.706) * (-261.440) (-261.421) [-261.604] (-259.911) -- 0:00:59
      92500 -- (-260.110) (-260.046) [-260.058] (-262.683) * (-263.502) [-259.636] (-262.000) (-261.125) -- 0:00:58
      93000 -- (-260.429) [-263.673] (-260.009) (-260.978) * (-262.007) [-259.923] (-262.213) (-262.075) -- 0:00:58
      93500 -- (-261.952) [-260.290] (-262.239) (-262.209) * (-260.803) (-263.894) (-259.468) [-261.361] -- 0:00:58
      94000 -- (-260.360) [-261.032] (-260.502) (-260.042) * [-260.669] (-261.203) (-260.685) (-259.578) -- 0:00:57
      94500 -- [-260.514] (-260.213) (-261.047) (-261.679) * [-259.792] (-263.215) (-261.713) (-262.656) -- 0:00:57
      95000 -- (-259.919) (-260.757) [-261.078] (-261.603) * (-259.656) (-261.048) [-262.558] (-262.807) -- 0:00:57

      Average standard deviation of split frequencies: 0.021361

      95500 -- (-259.618) (-259.817) (-263.387) [-259.931] * [-259.732] (-266.788) (-260.585) (-261.652) -- 0:00:56
      96000 -- [-259.646] (-260.097) (-261.264) (-260.560) * (-262.311) (-262.386) [-259.787] (-260.751) -- 0:00:56
      96500 -- (-260.871) (-261.029) [-263.056] (-261.860) * (-264.332) [-261.747] (-263.042) (-265.008) -- 0:00:56
      97000 -- (-261.412) (-260.478) (-260.685) [-261.421] * (-261.682) [-260.242] (-264.783) (-263.164) -- 0:00:55
      97500 -- (-261.593) [-259.665] (-260.781) (-262.210) * (-261.351) (-264.454) (-261.734) [-263.868] -- 0:00:55
      98000 -- [-266.364] (-261.469) (-261.996) (-262.871) * [-261.812] (-259.776) (-260.440) (-262.998) -- 0:00:55
      98500 -- (-263.144) (-259.462) (-259.768) [-259.308] * [-261.217] (-259.142) (-259.349) (-261.360) -- 0:00:54
      99000 -- (-263.955) (-260.225) [-259.774] (-266.253) * (-261.775) [-260.686] (-260.571) (-261.270) -- 0:00:54
      99500 -- (-263.841) (-260.392) [-260.281] (-259.335) * [-265.559] (-261.835) (-259.863) (-261.630) -- 0:00:54
      100000 -- (-261.604) [-260.080] (-264.441) (-260.648) * (-261.790) (-262.012) (-262.730) [-263.502] -- 0:00:54

      Average standard deviation of split frequencies: 0.019772

      100500 -- [-262.718] (-261.521) (-262.579) (-261.235) * [-260.461] (-261.422) (-261.016) (-263.321) -- 0:00:53
      101000 -- (-259.449) (-260.812) [-262.336] (-259.593) * (-263.828) [-260.950] (-261.461) (-266.174) -- 0:00:53
      101500 -- [-259.999] (-265.851) (-260.395) (-261.511) * (-263.346) (-259.588) (-262.027) [-260.248] -- 0:00:53
      102000 -- (-262.598) [-260.957] (-261.085) (-266.546) * (-262.418) (-260.345) (-260.479) [-261.042] -- 0:00:52
      102500 -- (-260.969) (-260.432) (-260.651) [-260.763] * (-261.570) (-261.196) (-261.854) [-265.076] -- 0:00:52
      103000 -- (-261.065) (-261.053) (-262.590) [-262.565] * (-259.913) [-262.516] (-261.121) (-262.742) -- 0:00:52
      103500 -- (-261.418) (-261.078) [-260.243] (-259.681) * (-264.375) (-261.153) (-263.950) [-261.761] -- 0:00:51
      104000 -- (-261.990) (-260.219) (-261.305) [-259.883] * (-264.785) [-263.026] (-260.863) (-260.434) -- 0:00:51
      104500 -- [-260.003] (-262.449) (-263.477) (-263.729) * (-259.622) (-268.423) (-262.834) [-260.640] -- 0:00:51
      105000 -- (-262.107) [-260.073] (-262.593) (-263.403) * [-261.462] (-263.945) (-264.567) (-267.207) -- 0:00:51

      Average standard deviation of split frequencies: 0.018530

      105500 -- (-262.312) (-261.714) [-262.141] (-261.024) * (-260.418) (-265.485) (-260.695) [-262.304] -- 0:00:59
      106000 -- (-262.784) (-263.090) (-259.857) [-260.535] * (-260.889) (-262.929) [-261.055] (-262.845) -- 0:00:59
      106500 -- (-261.141) [-260.001] (-261.974) (-260.295) * [-259.313] (-261.180) (-259.837) (-266.579) -- 0:00:58
      107000 -- [-261.710] (-259.475) (-261.618) (-263.097) * (-261.549) [-261.087] (-260.928) (-262.715) -- 0:00:58
      107500 -- (-262.776) (-260.715) [-264.471] (-259.912) * (-260.298) (-260.559) [-263.683] (-265.028) -- 0:00:58
      108000 -- (-260.244) (-261.170) [-260.984] (-261.197) * (-262.701) (-262.251) [-262.826] (-270.018) -- 0:00:57
      108500 -- (-262.391) [-259.977] (-261.569) (-259.765) * (-271.104) [-260.705] (-260.727) (-263.481) -- 0:00:57
      109000 -- (-263.641) [-261.496] (-261.949) (-259.187) * (-261.758) (-259.660) [-261.606] (-260.531) -- 0:00:57
      109500 -- (-266.484) (-260.355) (-261.963) [-259.165] * (-266.290) (-260.408) [-260.906] (-260.264) -- 0:00:56
      110000 -- (-261.221) (-261.397) (-263.616) [-265.472] * [-263.693] (-262.967) (-260.019) (-260.053) -- 0:00:56

      Average standard deviation of split frequencies: 0.018832

      110500 -- (-263.433) [-260.944] (-261.321) (-264.341) * (-271.322) (-263.431) (-261.047) [-260.340] -- 0:00:56
      111000 -- (-259.111) [-260.292] (-263.273) (-261.607) * (-262.297) [-262.514] (-260.539) (-259.529) -- 0:00:56
      111500 -- [-260.538] (-261.957) (-261.554) (-261.524) * (-262.123) [-262.013] (-260.779) (-260.868) -- 0:00:55
      112000 -- (-262.036) (-261.393) [-260.758] (-260.089) * [-260.261] (-260.165) (-262.229) (-262.102) -- 0:00:55
      112500 -- (-262.810) (-261.482) (-263.643) [-259.877] * [-259.853] (-259.725) (-260.757) (-259.523) -- 0:00:55
      113000 -- [-261.165] (-260.411) (-262.199) (-262.778) * (-261.356) [-261.177] (-259.751) (-261.257) -- 0:00:54
      113500 -- (-264.281) [-259.864] (-262.620) (-266.846) * (-259.991) [-260.489] (-259.240) (-263.321) -- 0:00:54
      114000 -- (-260.191) [-260.713] (-261.459) (-261.194) * (-259.630) (-263.417) (-262.254) [-259.771] -- 0:00:54
      114500 -- [-259.457] (-267.483) (-260.836) (-263.989) * (-261.001) [-261.259] (-261.271) (-263.893) -- 0:00:54
      115000 -- (-259.995) (-267.061) [-261.711] (-260.216) * (-259.766) (-263.704) (-259.861) [-263.253] -- 0:00:53

      Average standard deviation of split frequencies: 0.021175

      115500 -- (-263.526) (-263.419) [-259.724] (-260.669) * (-261.610) [-261.272] (-261.337) (-260.817) -- 0:00:53
      116000 -- [-259.409] (-260.234) (-262.858) (-262.745) * (-261.531) [-259.918] (-261.031) (-262.339) -- 0:00:53
      116500 -- [-260.628] (-259.745) (-262.480) (-259.978) * [-261.900] (-261.110) (-262.168) (-261.664) -- 0:00:53
      117000 -- (-261.424) [-260.336] (-261.331) (-260.953) * [-259.830] (-263.597) (-263.761) (-263.009) -- 0:00:52
      117500 -- [-262.887] (-267.055) (-265.028) (-268.048) * (-259.884) (-263.712) [-259.640] (-262.127) -- 0:00:52
      118000 -- (-261.669) [-265.004] (-262.366) (-261.094) * (-261.465) [-267.656] (-259.972) (-262.276) -- 0:00:52
      118500 -- (-260.579) [-259.083] (-262.615) (-261.335) * (-259.630) (-262.223) [-261.562] (-265.542) -- 0:00:52
      119000 -- (-261.525) [-262.123] (-263.665) (-262.706) * [-264.500] (-264.659) (-262.746) (-262.689) -- 0:00:51
      119500 -- (-261.794) [-260.362] (-261.613) (-262.076) * (-260.764) [-264.181] (-262.852) (-259.385) -- 0:00:58
      120000 -- (-260.148) [-261.491] (-264.589) (-261.102) * (-261.222) (-260.473) [-261.895] (-261.337) -- 0:00:58

      Average standard deviation of split frequencies: 0.022618

      120500 -- [-259.885] (-260.596) (-264.246) (-263.180) * (-261.852) (-261.671) (-265.587) [-259.270] -- 0:00:58
      121000 -- (-260.737) (-259.728) (-264.628) [-258.900] * (-259.908) [-262.264] (-260.669) (-262.260) -- 0:00:58
      121500 -- (-262.269) [-262.899] (-262.917) (-263.511) * (-259.603) [-262.291] (-264.183) (-259.851) -- 0:00:57
      122000 -- [-260.676] (-262.793) (-263.252) (-260.799) * (-259.527) (-260.482) (-260.214) [-264.237] -- 0:00:57
      122500 -- (-261.204) (-263.380) [-259.807] (-264.802) * [-259.603] (-260.995) (-262.166) (-260.507) -- 0:00:57
      123000 -- [-259.232] (-259.806) (-259.650) (-262.879) * (-260.092) (-259.736) (-263.436) [-260.672] -- 0:00:57
      123500 -- (-259.714) (-260.744) [-261.115] (-260.643) * (-262.791) [-259.440] (-263.141) (-260.695) -- 0:00:56
      124000 -- (-259.488) (-265.851) [-264.040] (-259.502) * (-263.327) (-259.562) (-260.115) [-259.518] -- 0:00:56
      124500 -- [-260.588] (-265.991) (-263.253) (-259.458) * (-264.043) (-260.511) (-262.455) [-261.326] -- 0:00:56
      125000 -- (-261.102) [-265.212] (-263.156) (-261.130) * [-262.241] (-260.052) (-260.407) (-262.261) -- 0:00:56

      Average standard deviation of split frequencies: 0.024023

      125500 -- [-261.413] (-260.615) (-259.431) (-263.668) * (-263.028) (-261.438) (-265.287) [-262.465] -- 0:00:55
      126000 -- (-258.901) (-260.749) (-262.396) [-260.882] * (-263.623) (-261.653) [-267.632] (-261.838) -- 0:00:55
      126500 -- [-258.901] (-259.498) (-259.304) (-261.617) * (-262.348) [-264.419] (-266.638) (-263.167) -- 0:00:55
      127000 -- (-261.541) (-260.341) [-263.605] (-261.197) * (-264.728) (-262.186) [-265.145] (-265.702) -- 0:00:54
      127500 -- (-261.156) (-261.987) (-265.422) [-262.481] * [-261.342] (-262.752) (-260.715) (-268.082) -- 0:00:54
      128000 -- [-260.711] (-261.404) (-263.386) (-261.739) * (-260.814) (-263.439) (-259.440) [-263.424] -- 0:00:54
      128500 -- (-260.394) [-259.559] (-262.956) (-263.985) * (-263.502) [-261.067] (-260.780) (-261.736) -- 0:00:54
      129000 -- (-261.890) (-259.634) (-262.642) [-259.751] * [-261.032] (-267.614) (-261.163) (-265.391) -- 0:00:54
      129500 -- (-259.010) (-259.798) [-260.141] (-262.292) * (-259.818) (-259.017) (-260.388) [-263.605] -- 0:00:53
      130000 -- (-260.548) [-259.523] (-261.350) (-265.205) * (-262.082) [-261.841] (-263.663) (-263.119) -- 0:00:53

      Average standard deviation of split frequencies: 0.019842

      130500 -- (-265.224) [-260.941] (-261.240) (-263.213) * [-261.774] (-263.235) (-261.590) (-260.620) -- 0:00:53
      131000 -- (-261.876) (-259.384) (-264.947) [-260.986] * (-260.526) (-263.871) (-264.691) [-260.714] -- 0:00:53
      131500 -- (-262.892) (-263.055) (-262.644) [-263.238] * (-260.735) (-265.058) [-260.198] (-261.213) -- 0:00:52
      132000 -- [-266.820] (-261.137) (-261.764) (-261.424) * (-263.775) (-264.897) [-262.046] (-260.522) -- 0:00:59
      132500 -- (-265.574) (-259.157) (-260.451) [-261.394] * [-259.438] (-264.242) (-261.820) (-260.144) -- 0:00:58
      133000 -- (-264.869) (-263.095) (-260.200) [-261.916] * (-259.415) (-260.953) (-259.548) [-261.158] -- 0:00:58
      133500 -- (-265.997) [-260.106] (-259.460) (-260.081) * [-259.585] (-261.034) (-262.682) (-260.349) -- 0:00:58
      134000 -- (-266.684) [-262.885] (-259.824) (-259.246) * [-262.593] (-261.716) (-260.126) (-261.928) -- 0:00:58
      134500 -- (-262.731) (-261.360) (-262.149) [-260.129] * (-259.957) [-266.062] (-260.413) (-261.465) -- 0:00:57
      135000 -- (-261.070) (-260.909) [-259.881] (-260.257) * (-260.635) [-261.717] (-261.294) (-259.772) -- 0:00:57

      Average standard deviation of split frequencies: 0.020104

      135500 -- [-260.889] (-261.138) (-261.788) (-260.417) * [-260.327] (-260.312) (-260.415) (-261.473) -- 0:00:57
      136000 -- [-259.407] (-259.864) (-263.494) (-262.270) * [-261.488] (-262.219) (-259.780) (-262.084) -- 0:00:57
      136500 -- (-259.434) (-261.699) (-261.786) [-259.989] * (-259.676) [-259.858] (-260.623) (-263.482) -- 0:00:56
      137000 -- (-260.429) [-260.903] (-261.615) (-265.302) * (-261.020) (-259.851) (-263.121) [-260.908] -- 0:00:56
      137500 -- (-263.362) [-259.377] (-263.967) (-262.258) * (-261.337) (-260.353) [-263.766] (-260.161) -- 0:00:56
      138000 -- [-261.617] (-261.161) (-261.478) (-260.234) * (-261.086) (-260.159) [-266.955] (-260.915) -- 0:00:56
      138500 -- (-263.317) [-262.031] (-262.679) (-259.029) * (-262.931) (-261.599) (-261.212) [-261.280] -- 0:00:55
      139000 -- (-261.279) [-263.163] (-259.165) (-259.905) * [-259.583] (-262.132) (-262.125) (-260.399) -- 0:00:55
      139500 -- [-260.782] (-262.630) (-260.506) (-259.355) * (-260.947) (-259.813) [-260.857] (-259.025) -- 0:00:55
      140000 -- (-260.137) (-259.795) (-259.831) [-259.756] * (-265.381) (-260.349) (-259.918) [-259.226] -- 0:00:55

      Average standard deviation of split frequencies: 0.020293

      140500 -- (-259.729) (-261.480) [-261.614] (-259.990) * (-263.366) (-260.913) [-264.214] (-261.378) -- 0:00:55
      141000 -- (-259.794) (-261.372) [-261.887] (-261.661) * (-260.853) (-264.163) (-262.290) [-260.867] -- 0:00:54
      141500 -- (-262.071) [-260.397] (-265.367) (-260.510) * [-262.865] (-260.604) (-263.123) (-260.475) -- 0:00:54
      142000 -- [-260.302] (-260.013) (-261.085) (-261.127) * (-263.402) (-260.656) (-261.669) [-262.514] -- 0:00:54
      142500 -- [-259.191] (-259.782) (-261.112) (-264.166) * [-261.527] (-261.152) (-265.817) (-261.800) -- 0:00:54
      143000 -- (-260.575) [-262.627] (-262.059) (-259.998) * (-259.311) (-263.295) (-260.437) [-261.963] -- 0:00:53
      143500 -- (-260.111) (-262.508) [-262.703] (-260.419) * [-259.340] (-260.844) (-262.167) (-261.902) -- 0:00:53
      144000 -- (-260.161) (-263.224) [-259.269] (-261.962) * [-259.440] (-260.859) (-259.900) (-261.227) -- 0:00:53
      144500 -- [-259.953] (-261.077) (-261.967) (-263.090) * (-261.606) (-263.867) [-261.390] (-261.404) -- 0:00:59
      145000 -- (-259.543) [-263.869] (-259.602) (-265.371) * (-264.500) (-262.097) [-262.472] (-260.049) -- 0:00:58

      Average standard deviation of split frequencies: 0.021794

      145500 -- (-260.237) (-267.987) [-259.433] (-263.450) * (-265.114) (-261.946) (-265.828) [-262.568] -- 0:00:58
      146000 -- (-262.103) (-263.652) [-263.888] (-259.157) * [-263.016] (-259.521) (-260.685) (-261.122) -- 0:00:58
      146500 -- (-261.964) (-263.638) [-260.060] (-260.119) * [-262.683] (-264.119) (-260.040) (-260.349) -- 0:00:58
      147000 -- [-271.549] (-262.582) (-261.168) (-261.133) * (-259.752) (-263.655) [-261.104] (-260.695) -- 0:00:58
      147500 -- (-262.699) (-261.009) (-261.853) [-263.257] * (-261.450) [-261.241] (-260.497) (-262.380) -- 0:00:57
      148000 -- [-260.693] (-262.595) (-260.292) (-260.674) * (-260.675) (-267.476) [-261.716] (-259.519) -- 0:00:57
      148500 -- (-264.701) (-261.311) [-262.014] (-262.264) * [-260.169] (-260.185) (-260.323) (-259.547) -- 0:00:57
      149000 -- (-259.312) (-260.606) (-260.699) [-261.595] * (-260.024) (-261.192) (-259.689) [-263.282] -- 0:00:57
      149500 -- [-260.372] (-260.209) (-261.082) (-260.975) * [-259.307] (-262.651) (-260.504) (-260.322) -- 0:00:56
      150000 -- (-261.202) (-260.429) (-260.968) [-262.579] * [-259.884] (-259.702) (-259.777) (-262.675) -- 0:00:56

      Average standard deviation of split frequencies: 0.019868

      150500 -- [-261.867] (-261.105) (-261.414) (-264.984) * (-261.800) [-260.714] (-260.966) (-261.907) -- 0:00:56
      151000 -- (-260.574) (-260.054) [-266.663] (-261.667) * (-264.148) (-263.168) [-262.897] (-260.740) -- 0:00:56
      151500 -- (-261.235) [-262.859] (-259.814) (-263.030) * (-260.933) (-261.111) [-261.108] (-262.152) -- 0:00:56
      152000 -- (-260.432) (-260.506) (-265.015) [-259.836] * (-260.995) (-261.975) [-261.726] (-264.211) -- 0:00:55
      152500 -- (-263.337) (-263.340) [-260.719] (-260.114) * [-261.829] (-262.945) (-263.785) (-262.000) -- 0:00:55
      153000 -- (-263.774) (-262.838) (-260.725) [-260.773] * [-261.088] (-261.906) (-260.626) (-260.091) -- 0:00:55
      153500 -- (-259.956) [-262.036] (-260.450) (-260.637) * (-262.909) [-262.744] (-259.466) (-264.926) -- 0:00:55
      154000 -- (-261.846) (-259.033) [-262.365] (-260.956) * (-260.564) [-259.805] (-260.814) (-261.582) -- 0:00:54
      154500 -- (-261.313) (-260.322) (-264.092) [-260.751] * (-261.772) [-263.321] (-259.984) (-263.972) -- 0:00:54
      155000 -- (-260.044) (-263.526) (-260.101) [-260.140] * (-260.978) (-262.456) [-262.089] (-264.055) -- 0:00:54

      Average standard deviation of split frequencies: 0.018608

      155500 -- [-259.451] (-259.065) (-259.619) (-260.737) * [-260.825] (-261.411) (-261.887) (-260.551) -- 0:00:54
      156000 -- (-262.678) [-259.682] (-259.095) (-264.121) * (-260.659) [-261.039] (-261.454) (-260.123) -- 0:00:54
      156500 -- (-260.669) (-261.844) [-261.789] (-263.763) * (-261.517) (-261.116) (-262.181) [-260.463] -- 0:00:53
      157000 -- (-261.090) (-260.072) (-259.534) [-260.025] * (-260.349) (-259.814) (-261.225) [-260.249] -- 0:00:59
      157500 -- (-262.548) (-264.058) [-259.561] (-264.354) * (-261.437) [-261.239] (-259.324) (-262.364) -- 0:00:58
      158000 -- (-261.036) [-262.564] (-260.837) (-261.778) * (-259.325) (-260.301) (-262.054) [-261.656] -- 0:00:58
      158500 -- (-262.669) (-260.186) (-260.911) [-263.760] * [-262.351] (-264.357) (-260.466) (-260.421) -- 0:00:58
      159000 -- (-260.548) [-261.326] (-260.269) (-260.756) * [-261.656] (-260.731) (-261.182) (-259.965) -- 0:00:58
      159500 -- [-262.687] (-260.861) (-262.787) (-262.428) * (-260.890) (-260.479) [-259.739] (-264.038) -- 0:00:57
      160000 -- (-259.443) (-260.545) (-262.726) [-260.317] * [-262.276] (-259.797) (-259.989) (-262.875) -- 0:00:57

      Average standard deviation of split frequencies: 0.020538

      160500 -- [-261.224] (-259.396) (-260.081) (-266.196) * (-265.222) [-260.116] (-260.750) (-260.999) -- 0:00:57
      161000 -- (-260.615) (-260.324) [-259.651] (-264.982) * (-265.543) (-261.455) (-263.761) [-260.924] -- 0:00:57
      161500 -- [-260.067] (-260.185) (-261.561) (-262.474) * [-261.149] (-260.459) (-260.509) (-259.675) -- 0:00:57
      162000 -- (-263.705) [-259.227] (-262.084) (-262.203) * (-261.644) (-261.860) [-260.610] (-260.861) -- 0:00:56
      162500 -- (-261.005) [-262.521] (-259.324) (-263.904) * [-260.812] (-261.776) (-264.075) (-259.953) -- 0:00:56
      163000 -- (-260.679) (-260.001) [-262.175] (-262.457) * [-259.283] (-259.478) (-261.607) (-259.913) -- 0:00:56
      163500 -- [-259.707] (-261.005) (-262.430) (-262.904) * [-263.718] (-264.523) (-260.419) (-263.514) -- 0:00:56
      164000 -- (-260.517) [-263.000] (-262.905) (-268.442) * (-263.416) (-260.625) [-260.842] (-260.711) -- 0:00:56
      164500 -- (-260.689) [-260.055] (-261.451) (-261.503) * (-264.306) (-259.192) (-262.364) [-259.988] -- 0:00:55
      165000 -- (-260.404) (-262.706) [-260.270] (-265.840) * (-265.519) [-259.839] (-265.769) (-259.661) -- 0:00:55

      Average standard deviation of split frequencies: 0.020626

      165500 -- (-262.016) [-264.129] (-260.557) (-262.059) * [-261.331] (-262.850) (-261.545) (-261.651) -- 0:00:55
      166000 -- (-259.703) (-264.413) [-259.904] (-260.562) * (-260.405) (-259.724) [-260.788] (-261.860) -- 0:00:55
      166500 -- (-261.984) (-260.310) [-264.341] (-260.141) * [-261.635] (-261.343) (-260.943) (-261.056) -- 0:00:55
      167000 -- [-261.078] (-266.904) (-264.029) (-259.134) * (-261.775) (-259.358) [-261.328] (-265.723) -- 0:00:54
      167500 -- (-261.385) (-262.337) (-259.401) [-259.620] * (-260.390) (-259.788) (-265.779) [-262.099] -- 0:00:54
      168000 -- (-260.170) (-261.157) [-260.032] (-264.090) * [-263.866] (-260.352) (-263.346) (-260.422) -- 0:00:54
      168500 -- (-260.648) [-261.286] (-265.272) (-260.013) * (-259.947) (-259.814) (-258.898) [-262.536] -- 0:00:54
      169000 -- (-262.395) [-259.031] (-262.689) (-261.323) * (-259.088) [-263.945] (-262.283) (-264.898) -- 0:00:54
      169500 -- (-264.721) (-260.851) [-260.170] (-260.931) * (-262.543) (-264.123) (-259.665) [-260.979] -- 0:00:53
      170000 -- (-262.620) (-260.672) [-264.642] (-260.012) * (-261.386) [-260.928] (-259.823) (-261.630) -- 0:00:53

      Average standard deviation of split frequencies: 0.020062

      170500 -- (-260.357) [-261.293] (-266.682) (-263.060) * (-262.004) (-260.334) [-260.857] (-260.369) -- 0:00:53
      171000 -- [-261.815] (-261.622) (-261.388) (-262.031) * [-263.011] (-261.715) (-262.564) (-261.796) -- 0:00:53
      171500 -- (-266.291) (-262.075) [-262.187] (-260.997) * (-259.871) [-260.616] (-260.045) (-260.738) -- 0:00:53
      172000 -- [-263.579] (-261.948) (-261.762) (-264.904) * (-259.651) (-261.557) (-259.559) [-260.374] -- 0:00:57
      172500 -- (-265.922) [-261.025] (-261.050) (-261.355) * [-259.894] (-264.280) (-261.149) (-264.064) -- 0:00:57
      173000 -- (-261.902) (-262.735) (-261.344) [-262.951] * (-264.580) [-260.744] (-264.680) (-264.290) -- 0:00:57
      173500 -- (-263.963) (-262.233) (-260.413) [-260.773] * (-263.149) (-260.742) [-262.244] (-261.047) -- 0:00:57
      174000 -- (-265.755) (-262.637) (-261.941) [-259.661] * (-260.728) (-263.530) [-260.066] (-261.776) -- 0:00:56
      174500 -- (-262.268) (-268.575) (-260.313) [-259.876] * (-259.610) [-263.396] (-262.159) (-263.456) -- 0:00:56
      175000 -- (-260.569) [-260.137] (-260.602) (-264.148) * [-259.168] (-258.999) (-259.750) (-262.123) -- 0:00:56

      Average standard deviation of split frequencies: 0.021991

      175500 -- (-261.474) [-259.670] (-259.943) (-261.240) * (-266.709) [-261.827] (-261.575) (-260.723) -- 0:00:56
      176000 -- [-260.306] (-262.080) (-262.330) (-260.120) * (-265.453) [-261.598] (-264.873) (-263.489) -- 0:00:56
      176500 -- [-260.068] (-259.619) (-261.427) (-259.700) * (-259.847) (-261.293) [-260.979] (-262.829) -- 0:00:55
      177000 -- (-261.982) (-264.949) [-261.365] (-263.403) * (-261.429) (-260.724) (-261.223) [-260.439] -- 0:00:55
      177500 -- (-261.749) (-266.642) (-262.653) [-259.203] * (-261.266) (-261.167) (-264.712) [-261.139] -- 0:00:55
      178000 -- [-264.139] (-262.003) (-260.069) (-259.341) * (-262.391) [-261.439] (-262.976) (-260.944) -- 0:00:55
      178500 -- (-264.371) [-262.897] (-263.165) (-261.655) * (-260.520) (-262.106) (-260.399) [-262.448] -- 0:00:55
      179000 -- [-261.302] (-260.149) (-262.100) (-261.087) * (-265.849) (-264.452) (-264.237) [-260.482] -- 0:00:55
      179500 -- (-262.533) (-260.711) [-259.969] (-261.998) * (-264.004) (-262.460) (-262.244) [-260.607] -- 0:00:54
      180000 -- (-260.941) (-263.420) [-261.242] (-264.997) * [-262.509] (-262.416) (-260.572) (-259.976) -- 0:00:54

      Average standard deviation of split frequencies: 0.020462

      180500 -- (-260.073) [-262.080] (-259.969) (-259.029) * (-260.197) (-260.305) [-261.021] (-261.183) -- 0:00:54
      181000 -- [-261.910] (-258.946) (-261.349) (-260.427) * (-262.400) [-260.204] (-259.872) (-260.057) -- 0:00:54
      181500 -- (-263.246) (-259.610) (-262.131) [-261.358] * (-266.976) (-261.326) [-260.758] (-260.199) -- 0:00:54
      182000 -- (-259.758) (-260.104) [-261.896] (-260.126) * (-261.492) (-260.118) (-263.924) [-261.691] -- 0:00:53
      182500 -- (-261.307) [-260.980] (-261.598) (-260.149) * [-259.172] (-266.882) (-265.361) (-263.234) -- 0:00:53
      183000 -- (-260.123) (-261.495) [-260.941] (-260.229) * [-259.281] (-263.140) (-263.473) (-260.638) -- 0:00:53
      183500 -- (-261.776) (-261.554) (-269.938) [-262.763] * [-262.679] (-261.271) (-260.059) (-260.804) -- 0:00:53
      184000 -- (-260.089) (-270.139) (-262.727) [-262.309] * (-260.702) [-259.692] (-260.896) (-260.749) -- 0:00:53
      184500 -- [-259.976] (-262.234) (-265.854) (-260.783) * (-260.873) (-267.217) [-262.155] (-261.717) -- 0:00:53
      185000 -- [-260.161] (-264.154) (-260.000) (-259.448) * [-260.680] (-263.228) (-262.328) (-263.199) -- 0:00:52

      Average standard deviation of split frequencies: 0.018755

      185500 -- (-264.503) [-263.342] (-262.435) (-261.045) * (-263.168) [-261.837] (-261.108) (-262.518) -- 0:00:52
      186000 -- (-263.185) [-261.194] (-266.609) (-261.855) * (-260.736) [-262.744] (-263.653) (-260.418) -- 0:00:56
      186500 -- [-259.071] (-261.894) (-260.867) (-262.410) * (-259.654) [-264.132] (-259.102) (-262.542) -- 0:00:56
      187000 -- [-262.628] (-262.307) (-260.723) (-261.791) * (-260.607) [-261.021] (-260.646) (-261.463) -- 0:00:56
      187500 -- (-260.340) [-260.885] (-260.914) (-265.202) * (-261.237) [-260.940] (-259.851) (-260.855) -- 0:00:56
      188000 -- (-262.212) [-260.575] (-260.737) (-262.373) * (-259.697) [-261.633] (-261.336) (-261.202) -- 0:00:56
      188500 -- (-260.504) (-261.184) [-262.265] (-262.416) * (-266.037) [-260.211] (-263.563) (-261.731) -- 0:00:55
      189000 -- [-260.366] (-261.362) (-261.025) (-260.312) * (-262.282) [-259.565] (-261.978) (-260.186) -- 0:00:55
      189500 -- (-260.426) (-261.809) (-261.858) [-259.695] * (-261.723) (-260.575) (-261.857) [-261.377] -- 0:00:55
      190000 -- (-268.747) [-261.607] (-261.598) (-262.482) * (-260.224) (-260.935) (-268.141) [-260.487] -- 0:00:55

      Average standard deviation of split frequencies: 0.019532

      190500 -- (-259.392) (-260.221) [-262.186] (-260.468) * (-262.181) (-260.746) [-266.872] (-264.050) -- 0:00:55
      191000 -- [-261.432] (-263.010) (-261.079) (-260.283) * (-261.303) [-259.236] (-259.818) (-261.530) -- 0:00:55
      191500 -- (-260.583) (-259.983) (-260.564) [-261.033] * [-261.322] (-259.892) (-260.625) (-261.528) -- 0:00:54
      192000 -- [-260.396] (-264.724) (-263.189) (-264.042) * (-260.188) [-262.564] (-260.708) (-263.493) -- 0:00:54
      192500 -- (-260.218) (-259.346) [-260.415] (-261.538) * (-261.497) [-260.265] (-263.369) (-263.698) -- 0:00:54
      193000 -- (-262.557) [-261.900] (-260.446) (-260.494) * [-263.350] (-262.475) (-263.369) (-263.294) -- 0:00:54
      193500 -- (-263.495) (-260.315) (-260.693) [-260.839] * (-268.635) (-262.914) (-261.063) [-261.768] -- 0:00:54
      194000 -- (-261.513) (-262.460) (-260.822) [-261.121] * (-261.931) (-264.767) [-262.068] (-262.166) -- 0:00:54
      194500 -- [-259.364] (-261.110) (-260.200) (-264.433) * (-265.336) [-259.840] (-260.671) (-262.355) -- 0:00:53
      195000 -- [-259.825] (-262.480) (-260.395) (-261.292) * [-263.188] (-262.739) (-259.258) (-265.333) -- 0:00:53

      Average standard deviation of split frequencies: 0.020380

      195500 -- [-259.904] (-261.748) (-262.968) (-260.713) * (-261.645) (-261.612) (-259.758) [-262.627] -- 0:00:53
      196000 -- (-262.016) (-263.876) [-263.444] (-261.517) * (-261.417) (-266.405) [-259.292] (-260.410) -- 0:00:53
      196500 -- [-260.618] (-259.604) (-259.625) (-259.962) * (-259.352) (-260.308) [-260.836] (-262.699) -- 0:00:53
      197000 -- (-259.823) (-260.098) (-260.389) [-262.622] * (-262.873) (-261.269) (-261.908) [-260.035] -- 0:00:52
      197500 -- (-261.933) [-263.414] (-261.502) (-262.003) * (-261.171) (-261.120) [-261.896] (-266.082) -- 0:00:52
      198000 -- [-262.936] (-260.173) (-260.573) (-261.083) * (-259.260) (-270.093) [-261.204] (-262.142) -- 0:00:52
      198500 -- (-262.016) (-263.662) [-263.548] (-261.425) * (-260.277) [-259.471] (-261.783) (-261.770) -- 0:00:52
      199000 -- (-259.590) [-262.132] (-264.142) (-265.351) * (-259.605) (-260.881) (-261.234) [-260.346] -- 0:00:52
      199500 -- (-263.332) [-261.400] (-268.814) (-265.502) * [-260.280] (-260.002) (-266.850) (-260.851) -- 0:00:52
      200000 -- (-263.806) (-260.028) (-265.810) [-260.260] * (-259.522) (-259.800) [-265.476] (-262.701) -- 0:00:51

      Average standard deviation of split frequencies: 0.019288

      200500 -- (-260.384) [-263.921] (-261.792) (-259.694) * [-261.788] (-261.433) (-259.110) (-259.698) -- 0:00:51
      201000 -- (-259.911) (-261.316) [-260.295] (-260.510) * (-262.453) (-260.099) (-260.458) [-259.179] -- 0:00:51
      201500 -- (-260.231) [-259.804] (-263.502) (-260.362) * (-261.088) (-259.782) (-260.020) [-260.998] -- 0:00:51
      202000 -- (-260.394) [-259.894] (-259.802) (-261.385) * [-260.290] (-260.537) (-260.820) (-260.427) -- 0:00:55
      202500 -- (-260.569) (-261.480) [-259.288] (-259.840) * (-259.942) [-259.872] (-260.401) (-261.269) -- 0:00:55
      203000 -- [-259.668] (-262.578) (-261.781) (-259.749) * (-260.198) (-263.471) [-261.436] (-260.697) -- 0:00:54
      203500 -- [-259.195] (-261.954) (-261.371) (-264.995) * (-262.741) (-262.313) (-264.944) [-259.529] -- 0:00:54
      204000 -- (-261.631) (-262.730) [-261.050] (-263.744) * (-259.756) (-263.028) [-259.873] (-265.409) -- 0:00:54
      204500 -- (-261.425) (-261.989) [-259.853] (-262.905) * (-262.461) (-261.933) (-261.255) [-261.663] -- 0:00:54
      205000 -- [-259.704] (-260.441) (-260.603) (-261.204) * (-260.658) (-260.409) (-262.052) [-260.812] -- 0:00:54

      Average standard deviation of split frequencies: 0.019150

      205500 -- (-270.569) (-259.269) (-261.698) [-259.767] * (-260.253) (-261.098) (-260.545) [-261.646] -- 0:00:54
      206000 -- (-265.784) (-260.152) (-261.250) [-263.298] * (-262.098) (-260.797) [-260.736] (-263.310) -- 0:00:53
      206500 -- (-262.460) (-260.167) (-260.710) [-264.298] * (-263.124) (-262.982) (-260.497) [-266.990] -- 0:00:53
      207000 -- (-266.479) [-261.567] (-260.784) (-262.875) * (-260.404) (-262.204) [-261.015] (-260.219) -- 0:00:53
      207500 -- [-263.440] (-261.510) (-261.407) (-261.351) * (-261.461) [-260.541] (-260.916) (-267.473) -- 0:00:53
      208000 -- (-263.395) (-259.957) (-261.987) [-259.235] * (-260.694) [-262.414] (-266.264) (-260.105) -- 0:00:53
      208500 -- (-265.533) (-260.354) (-263.517) [-260.695] * [-261.406] (-265.039) (-265.005) (-263.104) -- 0:00:53
      209000 -- (-267.237) (-264.651) [-260.774] (-262.264) * (-260.819) (-263.672) (-263.341) [-265.002] -- 0:00:52
      209500 -- (-263.196) [-259.588] (-260.342) (-266.221) * (-259.609) (-263.577) (-263.807) [-260.721] -- 0:00:52
      210000 -- (-266.430) (-261.921) [-261.917] (-268.902) * (-261.090) [-265.197] (-261.667) (-261.589) -- 0:00:52

      Average standard deviation of split frequencies: 0.017784

      210500 -- [-260.741] (-260.061) (-259.887) (-264.137) * (-260.544) (-263.760) (-261.595) [-266.545] -- 0:00:52
      211000 -- (-260.730) [-262.405] (-262.716) (-262.790) * [-263.579] (-264.065) (-262.068) (-261.383) -- 0:00:52
      211500 -- (-261.292) (-260.222) [-266.450] (-261.531) * (-263.021) [-264.465] (-260.332) (-261.875) -- 0:00:52
      212000 -- (-259.407) (-260.552) [-260.032] (-261.428) * [-262.909] (-260.644) (-260.046) (-260.231) -- 0:00:52
      212500 -- (-262.448) [-259.504] (-262.415) (-260.806) * (-260.726) (-260.545) [-261.839] (-263.744) -- 0:00:51
      213000 -- (-260.462) (-259.966) [-264.764] (-260.571) * [-259.594] (-261.703) (-259.824) (-261.060) -- 0:00:51
      213500 -- (-260.907) (-262.945) (-264.287) [-259.187] * (-261.245) (-261.877) (-262.003) [-263.543] -- 0:00:51
      214000 -- (-259.806) (-263.512) (-261.463) [-262.852] * (-264.722) (-264.680) [-261.110] (-260.347) -- 0:00:51
      214500 -- (-260.197) (-263.626) [-261.050] (-260.212) * (-261.163) (-259.312) (-263.232) [-262.731] -- 0:00:51
      215000 -- (-264.841) (-263.868) [-261.776] (-263.491) * (-261.549) [-262.692] (-260.267) (-266.353) -- 0:00:51

      Average standard deviation of split frequencies: 0.017459

      215500 -- (-262.732) (-264.178) (-260.045) [-262.421] * (-264.046) [-267.813] (-260.317) (-267.385) -- 0:00:50
      216000 -- (-259.554) [-261.519] (-261.517) (-263.808) * [-261.060] (-267.248) (-260.641) (-265.001) -- 0:00:50
      216500 -- [-260.559] (-262.704) (-259.705) (-261.017) * (-264.400) (-264.154) [-260.652] (-265.299) -- 0:00:50
      217000 -- (-261.112) [-261.654] (-259.939) (-264.953) * [-268.457] (-261.664) (-261.775) (-259.406) -- 0:00:50
      217500 -- (-261.438) (-261.552) [-264.372] (-263.743) * (-262.813) (-261.622) [-260.838] (-265.246) -- 0:00:50
      218000 -- (-264.452) (-261.407) [-260.476] (-261.080) * (-267.458) (-261.748) (-259.182) [-264.036] -- 0:00:53
      218500 -- (-261.128) (-259.609) (-261.294) [-261.589] * (-261.492) (-264.728) (-261.134) [-263.276] -- 0:00:53
      219000 -- (-259.251) (-261.240) [-260.766] (-261.579) * (-264.829) [-261.615] (-259.963) (-261.412) -- 0:00:53
      219500 -- (-259.923) (-262.287) (-259.456) [-259.824] * (-261.281) [-260.742] (-259.693) (-261.305) -- 0:00:53
      220000 -- (-261.142) (-261.418) [-259.223] (-261.164) * [-261.563] (-260.584) (-261.541) (-261.446) -- 0:00:53

      Average standard deviation of split frequencies: 0.017921

      220500 -- (-262.981) [-260.730] (-260.176) (-259.628) * [-259.419] (-260.091) (-269.438) (-260.839) -- 0:00:53
      221000 -- (-260.426) [-260.026] (-261.314) (-262.364) * [-259.111] (-262.332) (-264.600) (-264.668) -- 0:00:52
      221500 -- (-262.344) [-262.262] (-262.874) (-260.379) * (-260.938) [-263.214] (-262.439) (-261.025) -- 0:00:52
      222000 -- [-259.655] (-262.653) (-259.870) (-260.487) * (-263.575) (-269.356) (-262.215) [-261.399] -- 0:00:52
      222500 -- (-264.287) [-259.627] (-261.075) (-263.941) * [-262.756] (-264.187) (-261.234) (-260.074) -- 0:00:52
      223000 -- [-261.214] (-261.688) (-261.377) (-263.278) * (-260.012) (-259.499) (-260.276) [-259.485] -- 0:00:52
      223500 -- (-260.662) (-264.437) (-261.334) [-263.801] * (-261.562) (-261.289) [-260.575] (-263.107) -- 0:00:52
      224000 -- [-266.776] (-263.949) (-261.987) (-260.533) * [-261.461] (-261.089) (-262.335) (-262.683) -- 0:00:51
      224500 -- (-262.427) (-264.883) [-259.946] (-262.572) * (-259.897) [-259.817] (-260.073) (-267.686) -- 0:00:51
      225000 -- (-262.776) (-262.530) [-261.644] (-260.309) * (-260.367) (-260.534) (-260.456) [-264.255] -- 0:00:51

      Average standard deviation of split frequencies: 0.016478

      225500 -- (-263.721) [-260.859] (-261.857) (-261.647) * [-261.564] (-262.952) (-264.790) (-262.757) -- 0:00:51
      226000 -- (-264.545) (-265.695) (-260.096) [-262.950] * [-262.298] (-260.674) (-261.651) (-263.707) -- 0:00:51
      226500 -- [-260.518] (-262.393) (-260.131) (-261.525) * (-263.387) [-263.030] (-261.280) (-265.422) -- 0:00:51
      227000 -- (-261.796) (-260.203) (-260.158) [-261.305] * (-261.251) (-261.077) [-259.798] (-263.329) -- 0:00:51
      227500 -- (-262.846) (-259.874) (-260.691) [-262.847] * (-260.278) (-262.061) (-262.727) [-259.112] -- 0:00:50
      228000 -- (-261.580) [-261.506] (-263.544) (-263.146) * (-266.364) [-261.810] (-268.530) (-259.643) -- 0:00:50
      228500 -- (-262.766) [-259.586] (-259.832) (-262.068) * (-262.600) (-260.878) [-261.028] (-261.807) -- 0:00:50
      229000 -- (-260.467) [-259.929] (-262.280) (-259.893) * (-261.781) (-262.865) [-259.610] (-261.413) -- 0:00:50
      229500 -- [-260.110] (-260.862) (-265.360) (-261.896) * (-262.762) (-260.936) [-260.274] (-260.947) -- 0:00:50
      230000 -- (-263.745) (-260.530) [-259.746] (-261.568) * [-259.581] (-262.867) (-261.814) (-263.549) -- 0:00:50

      Average standard deviation of split frequencies: 0.017102

      230500 -- (-260.315) (-260.578) (-260.168) [-262.584] * (-260.010) (-260.857) (-263.626) [-264.565] -- 0:00:50
      231000 -- [-259.648] (-262.405) (-262.589) (-261.715) * (-262.373) (-260.823) [-260.761] (-260.237) -- 0:00:49
      231500 -- (-259.049) (-259.958) [-263.253] (-260.792) * [-260.315] (-261.881) (-261.584) (-261.222) -- 0:00:49
      232000 -- [-260.883] (-260.749) (-261.684) (-262.665) * [-260.834] (-260.987) (-261.164) (-262.744) -- 0:00:49
      232500 -- (-261.408) (-263.132) (-262.628) [-259.754] * (-262.819) [-260.449] (-259.967) (-259.556) -- 0:00:49
      233000 -- (-262.064) (-262.225) (-262.529) [-259.733] * (-261.267) (-261.508) [-259.709] (-260.882) -- 0:00:49
      233500 -- (-261.871) (-259.799) (-262.117) [-260.195] * (-260.167) (-266.429) (-260.288) [-260.234] -- 0:00:49
      234000 -- [-262.348] (-259.805) (-263.557) (-261.402) * [-259.643] (-263.639) (-260.293) (-260.240) -- 0:00:49
      234500 -- (-262.697) [-261.618] (-262.630) (-260.997) * (-259.928) (-260.139) (-260.617) [-259.920] -- 0:00:52
      235000 -- [-261.097] (-261.719) (-261.221) (-261.325) * (-263.323) (-261.553) (-263.237) [-259.843] -- 0:00:52

      Average standard deviation of split frequencies: 0.017977

      235500 -- (-262.906) [-261.613] (-263.357) (-260.394) * (-259.384) (-260.744) [-262.625] (-261.631) -- 0:00:51
      236000 -- (-261.802) [-261.172] (-262.076) (-264.379) * (-260.608) (-259.764) (-261.745) [-260.348] -- 0:00:51
      236500 -- (-259.468) [-260.971] (-259.437) (-261.619) * (-260.406) (-260.205) [-260.406] (-260.103) -- 0:00:51
      237000 -- [-265.280] (-259.396) (-260.902) (-263.725) * (-260.060) (-263.457) (-260.684) [-260.726] -- 0:00:51
      237500 -- [-262.273] (-261.944) (-261.125) (-263.818) * (-261.141) (-262.979) [-261.659] (-260.419) -- 0:00:51
      238000 -- (-259.717) (-262.031) (-260.414) [-259.603] * (-264.577) (-260.166) [-261.533] (-262.326) -- 0:00:51
      238500 -- (-260.488) (-263.364) [-261.906] (-261.460) * (-263.482) [-261.965] (-260.551) (-262.659) -- 0:00:51
      239000 -- (-259.678) (-261.300) (-261.144) [-262.161] * [-260.365] (-260.571) (-261.297) (-262.631) -- 0:00:50
      239500 -- (-265.523) (-260.995) (-261.531) [-260.784] * (-260.609) [-260.564] (-260.513) (-270.190) -- 0:00:50
      240000 -- [-263.451] (-259.402) (-263.021) (-259.855) * (-260.447) (-266.445) (-261.116) [-261.029] -- 0:00:50

      Average standard deviation of split frequencies: 0.016804

      240500 -- (-262.267) (-263.102) (-265.355) [-259.790] * (-263.567) (-260.300) [-261.692] (-260.515) -- 0:00:50
      241000 -- (-262.866) (-267.953) (-261.316) [-259.930] * (-259.881) [-263.462] (-262.928) (-262.632) -- 0:00:50
      241500 -- (-263.006) (-264.140) [-260.476] (-261.612) * (-259.563) [-263.099] (-261.721) (-259.544) -- 0:00:50
      242000 -- (-260.711) [-264.742] (-265.937) (-260.131) * (-262.448) (-261.887) [-261.292] (-262.358) -- 0:00:50
      242500 -- (-260.472) (-260.715) [-259.942] (-265.812) * (-262.158) (-262.179) [-263.082] (-261.686) -- 0:00:49
      243000 -- (-262.648) (-261.711) (-261.330) [-263.692] * (-262.934) (-262.211) (-261.258) [-260.507] -- 0:00:49
      243500 -- (-260.916) (-263.855) (-261.044) [-262.619] * [-265.913] (-261.966) (-262.100) (-260.587) -- 0:00:49
      244000 -- (-262.124) [-260.430] (-261.402) (-261.101) * [-262.107] (-259.340) (-259.394) (-263.273) -- 0:00:49
      244500 -- (-263.450) (-259.548) [-260.251] (-262.998) * [-262.661] (-260.115) (-266.759) (-261.427) -- 0:00:49
      245000 -- (-262.377) [-259.165] (-262.212) (-263.521) * [-260.095] (-260.423) (-261.794) (-262.141) -- 0:00:49

      Average standard deviation of split frequencies: 0.016137

      245500 -- (-261.366) [-261.270] (-260.267) (-262.856) * (-259.241) (-260.128) [-260.473] (-260.338) -- 0:00:49
      246000 -- (-260.300) (-259.800) [-259.463] (-265.720) * (-259.816) (-264.659) (-261.430) [-262.518] -- 0:00:49
      246500 -- (-262.406) [-259.992] (-259.210) (-263.709) * [-259.881] (-266.393) (-261.577) (-260.904) -- 0:00:48
      247000 -- (-263.344) [-259.338] (-265.449) (-259.550) * (-259.265) [-264.543] (-261.254) (-261.577) -- 0:00:48
      247500 -- (-260.754) [-261.532] (-261.699) (-261.534) * [-261.236] (-262.093) (-261.166) (-260.014) -- 0:00:48
      248000 -- (-263.248) (-259.275) [-260.336] (-260.860) * (-261.895) (-262.629) (-261.605) [-264.460] -- 0:00:48
      248500 -- (-264.123) [-260.843] (-266.279) (-262.166) * (-263.572) (-265.499) [-260.456] (-262.023) -- 0:00:48
      249000 -- (-263.511) (-261.979) (-260.833) [-264.002] * [-261.337] (-260.890) (-260.236) (-262.444) -- 0:00:48
      249500 -- [-261.136] (-263.705) (-263.287) (-260.287) * (-262.355) [-261.806] (-260.570) (-263.663) -- 0:00:48
      250000 -- (-266.490) (-260.051) (-260.622) [-263.464] * (-259.668) (-259.845) (-259.732) [-261.057] -- 0:00:51

      Average standard deviation of split frequencies: 0.016628

      250500 -- (-264.863) (-261.618) [-259.972] (-261.223) * [-260.882] (-262.121) (-261.423) (-259.764) -- 0:00:50
      251000 -- (-262.875) (-260.146) [-261.673] (-260.754) * (-259.390) (-260.800) [-259.951] (-259.584) -- 0:00:50
      251500 -- (-261.988) (-259.273) [-261.654] (-261.334) * (-261.641) (-259.914) (-262.570) [-260.616] -- 0:00:50
      252000 -- [-261.264] (-262.301) (-261.071) (-259.483) * (-260.256) [-259.532] (-259.918) (-259.354) -- 0:00:50
      252500 -- (-260.329) (-265.941) (-259.841) [-262.495] * (-265.687) (-261.408) (-261.583) [-263.841] -- 0:00:50
      253000 -- (-260.585) (-261.726) (-262.091) [-262.379] * (-261.258) (-260.971) [-262.623] (-267.631) -- 0:00:50
      253500 -- (-261.076) [-263.541] (-259.506) (-259.254) * (-262.688) [-264.261] (-262.448) (-261.472) -- 0:00:50
      254000 -- (-262.161) [-261.261] (-266.951) (-260.994) * (-262.905) (-260.487) (-263.337) [-260.606] -- 0:00:49
      254500 -- (-261.654) (-261.904) (-259.887) [-259.743] * (-260.879) [-259.878] (-261.189) (-270.142) -- 0:00:49
      255000 -- (-260.196) (-259.174) (-261.993) [-260.773] * (-261.446) [-258.949] (-263.963) (-262.553) -- 0:00:49

      Average standard deviation of split frequencies: 0.017656

      255500 -- [-260.346] (-266.447) (-259.910) (-261.868) * (-260.122) [-259.600] (-269.228) (-262.859) -- 0:00:49
      256000 -- (-260.541) (-263.951) [-260.215] (-264.799) * [-260.789] (-259.326) (-262.850) (-263.876) -- 0:00:49
      256500 -- (-261.563) (-260.047) (-262.809) [-260.848] * [-260.015] (-259.322) (-260.756) (-268.167) -- 0:00:49
      257000 -- (-262.939) (-261.082) [-260.853] (-260.327) * [-260.305] (-261.152) (-262.022) (-260.877) -- 0:00:49
      257500 -- (-261.184) (-260.354) (-259.206) [-261.488] * (-260.223) (-260.043) [-263.500] (-261.125) -- 0:00:49
      258000 -- (-260.354) (-260.483) (-261.669) [-261.971] * (-264.016) [-260.728] (-260.999) (-261.387) -- 0:00:48
      258500 -- (-260.737) [-263.579] (-263.257) (-260.436) * (-261.858) (-260.131) [-262.299] (-260.369) -- 0:00:48
      259000 -- (-261.073) (-261.316) [-262.921] (-260.292) * (-262.642) (-261.581) (-264.761) [-259.198] -- 0:00:48
      259500 -- (-260.886) [-263.288] (-260.177) (-264.191) * (-264.269) [-261.632] (-262.969) (-260.766) -- 0:00:48
      260000 -- (-261.188) [-261.382] (-259.799) (-265.928) * (-262.716) (-263.406) [-263.443] (-261.305) -- 0:00:48

      Average standard deviation of split frequencies: 0.017446

      260500 -- [-264.233] (-263.183) (-260.672) (-263.599) * (-260.936) (-261.473) [-261.761] (-259.335) -- 0:00:48
      261000 -- (-261.331) [-259.780] (-260.595) (-263.159) * (-259.641) (-259.570) [-260.246] (-261.444) -- 0:00:48
      261500 -- (-258.990) [-261.173] (-261.714) (-261.313) * (-262.191) (-260.281) [-260.333] (-262.098) -- 0:00:48
      262000 -- [-259.428] (-262.568) (-261.345) (-264.335) * (-259.628) (-259.603) [-262.136] (-261.367) -- 0:00:47
      262500 -- (-259.761) (-266.250) (-261.083) [-261.693] * [-261.025] (-259.796) (-260.222) (-263.474) -- 0:00:47
      263000 -- (-260.709) (-261.749) [-260.062] (-259.724) * (-260.922) (-264.624) [-259.733] (-260.538) -- 0:00:47
      263500 -- (-262.557) [-264.218] (-265.623) (-259.164) * (-262.257) (-260.167) [-261.355] (-268.568) -- 0:00:47
      264000 -- (-261.609) (-261.339) (-261.376) [-259.036] * (-262.451) (-259.942) (-262.290) [-263.975] -- 0:00:47
      264500 -- [-259.873] (-260.714) (-261.146) (-260.050) * (-260.744) (-263.047) [-260.271] (-262.500) -- 0:00:47
      265000 -- [-261.129] (-261.731) (-260.952) (-263.003) * (-261.163) (-261.076) [-259.532] (-259.976) -- 0:00:47

      Average standard deviation of split frequencies: 0.017230

      265500 -- (-263.628) [-264.447] (-260.635) (-261.007) * [-262.037] (-261.392) (-259.629) (-260.568) -- 0:00:47
      266000 -- (-262.231) (-263.970) [-260.323] (-260.533) * (-259.890) [-259.766] (-260.679) (-261.731) -- 0:00:49
      266500 -- (-260.853) (-263.683) (-264.818) [-260.164] * [-260.588] (-262.173) (-260.908) (-264.367) -- 0:00:49
      267000 -- (-262.038) [-261.160] (-265.223) (-258.951) * (-260.959) (-259.936) [-260.648] (-260.667) -- 0:00:49
      267500 -- (-262.180) (-264.701) (-268.028) [-260.560] * (-264.813) (-259.994) (-260.574) [-262.084] -- 0:00:49
      268000 -- [-260.201] (-260.946) (-269.533) (-264.259) * [-268.226] (-262.342) (-261.978) (-261.331) -- 0:00:49
      268500 -- [-259.907] (-260.216) (-259.398) (-259.841) * (-262.891) [-261.594] (-259.357) (-262.425) -- 0:00:49
      269000 -- (-259.041) [-263.013] (-262.345) (-259.182) * (-262.437) (-260.545) [-260.978] (-260.761) -- 0:00:48
      269500 -- [-263.761] (-266.460) (-262.837) (-262.682) * (-260.873) [-263.651] (-260.018) (-259.855) -- 0:00:48
      270000 -- (-261.957) (-261.095) (-261.917) [-262.030] * (-262.928) (-260.378) [-260.815] (-261.929) -- 0:00:48

      Average standard deviation of split frequencies: 0.018094

      270500 -- (-264.654) (-259.382) [-263.113] (-263.540) * [-262.172] (-263.271) (-260.344) (-260.884) -- 0:00:48
      271000 -- (-259.687) (-262.961) [-260.311] (-261.572) * (-263.229) (-260.647) [-260.183] (-265.142) -- 0:00:48
      271500 -- [-260.916] (-261.748) (-263.192) (-259.422) * (-261.456) (-260.311) [-260.708] (-260.031) -- 0:00:48
      272000 -- (-266.720) (-260.533) [-259.928] (-259.820) * [-260.959] (-262.266) (-259.712) (-262.396) -- 0:00:48
      272500 -- (-261.239) (-261.724) [-265.421] (-260.503) * [-265.013] (-261.171) (-262.174) (-262.772) -- 0:00:48
      273000 -- (-260.564) [-260.867] (-264.092) (-262.288) * (-260.553) [-262.714] (-261.248) (-261.345) -- 0:00:47
      273500 -- (-263.076) [-260.782] (-262.936) (-261.614) * (-259.851) (-265.040) [-261.724] (-260.771) -- 0:00:47
      274000 -- (-262.115) (-267.042) [-261.151] (-259.512) * [-261.022] (-266.793) (-261.887) (-261.303) -- 0:00:47
      274500 -- (-260.779) (-262.293) (-259.835) [-260.105] * (-260.835) (-259.498) [-259.904] (-261.339) -- 0:00:47
      275000 -- (-260.820) (-262.117) [-260.998] (-259.164) * (-262.475) [-262.055] (-263.004) (-259.803) -- 0:00:47

      Average standard deviation of split frequencies: 0.017170

      275500 -- [-264.090] (-259.699) (-261.977) (-260.061) * [-261.059] (-264.029) (-261.618) (-259.518) -- 0:00:47
      276000 -- (-261.438) (-261.382) [-260.708] (-259.914) * (-262.364) [-261.832] (-260.657) (-261.031) -- 0:00:47
      276500 -- (-260.955) (-264.747) (-261.595) [-259.701] * [-261.531] (-262.432) (-260.093) (-260.054) -- 0:00:47
      277000 -- (-260.485) [-261.496] (-261.263) (-264.354) * (-261.564) [-261.483] (-263.564) (-259.791) -- 0:00:46
      277500 -- [-262.247] (-267.528) (-262.685) (-260.075) * (-260.579) [-262.454] (-259.712) (-260.357) -- 0:00:46
      278000 -- (-260.543) [-261.463] (-262.218) (-260.985) * (-261.155) (-261.919) (-261.952) [-261.946] -- 0:00:46
      278500 -- (-259.790) [-260.658] (-261.153) (-261.960) * (-262.019) [-260.376] (-259.884) (-263.670) -- 0:00:46
      279000 -- (-259.856) (-262.548) (-264.205) [-262.375] * (-260.448) [-259.714] (-260.725) (-260.834) -- 0:00:46
      279500 -- (-264.368) (-261.037) (-266.974) [-261.120] * (-260.854) (-261.241) (-260.358) [-260.193] -- 0:00:46
      280000 -- (-260.396) [-260.887] (-262.914) (-261.107) * (-263.192) (-264.171) [-262.612] (-259.523) -- 0:00:46

      Average standard deviation of split frequencies: 0.015396

      280500 -- (-262.256) [-260.117] (-261.795) (-261.614) * [-260.794] (-261.149) (-262.041) (-261.266) -- 0:00:46
      281000 -- [-259.917] (-263.230) (-262.841) (-262.911) * [-261.823] (-260.337) (-261.790) (-260.756) -- 0:00:46
      281500 -- (-262.120) (-262.896) (-259.825) [-261.822] * [-260.800] (-260.250) (-259.776) (-262.460) -- 0:00:45
      282000 -- (-260.374) (-261.097) (-259.371) [-263.333] * (-260.950) (-259.697) [-260.720] (-263.385) -- 0:00:45
      282500 -- (-260.833) [-261.930] (-262.326) (-262.365) * [-263.397] (-260.951) (-261.618) (-264.701) -- 0:00:48
      283000 -- (-262.923) (-261.024) (-259.674) [-260.535] * (-260.602) [-259.780] (-260.495) (-263.190) -- 0:00:48
      283500 -- [-260.341] (-262.369) (-260.672) (-263.470) * [-262.723] (-262.691) (-263.014) (-263.768) -- 0:00:48
      284000 -- (-263.307) [-264.832] (-262.915) (-265.503) * (-263.970) [-259.513] (-261.230) (-260.217) -- 0:00:47
      284500 -- [-261.902] (-260.888) (-259.213) (-260.446) * (-260.237) (-260.365) (-261.760) [-259.934] -- 0:00:47
      285000 -- (-260.659) [-260.386] (-260.915) (-261.155) * (-261.378) [-259.986] (-265.377) (-260.066) -- 0:00:47

      Average standard deviation of split frequencies: 0.014921

      285500 -- (-264.540) [-259.698] (-259.799) (-260.295) * (-261.470) [-262.168] (-261.438) (-260.957) -- 0:00:47
      286000 -- (-259.452) (-260.345) (-260.330) [-261.396] * [-260.346] (-261.316) (-259.920) (-263.180) -- 0:00:47
      286500 -- (-259.571) (-267.601) (-263.104) [-261.532] * (-264.854) (-259.244) (-263.619) [-261.525] -- 0:00:47
      287000 -- (-260.271) (-263.119) [-264.204] (-262.843) * (-261.863) [-259.539] (-264.330) (-259.781) -- 0:00:47
      287500 -- (-264.327) (-266.001) (-263.180) [-262.854] * (-260.439) (-260.215) (-264.540) [-261.721] -- 0:00:47
      288000 -- (-265.771) [-259.973] (-261.317) (-259.228) * (-260.960) (-260.957) [-260.335] (-261.407) -- 0:00:46
      288500 -- (-261.494) [-260.608] (-262.442) (-260.503) * [-259.915] (-263.097) (-264.079) (-261.607) -- 0:00:46
      289000 -- (-262.155) (-261.836) (-265.131) [-261.715] * (-259.887) (-262.601) (-263.644) [-260.070] -- 0:00:46
      289500 -- (-262.858) (-261.584) (-263.936) [-261.141] * [-261.850] (-263.266) (-269.877) (-263.290) -- 0:00:46
      290000 -- (-262.355) (-264.559) (-260.622) [-262.361] * (-262.312) (-260.008) (-260.072) [-260.651] -- 0:00:46

      Average standard deviation of split frequencies: 0.016600

      290500 -- [-259.950] (-261.099) (-261.331) (-260.767) * (-260.869) (-260.048) [-259.680] (-262.217) -- 0:00:46
      291000 -- (-261.662) (-261.627) [-259.714] (-264.682) * (-261.157) (-259.967) [-261.168] (-260.553) -- 0:00:46
      291500 -- [-262.294] (-259.773) (-261.233) (-265.011) * (-263.808) (-261.273) (-260.342) [-260.183] -- 0:00:46
      292000 -- (-263.581) [-261.612] (-265.140) (-263.885) * (-263.060) (-264.852) (-260.023) [-263.498] -- 0:00:46
      292500 -- (-261.727) [-259.607] (-261.125) (-264.216) * (-261.896) (-260.666) [-263.222] (-263.923) -- 0:00:45
      293000 -- (-264.043) (-261.459) (-261.360) [-260.079] * (-261.759) [-261.022] (-260.542) (-261.058) -- 0:00:45
      293500 -- (-266.495) [-260.786] (-262.877) (-259.723) * [-261.454] (-260.341) (-260.771) (-263.260) -- 0:00:45
      294000 -- (-263.054) (-261.531) [-260.096] (-260.322) * (-260.711) (-262.444) [-259.727] (-260.266) -- 0:00:45
      294500 -- (-265.172) (-261.746) [-260.677] (-265.297) * (-261.594) (-260.819) (-261.149) [-260.226] -- 0:00:45
      295000 -- (-261.072) (-261.322) [-260.502] (-261.165) * (-263.821) (-260.316) (-264.934) [-259.739] -- 0:00:45

      Average standard deviation of split frequencies: 0.016545

      295500 -- (-261.737) [-259.858] (-260.825) (-261.797) * [-262.163] (-260.458) (-260.328) (-261.260) -- 0:00:45
      296000 -- (-263.066) (-261.790) [-263.588] (-265.100) * (-261.173) (-261.647) [-260.500] (-262.646) -- 0:00:45
      296500 -- (-261.199) [-259.908] (-262.258) (-265.014) * [-263.207] (-260.963) (-261.269) (-261.254) -- 0:00:45
      297000 -- (-261.506) (-261.030) [-260.661] (-261.698) * [-262.133] (-263.952) (-260.230) (-261.101) -- 0:00:44
      297500 -- (-263.836) [-261.855] (-260.023) (-260.188) * [-268.652] (-268.731) (-260.056) (-265.115) -- 0:00:44
      298000 -- (-265.289) (-262.082) (-259.777) [-259.900] * (-261.447) [-261.033] (-260.086) (-261.122) -- 0:00:47
      298500 -- (-261.667) [-259.927] (-260.188) (-260.656) * (-260.220) (-260.191) [-260.700] (-263.441) -- 0:00:47
      299000 -- (-259.056) (-260.325) (-262.155) [-260.303] * (-260.417) [-260.680] (-263.857) (-259.581) -- 0:00:46
      299500 -- (-260.005) (-260.267) [-263.963] (-264.654) * (-262.282) (-259.747) (-260.914) [-260.018] -- 0:00:46
      300000 -- [-261.543] (-262.871) (-262.061) (-264.503) * (-261.546) [-262.279] (-260.371) (-260.661) -- 0:00:46

      Average standard deviation of split frequencies: 0.017339

      300500 -- (-262.452) (-261.784) (-260.620) [-261.283] * (-260.508) (-261.825) (-259.986) [-262.294] -- 0:00:46
      301000 -- (-264.552) (-260.885) [-266.177] (-263.676) * (-261.489) (-261.519) [-261.083] (-262.220) -- 0:00:46
      301500 -- (-263.864) [-263.847] (-259.566) (-261.480) * (-261.296) (-260.839) [-262.362] (-260.583) -- 0:00:46
      302000 -- (-259.360) (-263.108) [-260.584] (-260.971) * (-263.037) (-265.178) (-264.250) [-260.150] -- 0:00:46
      302500 -- (-260.869) (-260.875) (-262.516) [-260.219] * (-260.543) [-261.769] (-265.613) (-259.647) -- 0:00:46
      303000 -- (-261.423) [-262.898] (-259.799) (-261.255) * [-262.101] (-263.063) (-260.274) (-260.615) -- 0:00:46
      303500 -- (-262.731) (-262.746) [-261.572] (-260.336) * (-262.634) [-261.121] (-261.299) (-259.330) -- 0:00:45
      304000 -- (-263.975) (-267.694) [-263.687] (-264.614) * [-261.553] (-261.680) (-263.332) (-260.203) -- 0:00:45
      304500 -- [-261.726] (-262.649) (-261.695) (-260.962) * (-262.757) (-260.276) [-260.534] (-265.812) -- 0:00:45
      305000 -- (-263.096) (-267.326) [-262.967] (-261.148) * (-262.601) (-261.947) (-263.043) [-260.826] -- 0:00:45

      Average standard deviation of split frequencies: 0.016860

      305500 -- (-263.742) (-259.317) (-261.295) [-260.669] * (-259.940) (-261.267) [-259.932] (-263.242) -- 0:00:45
      306000 -- (-260.597) (-262.804) (-263.765) [-259.877] * (-264.554) (-262.624) (-262.071) [-260.918] -- 0:00:45
      306500 -- [-260.358] (-260.311) (-261.449) (-259.880) * (-262.269) (-262.524) [-261.873] (-264.201) -- 0:00:45
      307000 -- [-261.731] (-263.872) (-260.871) (-260.111) * [-260.942] (-262.433) (-260.650) (-259.761) -- 0:00:45
      307500 -- (-262.253) (-262.228) [-260.327] (-260.074) * (-259.523) [-261.982] (-259.802) (-260.453) -- 0:00:45
      308000 -- (-259.992) [-259.628] (-261.513) (-262.797) * [-259.924] (-262.014) (-265.094) (-264.436) -- 0:00:44
      308500 -- (-261.828) (-261.041) (-265.153) [-262.339] * (-261.658) (-264.915) [-264.640] (-266.807) -- 0:00:44
      309000 -- (-261.125) (-264.874) (-263.568) [-260.481] * [-261.113] (-263.689) (-261.761) (-260.869) -- 0:00:44
      309500 -- (-261.701) (-263.222) [-260.863] (-260.135) * (-264.409) (-260.688) (-263.227) [-261.876] -- 0:00:44
      310000 -- (-260.992) (-260.671) [-264.288] (-260.191) * (-260.188) [-261.103] (-260.925) (-262.983) -- 0:00:44

      Average standard deviation of split frequencies: 0.016691

      310500 -- [-260.145] (-259.661) (-260.305) (-263.807) * (-262.680) (-260.239) [-260.338] (-262.124) -- 0:00:44
      311000 -- (-261.902) (-260.371) (-259.307) [-261.099] * (-261.764) (-261.151) (-259.896) [-259.036] -- 0:00:44
      311500 -- (-260.481) (-264.254) (-264.384) [-264.732] * (-265.946) [-259.479] (-264.227) (-260.843) -- 0:00:44
      312000 -- (-261.124) [-261.755] (-264.499) (-260.780) * (-260.400) [-262.792] (-260.639) (-258.919) -- 0:00:44
      312500 -- [-259.597] (-259.685) (-263.441) (-260.638) * (-260.313) (-259.549) (-261.363) [-262.674] -- 0:00:44
      313000 -- (-259.783) [-260.663] (-260.395) (-260.710) * (-260.645) (-261.242) [-262.157] (-263.540) -- 0:00:43
      313500 -- (-264.639) [-261.644] (-259.759) (-260.489) * (-260.668) [-259.893] (-263.558) (-260.232) -- 0:00:43
      314000 -- (-263.043) (-259.349) [-263.709] (-266.617) * (-262.036) (-260.232) (-262.383) [-261.427] -- 0:00:45
      314500 -- (-259.808) (-259.810) [-264.372] (-262.533) * (-261.350) (-261.108) [-261.121] (-261.674) -- 0:00:45
      315000 -- (-259.858) (-260.164) (-261.782) [-260.498] * [-261.468] (-261.492) (-260.683) (-259.697) -- 0:00:45

      Average standard deviation of split frequencies: 0.016645

      315500 -- (-262.989) (-260.732) (-263.478) [-261.355] * (-261.245) (-264.219) (-260.376) [-259.518] -- 0:00:45
      316000 -- (-266.392) [-260.515] (-267.297) (-262.069) * [-261.115] (-260.328) (-262.715) (-261.252) -- 0:00:45
      316500 -- (-263.643) (-261.325) (-263.908) [-260.917] * (-262.078) [-261.910] (-262.395) (-262.273) -- 0:00:45
      317000 -- [-260.976] (-262.417) (-265.350) (-259.761) * (-261.168) [-260.424] (-259.842) (-262.301) -- 0:00:45
      317500 -- [-261.821] (-261.250) (-261.283) (-261.251) * (-261.852) [-263.454] (-261.779) (-261.834) -- 0:00:45
      318000 -- [-263.537] (-261.669) (-260.699) (-261.731) * (-260.632) (-261.691) [-261.469] (-266.355) -- 0:00:45
      318500 -- [-260.590] (-260.850) (-265.341) (-259.759) * (-260.578) (-266.680) (-262.188) [-261.682] -- 0:00:44
      319000 -- (-261.382) (-261.945) (-260.989) [-260.646] * [-261.158] (-262.954) (-263.397) (-260.311) -- 0:00:44
      319500 -- [-260.661] (-263.442) (-260.300) (-260.042) * (-261.058) (-260.398) (-260.869) [-262.751] -- 0:00:44
      320000 -- (-259.694) [-260.477] (-262.938) (-263.444) * (-260.310) (-259.963) [-259.780] (-265.446) -- 0:00:44

      Average standard deviation of split frequencies: 0.016016

      320500 -- [-261.385] (-262.413) (-259.325) (-261.271) * (-260.735) (-265.578) (-261.301) [-260.942] -- 0:00:44
      321000 -- (-261.429) (-264.789) (-261.938) [-264.568] * (-263.477) [-260.404] (-262.274) (-261.579) -- 0:00:44
      321500 -- (-262.748) (-261.101) (-264.709) [-259.577] * (-259.803) [-260.002] (-260.223) (-262.188) -- 0:00:44
      322000 -- (-265.665) (-260.451) [-260.614] (-259.530) * [-260.075] (-262.579) (-261.041) (-260.989) -- 0:00:44
      322500 -- (-263.444) [-259.149] (-260.173) (-262.817) * [-261.325] (-259.593) (-261.770) (-259.921) -- 0:00:44
      323000 -- (-262.259) (-261.645) [-259.622] (-259.779) * (-260.618) (-262.317) [-261.649] (-260.995) -- 0:00:44
      323500 -- (-263.117) (-259.873) [-262.065] (-266.687) * (-261.757) (-261.529) [-261.788] (-264.558) -- 0:00:43
      324000 -- [-266.229] (-260.331) (-261.104) (-261.467) * [-266.419] (-261.811) (-264.558) (-260.237) -- 0:00:43
      324500 -- [-267.048] (-261.980) (-258.984) (-264.692) * (-263.201) (-259.478) (-263.728) [-262.300] -- 0:00:43
      325000 -- (-260.489) (-262.872) (-260.550) [-264.184] * [-261.602] (-262.047) (-262.374) (-264.558) -- 0:00:43

      Average standard deviation of split frequencies: 0.015678

      325500 -- (-261.677) (-260.695) (-262.020) [-261.150] * (-267.815) (-261.486) (-262.558) [-262.610] -- 0:00:43
      326000 -- (-261.454) (-261.794) (-260.345) [-260.102] * (-262.773) (-260.840) [-267.042] (-259.351) -- 0:00:43
      326500 -- (-261.327) (-263.273) (-261.957) [-260.957] * (-260.017) (-261.490) [-260.602] (-264.318) -- 0:00:43
      327000 -- (-263.153) (-261.162) [-260.664] (-260.797) * [-260.964] (-260.897) (-261.558) (-261.597) -- 0:00:43
      327500 -- (-264.955) (-260.741) [-261.777] (-262.052) * (-260.932) (-263.004) (-261.058) [-262.478] -- 0:00:43
      328000 -- (-260.886) [-259.622] (-260.837) (-265.273) * [-259.707] (-263.672) (-260.056) (-259.914) -- 0:00:43
      328500 -- (-263.661) (-259.379) [-263.531] (-262.245) * (-260.629) (-262.305) [-260.517] (-264.117) -- 0:00:42
      329000 -- (-265.178) [-259.740] (-262.463) (-260.027) * (-261.850) [-260.612] (-262.595) (-261.825) -- 0:00:42
      329500 -- (-262.796) (-261.730) [-259.910] (-262.607) * (-261.536) (-260.565) [-260.688] (-262.761) -- 0:00:42
      330000 -- (-260.636) [-264.493] (-260.295) (-261.492) * (-261.748) (-262.827) (-260.430) [-263.459] -- 0:00:44

      Average standard deviation of split frequencies: 0.015682

      330500 -- (-261.036) (-260.825) (-264.421) [-259.176] * [-261.048] (-260.853) (-261.079) (-260.866) -- 0:00:44
      331000 -- (-259.460) [-261.612] (-260.883) (-265.590) * (-260.942) (-260.294) (-263.932) [-260.810] -- 0:00:44
      331500 -- [-262.163] (-265.006) (-263.557) (-261.927) * (-261.065) (-263.478) (-261.858) [-261.054] -- 0:00:44
      332000 -- (-262.315) (-260.137) [-263.603] (-260.050) * (-261.899) (-261.412) (-263.344) [-259.620] -- 0:00:44
      332500 -- (-260.276) (-259.631) [-262.647] (-262.091) * (-260.706) (-263.923) [-263.884] (-262.990) -- 0:00:44
      333000 -- (-262.260) [-260.183] (-263.444) (-262.240) * (-262.464) [-260.482] (-260.250) (-259.770) -- 0:00:44
      333500 -- (-262.683) (-261.363) (-262.952) [-260.362] * (-259.711) (-262.463) [-266.157] (-260.980) -- 0:00:43
      334000 -- (-260.948) [-261.001] (-262.223) (-259.463) * (-260.000) (-262.288) (-262.709) [-259.426] -- 0:00:43
      334500 -- (-261.289) (-261.128) (-261.650) [-263.140] * (-259.413) [-261.605] (-261.139) (-264.948) -- 0:00:43
      335000 -- (-261.602) (-263.469) [-261.932] (-260.684) * [-260.222] (-261.898) (-263.773) (-260.240) -- 0:00:43

      Average standard deviation of split frequencies: 0.013952

      335500 -- [-261.690] (-260.773) (-264.266) (-262.109) * (-262.282) [-259.820] (-263.672) (-259.741) -- 0:00:43
      336000 -- (-262.091) (-261.959) [-262.748] (-260.612) * (-266.922) (-263.562) [-262.775] (-260.536) -- 0:00:43
      336500 -- (-258.969) (-262.795) [-260.046] (-260.572) * [-265.537] (-259.894) (-261.269) (-264.298) -- 0:00:43
      337000 -- (-260.599) [-260.598] (-261.611) (-261.053) * (-262.262) (-260.323) [-260.513] (-262.345) -- 0:00:43
      337500 -- (-265.157) (-263.188) [-261.211] (-259.809) * (-261.257) (-260.829) [-259.745] (-267.755) -- 0:00:43
      338000 -- [-262.143] (-262.816) (-261.124) (-261.887) * (-264.983) (-261.932) [-259.780] (-262.869) -- 0:00:43
      338500 -- (-259.833) [-263.650] (-260.482) (-261.186) * (-261.625) [-262.353] (-260.581) (-260.678) -- 0:00:42
      339000 -- (-259.983) (-260.604) [-260.850] (-261.845) * (-267.970) (-260.198) (-260.805) [-263.026] -- 0:00:42
      339500 -- (-260.466) [-260.072] (-264.627) (-261.525) * (-265.030) (-260.929) (-263.483) [-262.139] -- 0:00:42
      340000 -- (-261.165) (-260.703) (-261.269) [-266.093] * (-262.251) (-263.809) [-263.071] (-260.739) -- 0:00:42

      Average standard deviation of split frequencies: 0.014407

      340500 -- (-262.130) (-263.045) [-260.567] (-266.283) * (-261.619) (-266.095) [-261.623] (-262.445) -- 0:00:42
      341000 -- [-260.547] (-260.719) (-259.799) (-264.495) * (-262.398) (-265.619) (-262.549) [-260.309] -- 0:00:42
      341500 -- (-261.920) (-262.371) (-262.271) [-260.644] * [-263.606] (-264.262) (-259.329) (-260.303) -- 0:00:42
      342000 -- [-261.596] (-263.251) (-261.993) (-262.835) * (-263.737) [-259.405] (-260.255) (-259.964) -- 0:00:42
      342500 -- (-262.019) [-263.856] (-263.053) (-261.773) * (-260.566) (-260.918) (-261.080) [-260.781] -- 0:00:42
      343000 -- (-261.235) [-261.843] (-260.370) (-261.646) * (-260.221) (-264.028) (-260.414) [-262.847] -- 0:00:42
      343500 -- [-259.920] (-262.352) (-261.085) (-260.863) * [-259.601] (-260.267) (-261.064) (-264.584) -- 0:00:42
      344000 -- (-260.185) [-259.820] (-261.511) (-263.134) * (-264.927) [-261.150] (-261.097) (-262.633) -- 0:00:41
      344500 -- (-263.291) [-261.238] (-260.159) (-268.456) * [-262.450] (-259.251) (-263.553) (-265.371) -- 0:00:41
      345000 -- (-264.794) [-261.817] (-262.871) (-269.818) * (-259.991) (-263.375) (-262.762) [-260.638] -- 0:00:41

      Average standard deviation of split frequencies: 0.014987

      345500 -- [-262.541] (-261.338) (-262.503) (-272.505) * (-259.337) [-259.234] (-261.115) (-259.881) -- 0:00:43
      346000 -- (-260.798) [-259.863] (-261.098) (-260.742) * (-259.687) [-260.134] (-260.447) (-267.883) -- 0:00:43
      346500 -- (-268.406) [-260.782] (-259.847) (-262.531) * (-264.095) (-259.695) (-261.576) [-264.888] -- 0:00:43
      347000 -- (-262.393) [-259.689] (-259.652) (-259.808) * [-264.448] (-266.417) (-260.006) (-263.696) -- 0:00:43
      347500 -- (-259.855) (-259.784) (-260.854) [-259.905] * (-260.746) (-267.081) (-259.353) [-261.553] -- 0:00:43
      348000 -- (-262.953) (-260.243) [-261.757] (-263.260) * (-259.237) [-267.852] (-260.163) (-262.574) -- 0:00:43
      348500 -- (-259.813) [-261.538] (-264.062) (-259.959) * (-260.389) (-259.480) [-262.130] (-265.214) -- 0:00:42
      349000 -- (-261.934) (-262.082) [-263.859] (-262.590) * (-261.338) (-260.416) (-263.057) [-259.661] -- 0:00:42
      349500 -- (-263.628) (-259.373) (-266.244) [-259.479] * (-261.473) (-261.382) (-262.679) [-261.092] -- 0:00:42
      350000 -- (-262.236) (-259.670) (-266.583) [-264.090] * (-262.011) (-262.864) (-263.652) [-261.575] -- 0:00:42

      Average standard deviation of split frequencies: 0.014946

      350500 -- (-269.384) (-261.527) (-261.975) [-259.904] * (-261.492) (-262.411) [-259.222] (-261.743) -- 0:00:42
      351000 -- [-260.075] (-262.870) (-262.584) (-264.159) * (-261.649) (-261.662) [-260.963] (-262.196) -- 0:00:42
      351500 -- (-261.819) (-262.421) [-259.647] (-261.706) * (-259.932) (-260.853) (-261.586) [-261.415] -- 0:00:42
      352000 -- (-263.382) (-259.902) [-261.680] (-265.909) * (-259.946) [-268.015] (-261.346) (-261.559) -- 0:00:42
      352500 -- [-260.591] (-261.233) (-263.032) (-267.206) * (-262.280) (-260.930) (-259.712) [-260.265] -- 0:00:42
      353000 -- (-259.911) (-259.625) (-263.094) [-263.663] * (-263.152) (-260.158) (-260.357) [-263.836] -- 0:00:42
      353500 -- (-260.344) (-261.606) (-266.250) [-260.954] * (-261.700) [-260.876] (-261.666) (-262.356) -- 0:00:42
      354000 -- (-263.228) (-262.029) (-264.301) [-262.305] * [-264.629] (-260.454) (-262.456) (-263.056) -- 0:00:41
      354500 -- (-259.908) (-261.838) (-263.466) [-260.516] * (-261.389) (-261.912) [-262.492] (-263.961) -- 0:00:41
      355000 -- (-260.172) (-261.222) (-262.044) [-264.217] * (-263.228) (-261.072) [-261.980] (-262.890) -- 0:00:41

      Average standard deviation of split frequencies: 0.014198

      355500 -- [-260.473] (-262.382) (-260.629) (-261.325) * [-261.863] (-260.091) (-263.866) (-262.045) -- 0:00:41
      356000 -- (-260.248) [-259.710] (-260.784) (-260.023) * (-260.833) (-261.762) [-259.320] (-260.632) -- 0:00:41
      356500 -- [-261.596] (-259.553) (-260.787) (-260.164) * (-263.024) (-259.986) (-261.196) [-262.054] -- 0:00:41
      357000 -- (-260.532) (-260.625) (-263.275) [-261.641] * [-259.776] (-261.084) (-261.828) (-260.027) -- 0:00:41
      357500 -- (-260.755) (-261.183) (-260.594) [-260.878] * (-260.764) [-260.693] (-263.924) (-262.050) -- 0:00:41
      358000 -- (-260.781) (-259.176) [-260.286] (-259.712) * [-262.085] (-262.009) (-262.565) (-261.713) -- 0:00:41
      358500 -- [-259.540] (-259.690) (-261.565) (-261.820) * (-262.179) (-260.582) (-260.333) [-260.317] -- 0:00:41
      359000 -- (-260.750) [-260.208] (-263.379) (-262.618) * (-265.694) (-260.425) (-261.189) [-264.985] -- 0:00:41
      359500 -- [-259.924] (-262.102) (-266.064) (-260.490) * [-262.424] (-260.143) (-263.672) (-260.064) -- 0:00:40
      360000 -- (-260.905) (-259.793) (-265.097) [-261.160] * (-262.687) (-261.311) [-260.502] (-261.417) -- 0:00:40

      Average standard deviation of split frequencies: 0.014087

      360500 -- (-260.322) (-263.338) (-264.328) [-259.790] * (-260.863) (-261.883) [-261.943] (-260.745) -- 0:00:42
      361000 -- (-260.349) (-259.671) [-261.463] (-260.233) * (-261.709) (-263.131) [-259.689] (-262.901) -- 0:00:42
      361500 -- (-259.594) (-259.722) [-263.264] (-262.329) * (-260.469) (-261.803) [-260.418] (-260.334) -- 0:00:42
      362000 -- (-263.090) (-260.563) [-266.282] (-261.367) * (-264.871) (-262.462) (-261.156) [-261.387] -- 0:00:42
      362500 -- (-260.656) (-261.139) [-264.198] (-260.155) * [-259.739] (-262.292) (-262.591) (-260.139) -- 0:00:42
      363000 -- (-262.497) (-259.502) [-261.777] (-260.694) * (-260.741) (-260.214) (-259.782) [-262.081] -- 0:00:42
      363500 -- (-261.558) [-261.150] (-259.362) (-264.316) * (-261.332) (-262.235) (-260.765) [-259.592] -- 0:00:42
      364000 -- (-263.345) (-260.497) (-261.211) [-263.672] * [-262.084] (-259.562) (-261.887) (-261.502) -- 0:00:41
      364500 -- (-259.720) (-260.009) [-260.637] (-263.583) * [-259.209] (-261.549) (-260.377) (-263.288) -- 0:00:41
      365000 -- (-261.592) (-261.628) [-261.069] (-259.935) * [-260.344] (-259.377) (-262.563) (-261.114) -- 0:00:41

      Average standard deviation of split frequencies: 0.013309

      365500 -- (-262.074) [-261.446] (-261.591) (-260.684) * (-260.599) (-260.485) (-263.202) [-262.069] -- 0:00:41
      366000 -- (-261.455) (-262.977) [-260.065] (-261.025) * (-259.868) [-259.993] (-261.618) (-260.937) -- 0:00:41
      366500 -- (-262.131) (-262.905) [-261.826] (-259.635) * (-260.235) [-259.382] (-260.000) (-262.934) -- 0:00:41
      367000 -- (-262.782) [-260.164] (-264.452) (-259.739) * [-261.076] (-260.322) (-263.298) (-262.618) -- 0:00:41
      367500 -- [-263.131] (-262.707) (-260.763) (-259.821) * [-259.818] (-263.445) (-261.877) (-262.302) -- 0:00:41
      368000 -- (-262.763) (-259.521) (-259.865) [-261.882] * (-265.270) (-260.642) (-261.866) [-261.391] -- 0:00:41
      368500 -- (-262.853) [-259.917] (-260.585) (-259.547) * (-265.620) (-260.552) (-261.177) [-260.115] -- 0:00:41
      369000 -- (-261.312) (-267.831) [-259.816] (-261.702) * (-259.736) [-261.601] (-265.136) (-263.699) -- 0:00:41
      369500 -- [-263.047] (-261.329) (-259.712) (-261.745) * (-265.129) (-260.698) (-261.407) [-262.804] -- 0:00:40
      370000 -- (-260.518) (-261.521) (-262.019) [-260.817] * (-262.585) (-262.239) [-260.558] (-260.750) -- 0:00:40

      Average standard deviation of split frequencies: 0.014272

      370500 -- [-260.441] (-260.975) (-260.826) (-265.367) * (-265.131) [-260.112] (-260.780) (-264.263) -- 0:00:40
      371000 -- (-259.593) [-261.938] (-260.688) (-262.295) * (-260.443) (-260.207) (-260.893) [-261.296] -- 0:00:40
      371500 -- [-259.854] (-262.087) (-260.905) (-259.226) * (-260.502) (-260.958) [-261.245] (-266.222) -- 0:00:40
      372000 -- (-259.272) (-263.181) [-262.047] (-260.007) * [-261.177] (-261.839) (-259.418) (-258.921) -- 0:00:40
      372500 -- (-262.685) (-262.460) [-264.004] (-262.373) * [-263.202] (-260.146) (-260.079) (-259.702) -- 0:00:40
      373000 -- (-265.214) (-265.776) (-262.211) [-261.236] * [-265.854] (-264.186) (-259.785) (-260.901) -- 0:00:40
      373500 -- (-259.728) (-259.717) [-259.959] (-259.824) * (-260.362) (-264.205) [-261.647] (-261.326) -- 0:00:40
      374000 -- (-262.127) [-264.764] (-262.822) (-261.626) * (-260.929) [-266.779] (-269.053) (-260.598) -- 0:00:40
      374500 -- (-260.185) [-261.335] (-261.819) (-262.050) * (-261.144) (-261.378) (-261.263) [-262.072] -- 0:00:40
      375000 -- [-259.812] (-263.436) (-261.940) (-260.298) * (-261.878) (-261.367) [-260.905] (-258.934) -- 0:00:40

      Average standard deviation of split frequencies: 0.013652

      375500 -- (-260.848) (-262.826) (-264.360) [-262.408] * [-260.439] (-261.552) (-260.874) (-259.682) -- 0:00:39
      376000 -- (-261.216) (-261.404) [-261.351] (-262.194) * (-266.724) [-259.280] (-264.318) (-260.128) -- 0:00:39
      376500 -- (-261.495) (-260.554) [-260.667] (-263.861) * (-265.731) (-260.216) [-262.765] (-263.399) -- 0:00:41
      377000 -- (-259.556) (-262.003) [-264.610] (-265.414) * (-263.504) (-261.256) (-262.616) [-260.218] -- 0:00:41
      377500 -- (-259.314) [-259.732] (-263.256) (-259.708) * (-264.157) (-259.979) [-264.579] (-264.060) -- 0:00:41
      378000 -- (-260.750) (-261.406) [-260.333] (-264.686) * (-259.973) (-267.667) (-261.221) [-263.666] -- 0:00:41
      378500 -- [-259.785] (-259.655) (-259.982) (-259.357) * [-261.241] (-260.994) (-260.745) (-259.752) -- 0:00:41
      379000 -- [-261.697] (-259.362) (-262.339) (-261.150) * (-263.257) (-261.364) (-262.385) [-260.473] -- 0:00:40
      379500 -- (-262.342) (-261.031) [-261.491] (-263.053) * (-266.444) (-261.272) (-264.015) [-264.358] -- 0:00:40
      380000 -- (-261.986) (-262.184) (-261.985) [-260.733] * [-261.942] (-262.469) (-264.459) (-260.883) -- 0:00:40

      Average standard deviation of split frequencies: 0.014991

      380500 -- (-260.671) (-266.045) (-261.970) [-263.849] * (-262.983) (-263.346) [-259.583] (-260.456) -- 0:00:40
      381000 -- [-261.157] (-266.460) (-262.197) (-266.649) * (-262.564) [-258.836] (-260.141) (-259.313) -- 0:00:40
      381500 -- (-264.411) (-261.213) [-261.398] (-262.810) * (-264.686) (-259.847) [-260.943] (-260.393) -- 0:00:40
      382000 -- (-261.091) (-259.411) [-259.488] (-265.652) * (-261.587) [-259.281] (-261.118) (-260.362) -- 0:00:40
      382500 -- [-263.672] (-259.715) (-260.101) (-263.217) * (-261.033) [-260.357] (-261.378) (-261.245) -- 0:00:40
      383000 -- (-260.432) [-260.170] (-262.197) (-263.747) * (-260.995) [-260.820] (-264.377) (-262.613) -- 0:00:40
      383500 -- (-264.142) (-259.926) [-260.585] (-260.163) * (-262.654) (-267.000) (-259.905) [-260.210] -- 0:00:40
      384000 -- (-264.007) (-260.882) [-263.179] (-260.116) * (-263.666) (-261.162) [-263.444] (-260.107) -- 0:00:40
      384500 -- (-262.150) [-259.973] (-262.269) (-259.891) * [-262.514] (-261.355) (-262.496) (-260.659) -- 0:00:40
      385000 -- (-259.418) [-261.861] (-259.956) (-263.170) * (-261.236) (-264.258) (-261.596) [-260.608] -- 0:00:39

      Average standard deviation of split frequencies: 0.014180

      385500 -- [-260.299] (-260.634) (-260.298) (-261.274) * [-259.925] (-262.600) (-259.987) (-263.753) -- 0:00:39
      386000 -- (-259.955) (-262.294) [-260.499] (-261.199) * (-261.053) (-261.449) [-261.963] (-262.194) -- 0:00:39
      386500 -- [-261.639] (-260.045) (-258.822) (-260.996) * (-263.578) [-262.559] (-262.611) (-259.818) -- 0:00:39
      387000 -- [-259.897] (-259.643) (-259.354) (-263.626) * (-259.664) (-260.355) (-259.864) [-260.672] -- 0:00:39
      387500 -- (-260.359) (-260.697) [-260.279] (-262.104) * [-259.940] (-259.966) (-259.353) (-260.580) -- 0:00:39
      388000 -- (-259.269) (-260.027) [-260.557] (-261.673) * (-260.134) (-259.403) [-260.716] (-260.931) -- 0:00:39
      388500 -- (-260.694) [-261.084] (-261.975) (-265.332) * (-259.818) (-260.568) (-265.824) [-263.985] -- 0:00:39
      389000 -- [-260.547] (-260.791) (-259.840) (-264.066) * (-261.459) (-264.071) (-259.494) [-261.952] -- 0:00:39
      389500 -- (-260.958) (-267.576) (-260.414) [-264.071] * [-261.520] (-262.524) (-262.108) (-267.951) -- 0:00:39
      390000 -- (-260.916) (-267.909) (-260.017) [-260.678] * [-260.560] (-260.813) (-261.295) (-259.254) -- 0:00:39

      Average standard deviation of split frequencies: 0.014413

      390500 -- (-261.261) (-261.024) (-262.146) [-262.873] * (-259.306) (-263.203) (-262.243) [-260.411] -- 0:00:39
      391000 -- (-263.026) [-259.645] (-261.871) (-260.117) * (-259.666) (-259.800) [-261.040] (-261.289) -- 0:00:38
      391500 -- [-261.159] (-260.041) (-263.587) (-260.068) * (-263.193) (-259.588) (-267.008) [-259.060] -- 0:00:38
      392000 -- (-259.948) [-260.285] (-261.508) (-259.989) * (-261.641) [-261.358] (-263.388) (-265.930) -- 0:00:40
      392500 -- (-262.164) (-260.911) (-261.898) [-260.266] * (-259.330) [-261.273] (-259.203) (-259.671) -- 0:00:40
      393000 -- (-264.411) (-261.449) (-260.345) [-259.096] * [-259.766] (-260.944) (-261.834) (-260.420) -- 0:00:40
      393500 -- [-263.737] (-261.822) (-260.534) (-259.613) * (-260.464) [-260.581] (-260.865) (-260.057) -- 0:00:40
      394000 -- (-265.557) (-259.307) (-261.337) [-260.381] * [-261.048] (-260.055) (-260.258) (-261.750) -- 0:00:39
      394500 -- (-260.618) (-260.034) [-259.427] (-260.699) * (-261.504) [-260.229] (-260.206) (-260.214) -- 0:00:39
      395000 -- (-261.881) [-259.972] (-259.083) (-260.388) * (-259.589) (-262.102) (-261.163) [-259.630] -- 0:00:39

      Average standard deviation of split frequencies: 0.014087

      395500 -- (-263.604) (-259.668) (-259.821) [-262.312] * (-259.997) (-260.011) [-261.337] (-261.258) -- 0:00:39
      396000 -- (-263.025) [-260.414] (-267.288) (-261.804) * [-261.300] (-260.542) (-265.191) (-260.237) -- 0:00:39
      396500 -- (-260.845) (-260.451) (-259.649) [-259.518] * (-260.687) [-263.313] (-259.959) (-263.052) -- 0:00:39
      397000 -- (-266.864) (-262.978) (-263.581) [-259.466] * (-260.797) [-260.858] (-260.553) (-264.585) -- 0:00:39
      397500 -- [-265.653] (-261.405) (-259.805) (-262.950) * (-259.074) (-267.998) (-263.207) [-259.679] -- 0:00:39
      398000 -- (-259.480) (-260.514) [-259.867] (-262.459) * (-260.949) (-264.487) (-262.246) [-263.490] -- 0:00:39
      398500 -- (-261.949) [-260.775] (-262.226) (-263.534) * [-259.880] (-262.286) (-264.209) (-259.880) -- 0:00:39
      399000 -- (-261.610) [-260.981] (-259.438) (-261.633) * (-260.414) (-264.283) [-261.151] (-262.587) -- 0:00:39
      399500 -- (-260.793) (-260.638) [-259.683] (-262.117) * (-262.240) (-262.416) [-260.109] (-263.081) -- 0:00:39
      400000 -- (-260.632) [-259.673] (-260.757) (-265.786) * (-262.977) [-264.607] (-260.665) (-260.520) -- 0:00:39

      Average standard deviation of split frequencies: 0.013773

      400500 -- (-260.524) (-259.536) (-259.774) [-263.176] * (-259.145) [-259.488] (-264.687) (-260.610) -- 0:00:38
      401000 -- (-259.955) [-265.107] (-259.385) (-261.231) * [-260.650] (-263.066) (-259.312) (-261.667) -- 0:00:38
      401500 -- (-260.610) [-262.144] (-262.071) (-259.831) * [-259.864] (-261.267) (-259.964) (-261.956) -- 0:00:38
      402000 -- [-261.067] (-260.945) (-261.501) (-260.300) * (-259.461) [-262.540] (-262.130) (-264.026) -- 0:00:38
      402500 -- (-260.015) (-260.451) [-259.390] (-262.427) * (-260.313) (-261.173) [-260.606] (-261.071) -- 0:00:38
      403000 -- (-264.686) [-263.361] (-262.190) (-260.228) * (-260.244) [-259.988] (-261.200) (-260.743) -- 0:00:38
      403500 -- (-261.717) (-261.016) [-264.290] (-262.123) * (-263.988) (-261.271) (-265.080) [-260.621] -- 0:00:38
      404000 -- (-263.319) [-260.625] (-261.571) (-264.291) * (-263.800) (-265.151) (-261.785) [-260.592] -- 0:00:38
      404500 -- (-264.629) [-260.917] (-262.948) (-265.543) * (-264.862) (-263.121) [-260.979] (-263.016) -- 0:00:38
      405000 -- (-263.151) [-259.784] (-262.091) (-262.419) * [-262.947] (-261.090) (-268.117) (-259.936) -- 0:00:38

      Average standard deviation of split frequencies: 0.014548

      405500 -- (-259.617) (-260.223) (-264.377) [-259.879] * (-262.312) [-263.165] (-261.036) (-260.443) -- 0:00:38
      406000 -- (-260.014) (-261.858) (-262.327) [-260.603] * (-260.515) (-262.408) [-261.924] (-262.235) -- 0:00:38
      406500 -- (-260.186) (-262.028) [-261.617] (-260.291) * (-259.007) (-263.800) (-264.116) [-260.521] -- 0:00:39
      407000 -- (-259.730) [-260.871] (-260.801) (-263.358) * [-258.976] (-265.204) (-260.183) (-260.559) -- 0:00:39
      407500 -- [-259.703] (-259.398) (-268.394) (-261.129) * [-259.749] (-265.024) (-260.309) (-262.217) -- 0:00:39
      408000 -- (-259.412) [-260.406] (-267.622) (-263.361) * (-263.327) (-260.682) [-260.420] (-259.519) -- 0:00:39
      408500 -- [-262.260] (-259.440) (-261.634) (-260.731) * (-260.978) [-259.907] (-263.248) (-262.434) -- 0:00:39
      409000 -- [-264.576] (-264.447) (-261.143) (-259.959) * (-261.605) [-260.294] (-262.708) (-261.095) -- 0:00:39
      409500 -- (-268.288) [-261.661] (-261.968) (-260.719) * (-261.805) (-261.989) [-262.024] (-262.294) -- 0:00:38
      410000 -- (-265.755) (-265.124) (-261.202) [-259.325] * (-264.943) (-264.313) (-261.173) [-263.890] -- 0:00:38

      Average standard deviation of split frequencies: 0.013990

      410500 -- (-264.487) [-260.467] (-260.107) (-259.570) * [-262.462] (-261.050) (-262.817) (-261.989) -- 0:00:38
      411000 -- (-263.110) (-260.685) [-259.031] (-261.618) * (-260.635) (-259.756) (-264.173) [-265.813] -- 0:00:38
      411500 -- (-263.663) (-261.407) (-260.002) [-260.710] * [-259.734] (-259.959) (-262.503) (-267.079) -- 0:00:38
      412000 -- (-267.203) (-261.727) [-260.315] (-262.576) * [-261.194] (-260.528) (-263.028) (-263.269) -- 0:00:38
      412500 -- [-260.187] (-264.105) (-260.540) (-261.463) * (-259.280) (-260.475) (-261.013) [-262.538] -- 0:00:38
      413000 -- (-264.227) (-261.949) [-259.702] (-261.916) * [-261.512] (-259.960) (-260.195) (-263.177) -- 0:00:38
      413500 -- (-261.919) (-260.422) (-260.757) [-260.352] * [-264.942] (-262.695) (-260.614) (-261.258) -- 0:00:38
      414000 -- (-260.637) (-263.234) (-260.405) [-262.537] * (-262.776) (-260.337) [-260.348] (-264.170) -- 0:00:38
      414500 -- [-260.445] (-260.368) (-262.178) (-267.048) * [-263.048] (-263.558) (-262.217) (-260.634) -- 0:00:38
      415000 -- (-267.175) [-261.726] (-262.818) (-265.245) * (-261.940) (-263.839) [-260.072] (-262.700) -- 0:00:38

      Average standard deviation of split frequencies: 0.013457

      415500 -- (-261.080) (-267.542) [-263.289] (-262.670) * [-263.558] (-261.129) (-261.424) (-260.818) -- 0:00:37
      416000 -- (-260.768) (-262.541) [-259.632] (-260.487) * (-261.869) (-261.314) (-261.144) [-260.500] -- 0:00:37
      416500 -- [-263.587] (-259.856) (-261.905) (-261.167) * [-261.110] (-260.582) (-261.453) (-260.406) -- 0:00:37
      417000 -- (-264.361) (-260.923) [-262.791] (-264.514) * [-260.549] (-260.873) (-262.139) (-263.876) -- 0:00:37
      417500 -- (-266.703) [-266.330] (-262.539) (-261.919) * (-261.150) (-263.255) [-260.893] (-264.981) -- 0:00:37
      418000 -- (-261.826) (-263.062) [-261.657] (-262.092) * (-261.337) (-260.777) [-261.547] (-261.626) -- 0:00:37
      418500 -- (-261.805) (-262.312) [-261.385] (-261.952) * (-264.348) (-260.854) (-262.814) [-263.291] -- 0:00:37
      419000 -- (-262.242) (-262.908) (-259.777) [-261.772] * [-262.872] (-262.149) (-260.384) (-262.673) -- 0:00:37
      419500 -- (-263.662) [-262.375] (-263.103) (-261.846) * (-265.340) [-259.174] (-259.850) (-265.393) -- 0:00:37
      420000 -- (-263.579) [-261.962] (-261.271) (-267.274) * (-262.030) [-261.782] (-259.949) (-262.715) -- 0:00:37

      Average standard deviation of split frequencies: 0.014120

      420500 -- (-263.786) (-263.201) (-262.182) [-264.113] * (-260.360) (-259.345) (-259.535) [-261.751] -- 0:00:37
      421000 -- (-263.007) [-260.593] (-259.180) (-267.317) * [-261.285] (-261.968) (-259.392) (-261.206) -- 0:00:37
      421500 -- (-265.319) (-262.437) [-259.379] (-261.069) * (-268.225) [-261.708] (-262.464) (-260.679) -- 0:00:37
      422000 -- (-261.798) [-260.892] (-261.114) (-259.598) * (-264.844) [-260.422] (-263.596) (-261.607) -- 0:00:38
      422500 -- (-262.256) [-261.655] (-259.394) (-262.010) * [-261.606] (-260.770) (-259.596) (-261.405) -- 0:00:38
      423000 -- [-259.459] (-260.185) (-262.518) (-268.550) * (-260.401) [-261.563] (-263.049) (-263.951) -- 0:00:38
      423500 -- (-262.560) (-261.260) (-261.958) [-265.509] * (-259.591) (-261.038) [-260.247] (-262.983) -- 0:00:38
      424000 -- (-261.155) (-262.721) [-261.899] (-261.177) * (-259.861) [-260.444] (-261.054) (-259.484) -- 0:00:38
      424500 -- (-262.095) [-263.327] (-261.970) (-261.496) * (-259.023) [-260.028] (-266.483) (-260.993) -- 0:00:37
      425000 -- (-260.395) (-262.078) [-260.844] (-259.649) * [-260.058] (-261.324) (-261.875) (-260.183) -- 0:00:37

      Average standard deviation of split frequencies: 0.013971

      425500 -- (-259.858) (-260.515) (-260.341) [-259.912] * [-260.835] (-264.977) (-261.718) (-261.102) -- 0:00:37
      426000 -- (-262.414) (-264.625) (-262.708) [-260.052] * (-262.871) (-263.068) (-259.422) [-261.478] -- 0:00:37
      426500 -- [-260.058] (-260.532) (-260.835) (-262.038) * [-265.082] (-264.077) (-259.889) (-261.264) -- 0:00:37
      427000 -- (-259.506) [-260.276] (-264.828) (-259.419) * (-261.600) (-263.696) [-263.483] (-259.365) -- 0:00:37
      427500 -- (-259.999) (-260.031) (-264.095) [-259.608] * [-260.432] (-260.182) (-263.610) (-258.975) -- 0:00:37
      428000 -- (-259.789) (-259.400) (-259.848) [-261.210] * [-264.256] (-263.165) (-260.047) (-262.437) -- 0:00:37
      428500 -- [-260.527] (-260.848) (-270.289) (-265.724) * (-261.742) [-259.615] (-262.881) (-260.139) -- 0:00:37
      429000 -- (-261.505) (-262.256) (-262.682) [-260.673] * (-265.834) [-259.611] (-263.671) (-259.961) -- 0:00:37
      429500 -- [-260.582] (-262.489) (-261.995) (-263.992) * [-260.494] (-259.131) (-262.114) (-261.449) -- 0:00:37
      430000 -- (-262.741) (-262.503) [-260.266] (-262.081) * (-261.881) [-262.598] (-263.030) (-261.850) -- 0:00:37

      Average standard deviation of split frequencies: 0.014093

      430500 -- (-261.192) [-260.698] (-261.190) (-265.484) * (-266.163) (-259.625) (-259.622) [-261.355] -- 0:00:37
      431000 -- (-268.367) (-261.586) [-259.925] (-270.901) * (-263.379) (-262.129) [-260.169] (-259.949) -- 0:00:36
      431500 -- (-260.849) (-260.616) (-260.493) [-265.402] * (-264.624) [-260.108] (-265.085) (-259.469) -- 0:00:36
      432000 -- (-261.169) [-260.842] (-264.717) (-263.244) * (-259.716) [-261.906] (-263.577) (-261.746) -- 0:00:36
      432500 -- [-260.655] (-263.893) (-261.474) (-265.586) * [-261.316] (-263.451) (-262.933) (-261.992) -- 0:00:36
      433000 -- (-262.067) (-261.919) (-261.026) [-265.950] * (-260.577) [-263.719] (-267.221) (-260.613) -- 0:00:36
      433500 -- (-259.376) [-259.663] (-261.152) (-262.771) * (-264.342) (-259.542) [-259.656] (-264.679) -- 0:00:36
      434000 -- (-260.347) (-261.181) [-259.841] (-260.942) * (-261.340) (-264.341) [-260.391] (-263.018) -- 0:00:36
      434500 -- [-259.221] (-259.927) (-260.222) (-262.034) * [-260.138] (-259.117) (-261.079) (-263.258) -- 0:00:36
      435000 -- (-261.023) (-261.975) [-262.223] (-262.069) * [-261.120] (-263.838) (-260.497) (-261.333) -- 0:00:36

      Average standard deviation of split frequencies: 0.013650

      435500 -- (-262.926) (-260.136) (-262.947) [-259.613] * (-261.555) [-259.945] (-259.677) (-261.383) -- 0:00:36
      436000 -- (-264.520) [-260.457] (-264.832) (-261.758) * (-261.799) (-260.405) (-265.101) [-260.649] -- 0:00:36
      436500 -- (-264.560) [-259.653] (-265.229) (-261.013) * (-259.881) [-259.641] (-261.130) (-263.237) -- 0:00:36
      437000 -- [-259.571] (-262.184) (-260.152) (-259.474) * (-261.521) [-263.260] (-259.856) (-261.649) -- 0:00:36
      437500 -- (-260.667) (-261.143) (-260.091) [-263.025] * (-260.330) (-260.288) [-259.959] (-259.926) -- 0:00:36
      438000 -- (-262.470) (-260.352) (-261.845) [-260.930] * (-259.932) (-260.225) (-265.872) [-261.045] -- 0:00:37
      438500 -- [-260.464] (-260.401) (-264.373) (-261.492) * [-262.436] (-261.011) (-261.214) (-259.836) -- 0:00:37
      439000 -- (-260.305) (-261.890) (-259.490) [-266.545] * (-259.984) [-262.395] (-262.303) (-259.162) -- 0:00:37
      439500 -- (-262.774) [-259.712] (-260.405) (-262.653) * (-261.147) (-260.722) (-260.654) [-264.177] -- 0:00:36
      440000 -- (-262.877) (-260.515) [-259.592] (-261.388) * [-262.730] (-260.218) (-260.343) (-264.839) -- 0:00:36

      Average standard deviation of split frequencies: 0.013907

      440500 -- [-262.307] (-261.569) (-260.039) (-260.540) * [-260.057] (-260.392) (-260.787) (-259.728) -- 0:00:36
      441000 -- (-262.552) (-261.356) [-261.875] (-261.339) * [-261.013] (-259.579) (-260.269) (-259.670) -- 0:00:36
      441500 -- (-261.112) (-260.251) (-261.781) [-260.338] * (-259.842) (-259.497) (-259.704) [-260.624] -- 0:00:36
      442000 -- (-260.631) (-262.512) (-259.775) [-262.259] * (-262.958) (-260.848) [-261.233] (-264.585) -- 0:00:36
      442500 -- (-260.428) (-261.621) (-261.656) [-259.779] * [-269.071] (-260.052) (-261.455) (-263.882) -- 0:00:36
      443000 -- (-261.451) [-262.066] (-260.333) (-260.498) * (-261.697) [-260.089] (-260.596) (-264.217) -- 0:00:36
      443500 -- (-262.639) (-265.410) (-260.246) [-260.923] * [-260.119] (-264.898) (-262.079) (-264.755) -- 0:00:36
      444000 -- (-261.627) (-262.696) (-260.866) [-262.030] * (-259.501) (-262.568) [-261.608] (-263.834) -- 0:00:36
      444500 -- (-260.088) [-263.107] (-261.168) (-263.644) * (-261.193) [-261.358] (-259.067) (-259.888) -- 0:00:36
      445000 -- (-261.485) [-260.873] (-259.402) (-260.903) * (-263.948) (-263.004) [-259.172] (-259.891) -- 0:00:36

      Average standard deviation of split frequencies: 0.013807

      445500 -- (-265.909) (-259.240) (-261.494) [-260.863] * (-260.308) (-259.718) (-259.668) [-260.596] -- 0:00:36
      446000 -- (-260.013) (-259.285) (-261.422) [-261.328] * (-260.690) (-260.725) [-259.236] (-261.248) -- 0:00:36
      446500 -- (-261.126) (-259.278) (-262.161) [-263.070] * (-261.488) [-260.242] (-266.937) (-264.339) -- 0:00:35
      447000 -- (-259.888) (-261.382) (-259.826) [-262.033] * [-263.036] (-262.957) (-260.025) (-262.497) -- 0:00:35
      447500 -- (-261.795) [-259.426] (-263.984) (-264.461) * [-261.878] (-260.972) (-262.195) (-266.243) -- 0:00:35
      448000 -- (-263.802) [-260.406] (-261.846) (-260.373) * [-260.001] (-262.960) (-262.423) (-260.672) -- 0:00:35
      448500 -- (-261.484) (-262.523) (-264.806) [-261.471] * [-260.045] (-262.210) (-261.408) (-264.891) -- 0:00:35
      449000 -- (-260.104) (-264.442) [-261.522] (-262.912) * [-260.860] (-259.767) (-263.538) (-263.136) -- 0:00:35
      449500 -- (-260.953) (-267.609) (-263.373) [-260.025] * (-259.937) [-260.020] (-261.597) (-260.197) -- 0:00:35
      450000 -- [-261.710] (-265.476) (-259.342) (-260.402) * [-260.732] (-263.074) (-264.663) (-259.175) -- 0:00:35

      Average standard deviation of split frequencies: 0.013075

      450500 -- (-260.304) (-264.075) (-260.934) [-261.776] * (-263.873) (-261.972) [-263.209] (-259.289) -- 0:00:35
      451000 -- (-262.783) (-262.480) (-259.944) [-262.272] * [-259.779] (-262.009) (-265.421) (-260.521) -- 0:00:35
      451500 -- (-261.300) [-263.709] (-260.112) (-263.278) * (-260.153) (-264.614) [-259.129] (-262.834) -- 0:00:35
      452000 -- (-260.958) (-261.147) (-262.304) [-259.836] * [-262.035] (-266.986) (-262.068) (-265.395) -- 0:00:35
      452500 -- [-262.780] (-261.225) (-262.648) (-260.751) * (-261.537) (-261.345) [-260.551] (-262.888) -- 0:00:35
      453000 -- (-260.979) (-265.085) (-260.864) [-260.168] * (-261.152) (-261.246) (-261.263) [-259.749] -- 0:00:35
      453500 -- (-261.005) [-265.982] (-260.601) (-260.217) * [-260.317] (-260.362) (-260.122) (-261.048) -- 0:00:34
      454000 -- (-263.124) [-260.628] (-264.785) (-260.826) * (-260.892) [-262.991] (-260.239) (-263.253) -- 0:00:36
      454500 -- (-262.702) [-261.626] (-264.779) (-260.131) * (-259.738) (-260.397) (-261.410) [-260.916] -- 0:00:36
      455000 -- (-262.875) (-263.852) (-265.044) [-260.243] * (-259.300) (-260.521) [-260.009] (-260.528) -- 0:00:35

      Average standard deviation of split frequencies: 0.012599

      455500 -- (-262.110) (-261.044) [-261.857] (-260.072) * [-259.798] (-261.999) (-260.504) (-261.684) -- 0:00:35
      456000 -- (-259.571) (-261.004) (-262.254) [-263.140] * (-268.135) [-263.310] (-261.875) (-263.990) -- 0:00:35
      456500 -- (-260.521) (-259.764) (-259.828) [-260.339] * (-265.068) (-261.558) (-259.590) [-259.344] -- 0:00:35
      457000 -- [-259.842] (-260.412) (-260.596) (-259.662) * (-263.312) [-261.043] (-260.877) (-259.339) -- 0:00:35
      457500 -- (-259.068) [-260.075] (-263.697) (-260.211) * (-258.971) (-260.916) (-261.438) [-259.224] -- 0:00:35
      458000 -- (-259.251) (-261.278) [-260.801] (-260.127) * [-262.654] (-261.844) (-262.447) (-259.734) -- 0:00:35
      458500 -- (-260.269) (-259.511) (-260.562) [-260.737] * [-261.004] (-261.166) (-263.412) (-262.496) -- 0:00:35
      459000 -- (-260.875) (-265.792) [-261.912] (-260.112) * (-260.401) (-260.282) (-264.519) [-260.857] -- 0:00:35
      459500 -- (-259.400) (-264.780) [-260.260] (-260.222) * (-266.508) (-261.875) [-260.838] (-265.328) -- 0:00:35
      460000 -- [-259.025] (-260.796) (-264.065) (-266.699) * (-261.294) [-260.030] (-265.567) (-266.390) -- 0:00:35

      Average standard deviation of split frequencies: 0.012919

      460500 -- [-264.488] (-261.103) (-263.948) (-261.847) * (-259.368) [-261.683] (-260.751) (-266.453) -- 0:00:35
      461000 -- (-265.179) (-264.324) [-265.542] (-262.503) * (-259.993) (-265.646) [-261.390] (-263.091) -- 0:00:35
      461500 -- (-260.653) (-264.298) [-260.959] (-262.912) * [-261.473] (-263.861) (-262.299) (-263.341) -- 0:00:35
      462000 -- (-262.445) [-263.108] (-262.667) (-266.778) * [-259.696] (-262.252) (-264.757) (-261.088) -- 0:00:34
      462500 -- (-260.792) (-260.174) [-261.311] (-266.062) * [-265.494] (-259.940) (-261.689) (-263.832) -- 0:00:34
      463000 -- (-259.938) (-260.846) (-261.727) [-260.606] * [-260.290] (-263.736) (-259.427) (-263.482) -- 0:00:34
      463500 -- (-259.843) (-261.346) [-259.651] (-263.394) * [-260.165] (-259.916) (-260.849) (-264.195) -- 0:00:34
      464000 -- (-260.633) (-261.891) (-264.129) [-261.158] * (-260.163) (-260.641) (-260.599) [-265.218] -- 0:00:34
      464500 -- (-260.188) [-259.695] (-263.663) (-263.172) * (-261.020) (-262.627) (-259.848) [-261.915] -- 0:00:34
      465000 -- (-261.900) [-260.971] (-259.570) (-261.648) * (-260.052) (-261.367) (-262.429) [-260.173] -- 0:00:34

      Average standard deviation of split frequencies: 0.012708

      465500 -- (-260.207) (-262.770) (-259.328) [-261.847] * (-259.279) (-263.599) [-261.464] (-261.394) -- 0:00:34
      466000 -- (-261.101) [-260.702] (-260.164) (-261.529) * (-259.429) (-263.840) [-262.147] (-260.904) -- 0:00:34
      466500 -- (-261.267) [-261.443] (-263.442) (-260.460) * (-260.271) (-259.156) [-260.147] (-262.574) -- 0:00:34
      467000 -- [-260.415] (-260.916) (-264.645) (-260.092) * (-259.814) (-261.273) [-259.865] (-259.893) -- 0:00:34
      467500 -- [-261.889] (-259.418) (-264.379) (-260.898) * (-260.081) (-261.053) [-260.319] (-260.835) -- 0:00:34
      468000 -- (-261.177) (-259.488) (-263.201) [-260.001] * (-259.805) (-261.759) [-260.617] (-262.172) -- 0:00:34
      468500 -- (-266.986) (-259.727) [-268.477] (-259.743) * (-261.238) (-266.296) [-259.814] (-265.129) -- 0:00:34
      469000 -- [-264.267] (-260.576) (-264.691) (-260.916) * (-263.372) [-259.909] (-261.516) (-264.056) -- 0:00:33
      469500 -- (-262.448) (-262.551) [-261.417] (-260.773) * (-267.878) (-260.775) [-261.227] (-262.585) -- 0:00:33
      470000 -- [-262.111] (-260.236) (-260.406) (-262.476) * (-262.013) (-259.762) (-262.289) [-262.030] -- 0:00:34

      Average standard deviation of split frequencies: 0.012707

      470500 -- (-262.407) [-260.733] (-260.705) (-263.021) * [-260.474] (-262.253) (-262.219) (-264.389) -- 0:00:34
      471000 -- (-261.083) [-259.980] (-262.765) (-262.952) * (-261.172) (-260.999) (-264.505) [-262.968] -- 0:00:34
      471500 -- (-261.460) (-262.192) [-260.404] (-261.068) * (-261.542) [-261.800] (-260.411) (-261.036) -- 0:00:34
      472000 -- (-264.968) [-260.431] (-261.385) (-260.451) * [-260.861] (-263.088) (-259.543) (-259.923) -- 0:00:34
      472500 -- [-265.278] (-260.402) (-260.569) (-260.462) * (-261.400) [-262.959] (-261.510) (-259.594) -- 0:00:34
      473000 -- (-261.373) (-259.891) [-261.562] (-261.964) * (-260.991) (-262.957) (-259.960) [-260.457] -- 0:00:34
      473500 -- (-259.897) (-265.693) (-261.931) [-262.106] * (-260.807) (-265.917) [-259.253] (-260.537) -- 0:00:34
      474000 -- (-260.860) (-262.153) [-263.741] (-260.222) * (-262.752) (-261.628) [-260.690] (-260.499) -- 0:00:34
      474500 -- (-262.268) (-260.989) [-259.397] (-262.416) * (-261.485) (-260.493) (-262.083) [-260.931] -- 0:00:34
      475000 -- [-262.292] (-261.108) (-259.912) (-260.606) * (-260.669) (-262.701) (-263.157) [-261.444] -- 0:00:34

      Average standard deviation of split frequencies: 0.012936

      475500 -- (-263.777) [-269.522] (-263.264) (-263.188) * (-260.466) (-261.511) [-262.559] (-260.377) -- 0:00:34
      476000 -- (-261.689) [-263.703] (-263.974) (-259.890) * (-259.626) (-263.942) (-262.152) [-263.462] -- 0:00:34
      476500 -- (-261.851) (-262.862) [-262.415] (-262.393) * (-261.784) [-264.026] (-260.809) (-262.557) -- 0:00:34
      477000 -- (-264.574) (-261.221) [-261.797] (-261.967) * (-264.731) (-260.151) (-262.592) [-259.870] -- 0:00:33
      477500 -- (-263.118) (-259.401) [-261.554] (-261.222) * (-261.251) (-259.456) [-259.686] (-259.385) -- 0:00:33
      478000 -- (-260.288) (-258.982) (-259.157) [-259.937] * [-259.110] (-260.031) (-259.851) (-263.584) -- 0:00:33
      478500 -- (-262.116) [-262.003] (-259.246) (-262.697) * [-264.182] (-263.761) (-262.833) (-260.501) -- 0:00:33
      479000 -- (-262.408) [-262.233] (-260.660) (-260.747) * (-264.054) (-260.077) [-261.387] (-261.823) -- 0:00:33
      479500 -- (-262.937) (-262.475) [-259.502] (-261.947) * (-261.469) [-259.917] (-259.676) (-267.044) -- 0:00:33
      480000 -- (-264.261) [-262.435] (-263.245) (-262.857) * [-263.121] (-263.448) (-260.929) (-261.840) -- 0:00:33

      Average standard deviation of split frequencies: 0.013669

      480500 -- (-259.609) (-265.571) (-263.974) [-260.008] * [-263.687] (-263.641) (-263.215) (-260.328) -- 0:00:33
      481000 -- (-267.421) (-261.967) (-259.378) [-260.621] * [-261.236] (-260.117) (-260.445) (-260.346) -- 0:00:33
      481500 -- (-266.836) (-261.347) [-261.144] (-263.172) * [-260.395] (-263.951) (-262.865) (-261.743) -- 0:00:33
      482000 -- (-262.301) (-260.414) (-260.821) [-262.758] * (-260.861) (-264.521) (-260.656) [-261.663] -- 0:00:33
      482500 -- (-260.284) (-260.534) [-261.852] (-264.944) * (-260.102) (-260.694) [-260.334] (-260.396) -- 0:00:33
      483000 -- [-259.229] (-261.318) (-263.721) (-264.606) * (-262.226) (-260.675) (-263.353) [-260.611] -- 0:00:33
      483500 -- (-261.852) (-263.147) (-260.190) [-259.134] * (-261.885) [-260.211] (-260.127) (-259.822) -- 0:00:33
      484000 -- [-260.688] (-265.137) (-265.950) (-262.959) * (-266.080) [-261.088] (-259.076) (-267.965) -- 0:00:33
      484500 -- (-261.716) (-263.947) (-259.795) [-261.716] * (-266.035) [-262.577] (-260.197) (-263.024) -- 0:00:34
      485000 -- [-259.502] (-262.349) (-261.058) (-259.984) * (-262.544) (-265.175) (-259.742) [-261.287] -- 0:00:33

      Average standard deviation of split frequencies: 0.012913

      485500 -- (-259.965) [-262.112] (-260.283) (-261.194) * (-261.044) [-260.497] (-262.662) (-260.599) -- 0:00:33
      486000 -- (-263.191) [-259.313] (-264.415) (-259.618) * (-259.868) (-262.579) [-260.664] (-259.436) -- 0:00:33
      486500 -- (-261.496) (-260.021) [-260.965] (-259.288) * (-259.666) (-263.548) [-260.601] (-263.382) -- 0:00:33
      487000 -- (-259.949) [-262.592] (-263.482) (-262.907) * [-260.584] (-264.664) (-261.442) (-262.357) -- 0:00:33
      487500 -- (-262.716) [-263.140] (-260.394) (-264.942) * (-263.876) [-263.176] (-261.579) (-260.733) -- 0:00:33
      488000 -- (-261.221) (-262.114) [-260.928] (-260.432) * (-265.426) (-263.703) [-262.094] (-261.234) -- 0:00:33
      488500 -- [-262.379] (-260.840) (-262.879) (-261.035) * (-264.071) (-262.765) [-259.352] (-260.324) -- 0:00:33
      489000 -- (-259.062) [-260.386] (-264.160) (-261.755) * [-262.127] (-260.118) (-261.683) (-261.116) -- 0:00:33
      489500 -- (-260.024) [-260.424] (-270.475) (-260.275) * (-261.003) (-260.720) (-260.933) [-261.081] -- 0:00:33
      490000 -- [-259.626] (-262.251) (-259.574) (-261.276) * [-260.374] (-261.125) (-261.599) (-262.871) -- 0:00:33

      Average standard deviation of split frequencies: 0.012550

      490500 -- [-260.340] (-261.043) (-261.238) (-259.397) * (-261.856) [-262.213] (-261.225) (-264.213) -- 0:00:33
      491000 -- (-259.262) [-259.809] (-263.537) (-260.215) * (-260.400) [-259.039] (-259.840) (-261.742) -- 0:00:33
      491500 -- (-260.903) (-260.339) [-259.900] (-260.062) * (-263.088) (-260.022) [-259.166] (-262.860) -- 0:00:33
      492000 -- (-260.291) (-261.769) [-259.926] (-259.870) * (-262.317) (-260.800) [-262.327] (-261.483) -- 0:00:33
      492500 -- (-261.131) (-262.138) [-259.644] (-260.067) * [-261.951] (-261.782) (-259.855) (-259.955) -- 0:00:32
      493000 -- (-262.725) [-264.657] (-259.801) (-268.237) * (-260.240) [-261.115] (-263.017) (-261.115) -- 0:00:32
      493500 -- (-261.890) [-259.862] (-259.542) (-262.994) * (-261.255) [-261.922] (-267.523) (-261.467) -- 0:00:32
      494000 -- [-259.758] (-260.457) (-259.727) (-261.530) * (-262.729) (-259.873) (-263.965) [-261.736] -- 0:00:32
      494500 -- [-261.400] (-262.921) (-261.601) (-259.755) * (-260.747) (-265.977) [-264.031] (-260.544) -- 0:00:32
      495000 -- [-259.113] (-262.306) (-260.431) (-262.385) * (-259.996) [-262.806] (-262.854) (-262.094) -- 0:00:32

      Average standard deviation of split frequencies: 0.011761

      495500 -- [-258.961] (-259.885) (-261.334) (-261.110) * (-262.475) (-262.910) [-260.691] (-261.495) -- 0:00:32
      496000 -- (-263.350) [-259.642] (-261.688) (-261.233) * [-260.581] (-261.326) (-259.674) (-261.582) -- 0:00:32
      496500 -- (-261.429) (-259.246) [-259.482] (-260.228) * (-264.988) [-261.218] (-262.300) (-263.219) -- 0:00:32
      497000 -- (-262.422) (-261.350) (-260.352) [-261.579] * (-262.138) (-263.915) [-262.222] (-264.407) -- 0:00:32
      497500 -- (-259.435) [-260.859] (-262.703) (-263.631) * (-259.146) (-262.680) (-261.014) [-262.001] -- 0:00:32
      498000 -- (-260.608) [-261.716] (-261.450) (-263.259) * (-259.062) (-261.258) (-261.181) [-259.666] -- 0:00:32
      498500 -- (-263.115) (-263.211) (-263.561) [-261.275] * [-265.962] (-262.178) (-269.671) (-261.948) -- 0:00:32
      499000 -- (-261.793) [-260.871] (-261.367) (-260.065) * [-262.632] (-266.211) (-264.612) (-261.356) -- 0:00:32
      499500 -- (-261.851) [-261.059] (-261.386) (-260.002) * (-261.102) [-265.433] (-259.555) (-260.240) -- 0:00:33
      500000 -- [-263.125] (-261.799) (-261.787) (-259.485) * (-260.483) (-262.012) [-261.043] (-259.759) -- 0:00:33

      Average standard deviation of split frequencies: 0.011769

      500500 -- (-260.854) (-261.688) (-262.924) [-259.568] * [-259.608] (-261.516) (-268.505) (-260.446) -- 0:00:32
      501000 -- (-262.083) [-259.350] (-260.335) (-260.962) * [-261.463] (-259.766) (-262.362) (-259.469) -- 0:00:32
      501500 -- (-265.394) (-259.873) [-261.893] (-260.350) * (-262.009) (-266.590) (-265.812) [-259.548] -- 0:00:32
      502000 -- [-260.348] (-261.341) (-262.092) (-263.271) * [-262.363] (-261.241) (-262.126) (-259.278) -- 0:00:32
      502500 -- (-260.049) (-263.197) [-259.970] (-261.365) * (-270.148) (-259.599) (-259.229) [-259.987] -- 0:00:32
      503000 -- (-260.556) (-261.071) (-262.116) [-260.156] * (-261.467) (-259.156) [-259.735] (-262.155) -- 0:00:32
      503500 -- [-260.910] (-263.054) (-267.494) (-260.184) * (-260.157) [-262.010] (-262.066) (-261.620) -- 0:00:32
      504000 -- [-262.177] (-260.512) (-262.519) (-261.965) * (-261.082) [-259.500] (-262.063) (-267.633) -- 0:00:32
      504500 -- [-259.610] (-261.246) (-260.939) (-260.406) * (-262.709) (-260.321) (-261.787) [-262.257] -- 0:00:32
      505000 -- (-260.668) (-262.371) (-263.385) [-260.582] * (-263.657) [-262.053] (-265.768) (-260.393) -- 0:00:32

      Average standard deviation of split frequencies: 0.011529

      505500 -- (-259.683) (-260.780) [-264.491] (-261.453) * (-259.343) (-263.548) [-260.678] (-263.460) -- 0:00:32
      506000 -- [-262.608] (-262.356) (-260.322) (-264.779) * [-264.809] (-264.304) (-260.172) (-262.507) -- 0:00:32
      506500 -- [-260.596] (-263.617) (-263.855) (-259.320) * (-262.833) (-266.807) [-261.686] (-261.377) -- 0:00:32
      507000 -- [-261.492] (-262.790) (-260.519) (-260.641) * (-263.710) (-265.672) (-262.704) [-261.471] -- 0:00:32
      507500 -- (-261.990) [-263.348] (-259.424) (-263.873) * [-259.975] (-261.608) (-261.216) (-267.041) -- 0:00:32
      508000 -- (-263.087) (-265.669) [-262.260] (-262.340) * (-262.041) (-266.278) [-262.231] (-260.054) -- 0:00:31
      508500 -- (-263.171) (-264.532) [-263.944] (-259.126) * (-260.049) (-262.318) [-260.695] (-261.634) -- 0:00:31
      509000 -- (-260.550) (-261.076) [-260.350] (-259.618) * (-263.572) (-262.888) [-263.293] (-264.962) -- 0:00:31
      509500 -- (-260.422) (-262.619) (-261.376) [-259.966] * (-263.092) (-262.801) [-260.376] (-260.998) -- 0:00:31
      510000 -- (-260.525) [-260.468] (-262.299) (-262.842) * (-263.957) [-259.322] (-262.532) (-260.112) -- 0:00:31

      Average standard deviation of split frequencies: 0.011308

      510500 -- (-259.565) (-262.534) (-262.434) [-260.149] * [-259.641] (-261.713) (-263.673) (-262.181) -- 0:00:31
      511000 -- (-259.818) (-268.159) (-259.464) [-261.249] * (-259.319) [-266.391] (-263.179) (-259.693) -- 0:00:31
      511500 -- (-267.296) (-261.895) [-259.629] (-261.875) * (-258.994) (-263.038) (-262.240) [-260.532] -- 0:00:31
      512000 -- (-259.205) (-265.341) (-259.906) [-261.657] * (-260.352) [-263.130] (-260.016) (-261.779) -- 0:00:31
      512500 -- [-260.388] (-266.225) (-262.893) (-261.976) * (-262.973) (-259.723) [-260.303] (-260.873) -- 0:00:32
      513000 -- (-265.957) [-262.117] (-260.435) (-259.155) * [-261.292] (-262.457) (-260.954) (-260.402) -- 0:00:32
      513500 -- [-260.480] (-261.795) (-260.836) (-260.060) * (-260.185) (-261.908) (-260.102) [-264.675] -- 0:00:32
      514000 -- (-259.860) (-260.504) (-261.238) [-260.308] * (-266.391) (-262.152) [-260.394] (-262.683) -- 0:00:32
      514500 -- (-262.439) (-262.391) [-261.128] (-261.932) * [-264.222] (-261.133) (-264.053) (-259.738) -- 0:00:32
      515000 -- [-262.012] (-262.811) (-261.215) (-262.415) * (-260.417) [-261.879] (-261.055) (-259.733) -- 0:00:32

      Average standard deviation of split frequencies: 0.011420

      515500 -- (-262.740) [-261.315] (-260.811) (-262.965) * (-261.904) (-261.698) [-261.196] (-259.983) -- 0:00:31
      516000 -- (-261.339) (-261.575) [-259.869] (-261.646) * (-260.636) [-265.455] (-260.852) (-264.137) -- 0:00:31
      516500 -- (-264.245) (-261.088) [-260.844] (-262.904) * (-262.772) [-259.472] (-262.690) (-264.850) -- 0:00:31
      517000 -- (-261.693) (-260.345) [-261.304] (-261.363) * (-264.800) (-260.370) (-261.594) [-263.177] -- 0:00:31
      517500 -- (-263.247) [-260.393] (-265.318) (-260.037) * [-263.861] (-265.541) (-262.733) (-262.626) -- 0:00:31
      518000 -- (-261.743) (-261.567) (-261.000) [-259.874] * (-263.022) (-261.032) (-264.360) [-261.178] -- 0:00:31
      518500 -- (-262.328) (-260.448) (-260.563) [-260.500] * (-259.086) [-262.575] (-259.642) (-260.274) -- 0:00:31
      519000 -- (-261.594) (-262.099) [-260.650] (-259.691) * (-260.062) (-261.647) (-261.632) [-260.085] -- 0:00:31
      519500 -- (-263.432) (-263.342) (-264.851) [-259.535] * [-261.514] (-262.726) (-259.638) (-268.201) -- 0:00:31
      520000 -- (-263.999) [-260.363] (-265.317) (-260.409) * [-262.008] (-262.029) (-266.013) (-263.588) -- 0:00:31

      Average standard deviation of split frequencies: 0.011827

      520500 -- [-267.008] (-260.410) (-260.528) (-263.523) * (-261.915) (-263.290) (-263.833) [-260.877] -- 0:00:31
      521000 -- (-262.519) [-260.706] (-259.532) (-259.919) * (-259.733) [-264.731] (-262.459) (-261.949) -- 0:00:31
      521500 -- [-261.244] (-263.172) (-262.859) (-261.787) * (-259.542) (-260.421) (-264.214) [-262.993] -- 0:00:31
      522000 -- (-262.498) (-260.080) (-261.714) [-260.837] * (-260.381) (-260.198) [-259.394] (-261.350) -- 0:00:31
      522500 -- (-265.805) (-260.370) [-262.566] (-259.403) * [-260.211] (-262.491) (-261.546) (-261.187) -- 0:00:31
      523000 -- [-264.500] (-260.436) (-259.772) (-263.272) * (-260.114) (-263.568) [-259.679] (-261.232) -- 0:00:31
      523500 -- [-262.376] (-264.722) (-260.056) (-261.618) * (-259.804) (-261.330) (-259.675) [-259.213] -- 0:00:30
      524000 -- (-261.016) [-261.555] (-262.119) (-263.379) * (-264.056) (-264.862) [-262.926] (-261.268) -- 0:00:30
      524500 -- (-260.725) (-263.736) [-261.189] (-260.391) * (-263.873) (-261.697) [-259.657] (-260.201) -- 0:00:30
      525000 -- (-262.399) (-264.233) [-261.863] (-260.275) * (-261.582) (-261.655) (-261.511) [-260.325] -- 0:00:30

      Average standard deviation of split frequencies: 0.012072

      525500 -- [-260.172] (-262.158) (-259.644) (-262.190) * (-260.443) [-264.725] (-260.325) (-260.715) -- 0:00:30
      526000 -- [-262.668] (-259.268) (-260.435) (-261.041) * (-260.383) (-264.769) [-261.008] (-260.526) -- 0:00:30
      526500 -- (-260.639) (-261.412) (-260.840) [-260.474] * (-261.221) (-261.224) [-259.844] (-260.341) -- 0:00:30
      527000 -- [-260.535] (-259.793) (-262.972) (-259.296) * (-260.630) [-261.777] (-260.010) (-259.761) -- 0:00:30
      527500 -- (-263.195) (-259.841) (-260.419) [-262.096] * (-260.901) (-263.502) [-259.676] (-266.891) -- 0:00:30
      528000 -- (-260.204) (-260.407) (-264.674) [-262.640] * (-259.857) [-259.901] (-261.853) (-263.532) -- 0:00:30
      528500 -- (-259.410) (-260.606) [-261.205] (-267.014) * (-260.157) [-259.038] (-261.429) (-261.873) -- 0:00:31
      529000 -- (-259.908) [-262.553] (-262.750) (-259.402) * (-260.140) (-260.866) [-265.504] (-260.878) -- 0:00:31
      529500 -- (-261.168) [-264.765] (-263.715) (-261.416) * (-264.802) (-262.335) [-265.183] (-261.104) -- 0:00:31
      530000 -- (-260.347) (-265.320) [-262.210] (-263.655) * [-263.924] (-260.117) (-263.104) (-263.778) -- 0:00:31

      Average standard deviation of split frequencies: 0.012140

      530500 -- [-262.656] (-260.229) (-263.987) (-260.431) * (-268.476) (-260.575) [-260.593] (-259.682) -- 0:00:30
      531000 -- (-261.173) (-261.075) [-261.798] (-262.205) * (-259.343) [-262.115] (-259.999) (-260.327) -- 0:00:30
      531500 -- [-262.839] (-261.412) (-259.949) (-261.819) * (-259.365) [-261.806] (-262.354) (-260.632) -- 0:00:30
      532000 -- (-261.417) (-262.009) (-263.030) [-262.196] * (-260.244) [-261.473] (-261.685) (-260.724) -- 0:00:30
      532500 -- [-261.867] (-264.223) (-260.129) (-263.138) * (-262.895) (-261.850) (-265.339) [-260.202] -- 0:00:30
      533000 -- (-261.777) (-260.715) [-263.544] (-262.478) * (-262.585) (-270.311) (-263.913) [-264.613] -- 0:00:30
      533500 -- [-259.992] (-260.610) (-263.994) (-260.387) * [-260.792] (-264.270) (-264.773) (-264.996) -- 0:00:30
      534000 -- (-262.131) [-259.681] (-261.461) (-262.143) * [-261.351] (-259.426) (-261.097) (-260.969) -- 0:00:30
      534500 -- (-263.997) (-260.907) [-260.467] (-260.180) * [-264.031] (-260.828) (-259.370) (-260.477) -- 0:00:30
      535000 -- [-259.427] (-262.001) (-260.178) (-261.261) * (-261.158) (-261.402) [-262.784] (-260.568) -- 0:00:30

      Average standard deviation of split frequencies: 0.011382

      535500 -- [-260.845] (-262.151) (-260.023) (-260.575) * (-265.793) (-261.454) (-259.808) [-259.439] -- 0:00:30
      536000 -- [-260.205] (-266.342) (-260.965) (-262.435) * (-260.790) (-260.389) [-260.421] (-260.531) -- 0:00:30
      536500 -- (-260.453) (-264.857) [-260.717] (-264.529) * (-261.100) (-259.572) (-261.155) [-259.606] -- 0:00:30
      537000 -- (-262.638) (-261.128) (-259.831) [-260.770] * (-264.639) (-261.455) [-260.621] (-260.160) -- 0:00:30
      537500 -- (-265.268) [-260.584] (-262.105) (-263.427) * (-259.127) (-261.148) (-259.754) [-261.467] -- 0:00:30
      538000 -- [-263.875] (-259.355) (-262.026) (-262.339) * (-261.247) (-260.943) (-260.244) [-259.222] -- 0:00:30
      538500 -- (-264.533) [-260.199] (-261.963) (-261.077) * [-259.542] (-259.133) (-262.666) (-259.892) -- 0:00:29
      539000 -- [-260.438] (-260.990) (-262.425) (-262.348) * (-261.549) (-261.327) (-261.206) [-261.788] -- 0:00:29
      539500 -- (-263.182) [-259.405] (-265.263) (-259.531) * [-260.259] (-261.248) (-263.122) (-260.170) -- 0:00:29
      540000 -- [-262.837] (-263.187) (-268.523) (-265.700) * [-260.693] (-261.401) (-263.796) (-263.554) -- 0:00:29

      Average standard deviation of split frequencies: 0.010899

      540500 -- [-260.690] (-263.475) (-259.998) (-262.259) * (-260.069) (-260.711) [-261.127] (-262.900) -- 0:00:29
      541000 -- (-260.696) (-261.620) (-264.789) [-261.571] * (-263.143) (-264.032) [-259.567] (-261.072) -- 0:00:29
      541500 -- (-260.758) (-262.653) [-262.668] (-259.350) * (-259.619) (-259.532) (-260.295) [-260.767] -- 0:00:29
      542000 -- (-262.245) (-262.619) [-265.167] (-262.195) * (-266.092) (-260.777) (-259.940) [-260.231] -- 0:00:29
      542500 -- (-264.940) (-261.803) (-264.509) [-262.415] * (-260.271) (-261.999) [-262.938] (-259.496) -- 0:00:29
      543000 -- (-260.417) (-262.353) (-264.282) [-265.253] * (-263.541) (-267.042) [-262.698] (-262.255) -- 0:00:29
      543500 -- (-262.736) (-262.710) (-263.893) [-260.234] * (-261.791) (-260.797) (-262.221) [-261.859] -- 0:00:30
      544000 -- (-264.365) [-260.707] (-259.471) (-260.764) * (-262.285) (-261.382) [-263.336] (-258.858) -- 0:00:30
      544500 -- (-261.429) (-260.781) (-260.666) [-259.995] * (-261.747) (-261.296) [-261.664] (-259.224) -- 0:00:30
      545000 -- [-259.769] (-260.800) (-261.415) (-260.170) * (-260.929) (-262.083) (-262.173) [-261.033] -- 0:00:30

      Average standard deviation of split frequencies: 0.010738

      545500 -- (-260.358) (-261.351) [-260.878] (-261.085) * (-260.399) (-260.567) [-260.302] (-262.375) -- 0:00:29
      546000 -- [-259.994] (-260.067) (-260.642) (-261.857) * (-262.468) (-267.555) [-261.362] (-262.146) -- 0:00:29
      546500 -- (-261.330) (-260.001) [-262.674] (-261.455) * (-260.497) [-260.542] (-261.068) (-261.442) -- 0:00:29
      547000 -- [-259.397] (-261.410) (-259.906) (-262.949) * (-260.609) [-260.184] (-262.242) (-266.002) -- 0:00:29
      547500 -- [-259.286] (-260.020) (-260.091) (-260.991) * [-263.327] (-260.176) (-260.455) (-263.718) -- 0:00:29
      548000 -- (-259.733) [-260.570] (-259.963) (-261.621) * [-259.899] (-261.170) (-259.077) (-259.954) -- 0:00:29
      548500 -- (-263.542) [-259.735] (-260.048) (-260.726) * (-259.159) [-261.669] (-262.468) (-260.003) -- 0:00:29
      549000 -- (-261.678) (-262.208) (-260.975) [-260.025] * (-260.875) (-260.304) [-259.640] (-259.737) -- 0:00:29
      549500 -- [-259.922] (-262.042) (-260.393) (-260.860) * (-263.018) (-260.985) (-260.221) [-259.624] -- 0:00:29
      550000 -- (-261.940) [-261.752] (-260.676) (-260.714) * (-261.549) (-262.523) [-262.868] (-259.229) -- 0:00:29

      Average standard deviation of split frequencies: 0.011503

      550500 -- (-261.982) (-260.919) [-260.844] (-262.846) * (-263.625) (-265.783) (-259.961) [-259.136] -- 0:00:29
      551000 -- (-261.422) (-260.051) (-262.463) [-259.627] * (-261.843) (-261.450) (-261.268) [-259.977] -- 0:00:29
      551500 -- (-264.331) [-261.483] (-259.805) (-263.199) * (-264.159) [-259.122] (-259.471) (-263.115) -- 0:00:29
      552000 -- (-260.683) (-262.094) (-261.483) [-261.652] * (-259.600) [-260.387] (-262.969) (-260.746) -- 0:00:29
      552500 -- [-266.405] (-263.018) (-265.525) (-260.400) * (-263.069) (-260.712) (-263.137) [-262.497] -- 0:00:29
      553000 -- [-261.386] (-262.248) (-260.772) (-261.507) * (-262.271) (-264.406) (-261.455) [-264.218] -- 0:00:29
      553500 -- [-260.731] (-261.262) (-259.466) (-260.120) * (-262.996) (-262.784) (-262.287) [-262.138] -- 0:00:29
      554000 -- [-260.855] (-264.925) (-259.511) (-262.694) * (-265.483) [-261.697] (-261.920) (-265.669) -- 0:00:28
      554500 -- (-260.409) [-262.681] (-260.848) (-261.992) * (-260.939) [-262.451] (-263.476) (-261.844) -- 0:00:28
      555000 -- (-262.757) (-261.394) [-259.977] (-263.168) * (-262.816) (-262.469) (-259.721) [-260.798] -- 0:00:28

      Average standard deviation of split frequencies: 0.011499

      555500 -- [-259.726] (-260.971) (-260.702) (-263.827) * (-264.110) (-259.860) (-259.104) [-273.178] -- 0:00:28
      556000 -- [-259.954] (-264.778) (-261.177) (-265.408) * [-262.729] (-264.007) (-259.550) (-260.360) -- 0:00:28
      556500 -- (-260.212) (-264.391) (-263.678) [-259.350] * (-261.714) (-262.096) (-260.386) [-261.822] -- 0:00:28
      557000 -- (-262.561) (-266.194) [-262.198] (-260.194) * [-260.367] (-261.841) (-264.331) (-260.725) -- 0:00:28
      557500 -- (-261.244) (-265.509) [-260.698] (-263.684) * (-264.155) [-259.810] (-260.635) (-260.925) -- 0:00:28
      558000 -- (-261.737) [-263.314] (-259.500) (-265.639) * (-262.499) (-265.299) (-260.579) [-259.729] -- 0:00:28
      558500 -- [-261.291] (-260.517) (-260.741) (-261.411) * (-260.492) (-259.927) (-260.392) [-260.272] -- 0:00:28
      559000 -- (-260.500) (-261.063) [-259.411] (-259.667) * (-261.617) (-262.090) (-261.825) [-263.939] -- 0:00:28
      559500 -- (-261.751) (-261.067) (-262.419) [-261.539] * (-263.244) (-263.446) [-260.982] (-261.645) -- 0:00:29
      560000 -- (-260.181) (-266.946) (-261.066) [-260.659] * (-260.991) (-263.774) (-259.658) [-261.822] -- 0:00:29

      Average standard deviation of split frequencies: 0.011456

      560500 -- (-261.434) (-261.350) [-259.977] (-260.256) * (-262.565) [-261.586] (-260.750) (-259.528) -- 0:00:29
      561000 -- (-261.961) (-262.216) [-262.287] (-261.001) * (-260.932) (-259.990) (-262.252) [-262.046] -- 0:00:28
      561500 -- (-265.829) (-260.558) (-261.532) [-259.498] * (-261.166) [-260.729] (-260.131) (-261.217) -- 0:00:28
      562000 -- [-262.408] (-262.226) (-262.558) (-262.409) * (-262.971) (-261.115) [-264.153] (-266.049) -- 0:00:28
      562500 -- (-263.338) [-262.684] (-263.191) (-261.116) * [-259.652] (-260.641) (-262.332) (-260.276) -- 0:00:28
      563000 -- [-263.901] (-264.379) (-259.977) (-261.609) * (-261.508) [-260.806] (-260.726) (-260.800) -- 0:00:28
      563500 -- (-260.996) [-260.760] (-263.215) (-261.989) * (-260.992) (-262.627) [-259.703] (-261.505) -- 0:00:28
      564000 -- (-267.426) (-259.440) (-266.332) [-260.228] * (-260.411) [-261.497] (-259.051) (-261.868) -- 0:00:28
      564500 -- (-261.485) (-263.772) [-260.800] (-259.996) * (-263.663) [-260.114] (-261.858) (-261.814) -- 0:00:28
      565000 -- (-260.493) (-262.332) [-261.635] (-261.274) * (-263.194) (-264.505) [-260.562] (-265.674) -- 0:00:28

      Average standard deviation of split frequencies: 0.011400

      565500 -- [-260.784] (-260.334) (-262.126) (-263.836) * (-266.094) (-262.272) [-260.154] (-262.543) -- 0:00:28
      566000 -- [-259.726] (-262.696) (-260.418) (-259.645) * (-260.440) (-259.752) (-263.443) [-259.560] -- 0:00:28
      566500 -- [-262.939] (-260.390) (-262.283) (-261.470) * (-263.391) (-261.662) [-262.535] (-260.128) -- 0:00:28
      567000 -- (-263.810) [-260.286] (-260.959) (-261.023) * (-263.190) [-261.600] (-261.930) (-261.096) -- 0:00:28
      567500 -- (-259.893) (-264.111) [-261.664] (-262.110) * (-262.646) (-261.337) (-259.899) [-260.547] -- 0:00:28
      568000 -- (-260.282) (-261.920) (-261.328) [-266.263] * [-262.450] (-265.273) (-261.303) (-262.473) -- 0:00:28
      568500 -- [-261.498] (-265.740) (-260.992) (-259.857) * (-261.811) [-260.964] (-261.226) (-261.251) -- 0:00:28
      569000 -- (-260.314) (-263.700) (-263.231) [-263.866] * (-261.645) [-261.429] (-261.173) (-261.711) -- 0:00:28
      569500 -- [-260.060] (-260.317) (-259.494) (-259.626) * [-265.659] (-261.868) (-261.725) (-261.358) -- 0:00:27
      570000 -- (-263.334) (-260.436) [-260.362] (-259.937) * (-262.615) (-260.821) (-262.311) [-260.796] -- 0:00:27

      Average standard deviation of split frequencies: 0.011152

      570500 -- (-266.239) [-262.862] (-265.575) (-260.532) * [-264.857] (-260.295) (-261.796) (-260.538) -- 0:00:27
      571000 -- (-263.271) (-265.011) (-259.508) [-260.555] * (-263.730) [-262.389] (-261.430) (-260.708) -- 0:00:27
      571500 -- (-260.594) (-259.998) [-261.711] (-261.795) * (-261.671) (-261.108) (-259.935) [-259.829] -- 0:00:27
      572000 -- (-260.158) [-262.067] (-259.458) (-263.680) * (-259.885) [-259.612] (-259.688) (-260.423) -- 0:00:27
      572500 -- [-259.338] (-260.292) (-261.942) (-261.555) * (-259.186) [-259.522] (-264.529) (-260.533) -- 0:00:27
      573000 -- (-260.344) (-264.393) [-259.785] (-260.407) * (-259.968) (-261.877) (-261.814) [-260.269] -- 0:00:27
      573500 -- (-259.436) (-263.923) (-261.113) [-261.086] * [-259.788] (-263.180) (-260.296) (-262.721) -- 0:00:27
      574000 -- (-264.160) (-262.903) [-259.832] (-261.208) * [-260.217] (-261.014) (-261.630) (-260.893) -- 0:00:27
      574500 -- (-261.673) (-266.044) (-260.565) [-262.261] * (-260.527) [-261.884] (-260.787) (-261.029) -- 0:00:27
      575000 -- (-260.169) (-262.573) (-260.700) [-259.870] * (-262.181) (-262.089) (-260.343) [-260.301] -- 0:00:27

      Average standard deviation of split frequencies: 0.011304

      575500 -- (-261.891) (-264.498) [-261.126] (-263.735) * (-261.020) (-260.238) (-262.382) [-259.766] -- 0:00:27
      576000 -- (-261.835) (-261.750) (-261.238) [-260.162] * [-264.596] (-261.000) (-262.210) (-260.504) -- 0:00:27
      576500 -- (-259.934) (-263.773) [-262.926] (-260.788) * (-263.381) [-259.629] (-261.083) (-261.829) -- 0:00:27
      577000 -- (-263.718) (-259.895) (-262.169) [-259.545] * (-262.072) (-259.649) [-259.440] (-259.594) -- 0:00:27
      577500 -- (-263.848) (-262.674) (-261.292) [-261.693] * (-264.735) [-259.868] (-259.940) (-260.692) -- 0:00:27
      578000 -- (-264.986) (-261.349) [-261.963] (-260.767) * (-262.072) (-259.927) (-266.316) [-263.325] -- 0:00:27
      578500 -- (-260.957) (-262.467) [-259.849] (-260.908) * (-259.076) (-266.686) (-262.770) [-261.314] -- 0:00:27
      579000 -- (-261.229) [-261.190] (-261.635) (-262.453) * (-261.775) (-265.287) (-260.169) [-261.730] -- 0:00:27
      579500 -- (-262.343) [-260.047] (-259.831) (-260.243) * (-262.117) (-259.400) (-261.066) [-262.487] -- 0:00:27
      580000 -- [-263.476] (-259.885) (-264.495) (-261.385) * (-261.130) (-263.623) [-260.743] (-260.814) -- 0:00:27

      Average standard deviation of split frequencies: 0.011416

      580500 -- [-262.991] (-262.672) (-265.958) (-263.349) * (-261.545) (-261.529) [-260.215] (-263.021) -- 0:00:27
      581000 -- (-265.184) [-262.006] (-267.650) (-262.988) * (-263.411) (-259.681) (-260.281) [-259.752] -- 0:00:27
      581500 -- [-262.955] (-263.196) (-263.895) (-264.801) * (-264.763) (-260.910) [-259.911] (-261.268) -- 0:00:27
      582000 -- (-264.136) [-262.595] (-259.567) (-261.983) * (-262.610) [-262.131] (-263.156) (-260.955) -- 0:00:27
      582500 -- (-261.860) [-264.786] (-263.079) (-260.870) * [-264.931] (-261.220) (-260.569) (-259.933) -- 0:00:27
      583000 -- (-263.267) (-264.932) [-261.531] (-261.463) * (-262.943) [-259.576] (-259.690) (-263.636) -- 0:00:27
      583500 -- (-263.780) (-263.155) (-260.897) [-261.548] * [-262.360] (-259.854) (-261.504) (-267.395) -- 0:00:27
      584000 -- (-260.089) (-261.189) (-260.094) [-261.306] * (-259.974) (-262.851) (-262.159) [-261.718] -- 0:00:27
      584500 -- (-261.291) (-261.162) (-259.463) [-261.199] * (-264.334) (-261.319) (-261.095) [-261.873] -- 0:00:27
      585000 -- (-261.169) (-262.664) [-263.007] (-264.613) * (-261.145) (-261.550) [-266.311] (-263.786) -- 0:00:26

      Average standard deviation of split frequencies: 0.011499

      585500 -- (-261.757) (-261.941) [-260.064] (-260.522) * (-261.609) (-260.662) (-262.181) [-263.524] -- 0:00:26
      586000 -- [-260.280] (-259.457) (-259.718) (-261.569) * (-260.427) (-259.844) [-259.353] (-260.883) -- 0:00:26
      586500 -- (-260.907) [-263.871] (-261.121) (-260.690) * (-264.008) [-261.429] (-261.482) (-260.035) -- 0:00:26
      587000 -- (-261.024) [-259.491] (-265.388) (-261.035) * (-263.796) (-260.059) [-260.324] (-260.678) -- 0:00:26
      587500 -- (-261.257) (-262.923) (-260.838) [-260.668] * (-259.832) (-260.946) [-259.669] (-260.546) -- 0:00:26
      588000 -- [-260.988] (-262.690) (-262.112) (-263.679) * (-260.254) [-263.013] (-261.464) (-263.081) -- 0:00:26
      588500 -- (-267.410) [-266.727] (-264.999) (-261.802) * [-260.868] (-259.930) (-260.754) (-261.358) -- 0:00:26
      589000 -- (-260.052) (-262.305) [-262.359] (-261.368) * (-261.628) (-260.499) [-260.465] (-260.747) -- 0:00:26
      589500 -- (-259.785) [-260.443] (-261.802) (-265.021) * [-261.020] (-260.457) (-260.173) (-262.743) -- 0:00:26
      590000 -- [-259.376] (-261.769) (-260.012) (-260.180) * (-260.081) (-262.105) (-263.182) [-260.138] -- 0:00:26

      Average standard deviation of split frequencies: 0.010610

      590500 -- (-263.145) (-267.053) [-259.023] (-259.163) * [-261.561] (-262.530) (-260.943) (-262.204) -- 0:00:26
      591000 -- (-260.680) (-264.033) [-260.073] (-262.214) * (-261.263) (-261.723) [-261.102] (-262.088) -- 0:00:26
      591500 -- (-260.415) (-259.636) (-260.722) [-261.372] * (-263.455) (-259.086) (-260.783) [-263.453] -- 0:00:26
      592000 -- [-259.349] (-260.317) (-265.471) (-263.004) * (-259.793) (-259.287) (-260.668) [-261.157] -- 0:00:26
      592500 -- (-260.299) (-265.430) [-263.941] (-261.699) * (-260.473) [-260.006] (-260.799) (-262.250) -- 0:00:26
      593000 -- (-262.940) [-260.165] (-263.759) (-263.942) * (-260.096) (-260.161) [-258.961] (-264.472) -- 0:00:26
      593500 -- (-260.080) [-263.762] (-260.306) (-272.362) * (-259.948) (-266.071) [-262.368] (-266.557) -- 0:00:26
      594000 -- [-262.806] (-263.754) (-259.989) (-264.691) * (-261.639) (-260.704) [-261.218] (-261.817) -- 0:00:26
      594500 -- (-260.793) (-266.825) [-260.941] (-262.856) * (-263.966) (-259.528) [-262.150] (-261.344) -- 0:00:26
      595000 -- (-259.608) (-261.391) (-263.784) [-259.067] * (-260.840) [-261.138] (-260.015) (-259.658) -- 0:00:26

      Average standard deviation of split frequencies: 0.010980

      595500 -- [-259.723] (-260.292) (-261.674) (-259.067) * (-260.343) (-265.368) [-261.029] (-260.554) -- 0:00:26
      596000 -- [-259.072] (-260.998) (-265.048) (-264.176) * (-264.598) [-264.097] (-260.373) (-260.344) -- 0:00:26
      596500 -- (-261.373) (-259.868) (-264.224) [-260.629] * (-263.611) (-264.198) [-260.382] (-261.003) -- 0:00:26
      597000 -- (-260.948) [-260.122] (-260.685) (-261.417) * (-261.372) (-265.278) [-259.772] (-261.903) -- 0:00:26
      597500 -- (-261.668) (-259.208) [-261.530] (-261.449) * (-260.799) (-263.006) (-261.529) [-261.338] -- 0:00:26
      598000 -- [-261.017] (-260.306) (-263.126) (-263.634) * (-260.994) [-265.959] (-259.865) (-261.570) -- 0:00:26
      598500 -- (-260.875) [-260.111] (-263.816) (-264.014) * (-264.544) (-268.574) (-260.949) [-261.312] -- 0:00:26
      599000 -- [-262.378] (-260.280) (-261.381) (-261.796) * (-259.218) (-263.896) (-261.606) [-260.487] -- 0:00:26
      599500 -- (-261.842) [-263.293] (-263.632) (-262.028) * (-262.003) [-261.294] (-260.883) (-260.110) -- 0:00:26
      600000 -- (-259.928) (-261.709) (-265.256) [-261.123] * (-261.918) (-262.784) [-259.196] (-259.159) -- 0:00:25

      Average standard deviation of split frequencies: 0.010938

      600500 -- (-259.747) [-260.575] (-271.635) (-259.992) * (-261.246) (-261.621) [-260.296] (-261.585) -- 0:00:25
      601000 -- (-259.058) (-260.353) [-261.481] (-261.594) * (-262.803) [-261.688] (-263.439) (-262.365) -- 0:00:25
      601500 -- (-265.134) (-260.535) (-259.709) [-260.861] * (-262.944) (-260.184) [-264.302] (-260.610) -- 0:00:25
      602000 -- (-262.469) (-259.951) [-260.818] (-259.685) * [-260.762] (-262.570) (-261.453) (-261.208) -- 0:00:25
      602500 -- (-264.870) [-259.697] (-260.870) (-259.439) * [-263.637] (-260.649) (-259.368) (-259.830) -- 0:00:25
      603000 -- (-263.339) [-262.078] (-262.621) (-264.386) * (-265.274) [-260.558] (-262.900) (-261.333) -- 0:00:25
      603500 -- (-261.874) (-262.896) [-259.312] (-263.861) * [-262.234] (-259.097) (-262.868) (-262.243) -- 0:00:25
      604000 -- (-260.827) (-261.759) [-260.355] (-264.652) * (-264.091) [-261.730] (-260.747) (-263.582) -- 0:00:25
      604500 -- [-260.237] (-259.402) (-261.007) (-261.428) * (-259.244) (-261.113) (-261.220) [-261.126] -- 0:00:25
      605000 -- [-261.653] (-260.527) (-259.746) (-262.239) * (-261.152) (-262.444) [-264.001] (-260.724) -- 0:00:25

      Average standard deviation of split frequencies: 0.011571

      605500 -- (-260.489) [-259.350] (-261.509) (-260.534) * [-265.771] (-262.637) (-262.337) (-262.582) -- 0:00:26
      606000 -- [-260.200] (-263.060) (-259.788) (-261.806) * (-262.208) [-260.245] (-261.318) (-263.298) -- 0:00:26
      606500 -- [-260.791] (-262.132) (-260.043) (-264.567) * (-271.253) (-260.046) [-259.630] (-259.342) -- 0:00:25
      607000 -- (-259.272) (-260.192) [-259.518] (-259.695) * (-267.823) (-263.768) [-261.053] (-261.785) -- 0:00:25
      607500 -- (-264.251) (-260.425) (-260.317) [-261.225] * (-265.849) (-261.735) (-262.813) [-259.878] -- 0:00:25
      608000 -- [-260.518] (-260.508) (-265.834) (-262.294) * (-264.378) (-262.363) [-262.114] (-264.138) -- 0:00:25
      608500 -- (-261.509) (-262.067) [-260.144] (-259.726) * [-260.567] (-260.318) (-261.555) (-260.464) -- 0:00:25
      609000 -- (-260.368) (-261.378) (-261.511) [-259.881] * (-262.623) (-259.055) (-263.081) [-263.725] -- 0:00:25
      609500 -- (-260.114) (-262.028) [-262.539] (-261.626) * (-261.512) (-259.697) [-260.733] (-266.121) -- 0:00:25
      610000 -- (-263.366) [-260.316] (-261.765) (-260.524) * (-262.563) [-259.355] (-259.647) (-260.834) -- 0:00:25

      Average standard deviation of split frequencies: 0.011917

      610500 -- [-264.730] (-259.028) (-259.722) (-260.613) * (-260.715) [-260.342] (-261.692) (-262.596) -- 0:00:25
      611000 -- (-265.095) (-260.575) (-259.811) [-260.244] * (-260.543) (-261.562) [-260.696] (-261.445) -- 0:00:25
      611500 -- [-262.687] (-264.640) (-261.953) (-260.958) * (-259.496) [-260.177] (-260.927) (-262.304) -- 0:00:25
      612000 -- [-264.513] (-263.288) (-260.403) (-261.360) * (-260.487) (-260.244) (-259.800) [-260.493] -- 0:00:25
      612500 -- (-262.094) [-260.910] (-259.611) (-260.493) * (-265.185) [-260.802] (-261.078) (-260.672) -- 0:00:25
      613000 -- (-263.888) [-260.341] (-261.906) (-261.836) * (-264.818) [-260.415] (-260.860) (-260.841) -- 0:00:25
      613500 -- (-267.838) (-259.968) (-261.622) [-264.085] * (-259.658) (-263.168) [-261.336] (-261.206) -- 0:00:25
      614000 -- (-263.236) [-260.728] (-259.743) (-261.469) * (-260.646) (-260.056) (-261.867) [-260.766] -- 0:00:25
      614500 -- [-262.337] (-266.326) (-263.648) (-261.217) * [-265.540] (-263.157) (-259.834) (-262.921) -- 0:00:25
      615000 -- [-261.980] (-260.961) (-261.091) (-261.360) * [-263.614] (-266.558) (-259.992) (-260.181) -- 0:00:25

      Average standard deviation of split frequencies: 0.011839

      615500 -- [-260.347] (-263.447) (-261.247) (-263.249) * (-262.202) (-263.159) (-259.782) [-261.600] -- 0:00:24
      616000 -- (-263.238) [-264.681] (-260.535) (-260.209) * (-260.806) (-261.124) [-260.194] (-260.903) -- 0:00:24
      616500 -- (-264.399) (-262.760) [-262.418] (-260.099) * [-261.934] (-260.839) (-259.746) (-259.684) -- 0:00:24
      617000 -- (-263.060) (-262.016) (-262.119) [-260.813] * (-264.909) [-260.516] (-264.128) (-261.559) -- 0:00:24
      617500 -- [-261.954] (-259.354) (-263.463) (-261.664) * (-262.732) [-259.798] (-259.888) (-262.502) -- 0:00:24
      618000 -- [-264.375] (-261.119) (-264.006) (-259.656) * [-260.605] (-261.028) (-263.277) (-262.462) -- 0:00:24
      618500 -- [-264.474] (-262.831) (-263.309) (-262.753) * (-259.391) (-262.053) [-263.742] (-264.376) -- 0:00:24
      619000 -- (-267.106) (-260.766) (-264.190) [-263.214] * [-262.274] (-262.461) (-260.545) (-262.807) -- 0:00:24
      619500 -- (-263.572) (-260.823) [-260.236] (-261.313) * (-262.415) (-259.418) [-262.735] (-261.542) -- 0:00:24
      620000 -- [-260.074] (-260.157) (-260.357) (-259.987) * (-262.883) (-265.935) [-260.822] (-261.012) -- 0:00:24

      Average standard deviation of split frequencies: 0.011437

      620500 -- (-260.476) [-261.858] (-261.527) (-265.662) * [-261.442] (-260.155) (-263.754) (-259.999) -- 0:00:24
      621000 -- (-260.040) [-261.893] (-263.308) (-260.820) * (-260.889) (-261.118) (-262.283) [-259.875] -- 0:00:24
      621500 -- [-261.750] (-260.284) (-260.571) (-260.228) * [-266.533] (-260.178) (-260.360) (-259.249) -- 0:00:24
      622000 -- (-262.032) (-261.490) [-260.247] (-261.825) * (-261.007) (-264.473) (-263.056) [-260.167] -- 0:00:24
      622500 -- (-261.446) (-263.965) [-260.253] (-264.320) * [-261.500] (-264.123) (-261.052) (-259.866) -- 0:00:24
      623000 -- (-262.550) (-267.823) (-262.468) [-263.124] * (-261.007) (-259.934) [-261.201] (-261.264) -- 0:00:24
      623500 -- (-261.650) (-260.776) [-259.812] (-265.019) * (-260.765) (-260.580) [-260.501] (-260.885) -- 0:00:24
      624000 -- [-259.366] (-263.155) (-262.152) (-262.442) * (-262.723) (-261.986) (-260.355) [-259.588] -- 0:00:24
      624500 -- (-259.826) (-266.234) (-264.068) [-265.672] * (-266.414) [-261.813] (-260.271) (-260.512) -- 0:00:24
      625000 -- (-260.054) (-264.013) [-264.157] (-260.167) * [-260.799] (-260.743) (-259.996) (-259.060) -- 0:00:24

      Average standard deviation of split frequencies: 0.010720

      625500 -- (-261.679) [-260.279] (-265.744) (-259.865) * (-264.958) [-265.465] (-263.900) (-259.959) -- 0:00:24
      626000 -- (-262.460) [-260.527] (-263.631) (-264.020) * [-263.285] (-266.642) (-261.950) (-259.578) -- 0:00:24
      626500 -- [-261.564] (-260.683) (-262.870) (-263.256) * [-261.022] (-263.470) (-260.081) (-265.476) -- 0:00:24
      627000 -- (-267.821) (-260.971) (-260.628) [-261.494] * [-261.006] (-260.091) (-260.186) (-261.442) -- 0:00:24
      627500 -- [-262.310] (-263.855) (-260.654) (-261.875) * (-264.656) [-260.929] (-259.307) (-264.190) -- 0:00:24
      628000 -- [-265.852] (-261.363) (-261.223) (-260.925) * (-261.596) [-259.302] (-261.470) (-262.164) -- 0:00:24
      628500 -- (-264.570) (-259.553) (-262.671) [-264.922] * [-260.982] (-261.136) (-262.392) (-263.555) -- 0:00:24
      629000 -- (-262.715) (-261.395) (-261.210) [-260.443] * (-259.376) [-260.236] (-260.999) (-266.075) -- 0:00:24
      629500 -- (-262.113) (-261.045) [-260.802] (-260.243) * (-261.850) (-263.486) (-261.154) [-260.960] -- 0:00:24
      630000 -- (-260.460) [-260.979] (-261.198) (-262.799) * (-264.725) (-261.279) (-259.045) [-261.178] -- 0:00:24

      Average standard deviation of split frequencies: 0.010728

      630500 -- (-259.755) (-267.406) (-259.866) [-260.255] * (-261.989) (-262.715) [-259.618] (-260.324) -- 0:00:24
      631000 -- (-260.967) [-263.372] (-262.613) (-261.708) * (-260.095) (-260.914) (-262.792) [-259.619] -- 0:00:23
      631500 -- (-260.121) (-260.001) (-261.568) [-260.466] * (-260.990) [-260.136] (-262.604) (-260.211) -- 0:00:23
      632000 -- (-260.334) [-261.463] (-266.014) (-259.942) * [-260.535] (-261.497) (-263.816) (-260.955) -- 0:00:23
      632500 -- (-260.906) (-260.890) [-262.445] (-260.988) * (-259.925) [-259.983] (-260.139) (-260.076) -- 0:00:23
      633000 -- (-260.885) (-261.249) [-260.632] (-262.467) * (-260.917) (-262.656) [-259.796] (-262.223) -- 0:00:23
      633500 -- (-259.741) (-260.373) [-260.614] (-261.265) * [-259.940] (-262.903) (-261.660) (-262.291) -- 0:00:23
      634000 -- (-260.903) (-264.065) (-259.482) [-264.830] * [-261.261] (-262.685) (-260.146) (-260.676) -- 0:00:23
      634500 -- (-261.537) (-261.185) (-261.715) [-259.322] * [-260.310] (-266.737) (-259.345) (-263.330) -- 0:00:23
      635000 -- [-260.168] (-260.826) (-260.629) (-259.797) * (-261.544) (-263.471) [-260.767] (-260.026) -- 0:00:23

      Average standard deviation of split frequencies: 0.010726

      635500 -- [-259.788] (-263.932) (-262.768) (-259.992) * [-261.717] (-261.989) (-260.120) (-261.219) -- 0:00:23
      636000 -- (-261.378) (-263.352) [-265.307] (-259.811) * [-260.417] (-262.002) (-260.551) (-266.566) -- 0:00:23
      636500 -- (-261.608) (-265.560) [-269.728] (-259.862) * (-259.081) (-261.707) [-263.411] (-261.222) -- 0:00:23
      637000 -- (-260.814) [-261.861] (-263.324) (-259.729) * (-260.480) (-263.184) (-261.764) [-264.723] -- 0:00:23
      637500 -- (-260.853) [-261.395] (-262.306) (-259.702) * (-265.789) [-269.102] (-262.045) (-263.505) -- 0:00:23
      638000 -- (-260.501) (-261.032) (-262.659) [-260.650] * (-262.184) (-260.341) (-262.344) [-264.845] -- 0:00:23
      638500 -- [-259.364] (-261.986) (-259.181) (-261.783) * (-263.023) [-260.792] (-260.145) (-260.248) -- 0:00:23
      639000 -- [-261.139] (-263.351) (-261.667) (-259.954) * (-260.769) (-268.813) (-259.644) [-259.879] -- 0:00:23
      639500 -- [-262.272] (-262.401) (-260.198) (-262.889) * (-260.097) [-261.740] (-261.954) (-261.017) -- 0:00:23
      640000 -- (-259.429) (-261.724) [-260.431] (-262.681) * [-261.586] (-260.506) (-261.316) (-261.862) -- 0:00:23

      Average standard deviation of split frequencies: 0.010518

      640500 -- [-261.120] (-260.933) (-261.704) (-262.430) * [-262.588] (-259.661) (-262.861) (-259.399) -- 0:00:23
      641000 -- [-264.791] (-260.203) (-264.099) (-262.427) * (-268.573) [-260.352] (-259.474) (-259.867) -- 0:00:23
      641500 -- (-261.866) (-259.677) [-261.115] (-262.118) * (-269.304) [-259.530] (-263.483) (-259.510) -- 0:00:23
      642000 -- (-260.909) (-260.574) (-262.019) [-259.534] * (-261.263) (-259.739) [-263.545] (-264.430) -- 0:00:23
      642500 -- [-260.894] (-262.513) (-260.736) (-261.045) * [-266.946] (-262.710) (-261.661) (-260.736) -- 0:00:23
      643000 -- [-260.521] (-261.010) (-259.877) (-260.785) * (-259.703) [-260.526] (-261.736) (-260.382) -- 0:00:23
      643500 -- (-259.786) (-262.570) (-260.635) [-260.004] * (-262.203) (-261.925) [-265.482] (-266.665) -- 0:00:23
      644000 -- [-261.397] (-264.386) (-262.631) (-261.910) * (-261.038) (-261.776) (-262.467) [-263.684] -- 0:00:23
      644500 -- (-260.509) [-263.990] (-261.777) (-262.464) * (-259.768) [-266.221] (-260.272) (-263.010) -- 0:00:23
      645000 -- [-259.340] (-262.897) (-261.328) (-260.048) * (-263.445) (-260.506) (-260.156) [-259.637] -- 0:00:23

      Average standard deviation of split frequencies: 0.010603

      645500 -- [-259.521] (-260.008) (-262.220) (-260.051) * (-260.861) (-260.317) [-260.768] (-264.421) -- 0:00:23
      646000 -- [-261.175] (-263.149) (-260.050) (-259.816) * (-261.346) [-266.552] (-261.596) (-264.282) -- 0:00:23
      646500 -- (-262.220) [-262.680] (-261.751) (-263.216) * [-259.589] (-264.279) (-261.369) (-268.561) -- 0:00:22
      647000 -- [-263.635] (-265.657) (-260.756) (-260.989) * (-260.423) (-260.471) (-260.638) [-267.749] -- 0:00:22
      647500 -- (-260.566) (-265.332) [-260.393] (-259.713) * [-263.533] (-259.789) (-262.457) (-261.278) -- 0:00:22
      648000 -- [-260.275] (-260.208) (-265.204) (-261.051) * (-260.913) (-261.688) [-264.885] (-260.431) -- 0:00:22
      648500 -- (-260.649) [-261.732] (-260.127) (-263.904) * (-260.005) (-262.527) [-260.802] (-261.592) -- 0:00:22
      649000 -- [-260.403] (-262.015) (-260.620) (-260.417) * (-260.509) (-265.388) [-260.151] (-260.296) -- 0:00:22
      649500 -- (-261.603) (-262.787) (-261.802) [-259.065] * (-259.106) (-261.504) (-263.011) [-261.284] -- 0:00:22
      650000 -- (-259.687) [-259.909] (-261.693) (-259.332) * [-261.453] (-260.120) (-260.533) (-259.874) -- 0:00:22

      Average standard deviation of split frequencies: 0.010654

      650500 -- [-261.552] (-260.047) (-260.605) (-259.171) * [-262.608] (-262.569) (-260.433) (-260.496) -- 0:00:22
      651000 -- (-262.145) [-262.354] (-261.862) (-260.375) * (-261.046) [-261.850] (-260.878) (-260.373) -- 0:00:23
      651500 -- (-260.514) (-262.974) (-262.151) [-260.502] * (-260.716) [-261.693] (-260.436) (-261.188) -- 0:00:23
      652000 -- [-262.508] (-262.743) (-262.056) (-262.632) * (-263.498) [-261.355] (-261.863) (-260.179) -- 0:00:22
      652500 -- (-260.173) [-259.506] (-261.066) (-260.134) * (-259.202) (-260.930) (-261.286) [-260.500] -- 0:00:22
      653000 -- [-261.801] (-259.248) (-261.901) (-262.763) * (-261.313) (-263.078) [-259.697] (-260.196) -- 0:00:22
      653500 -- (-266.298) (-261.144) [-260.114] (-260.612) * (-261.959) (-264.777) (-260.102) [-259.810] -- 0:00:22
      654000 -- (-265.254) [-260.460] (-260.406) (-260.446) * [-260.664] (-264.508) (-265.077) (-259.230) -- 0:00:22
      654500 -- (-261.781) (-262.981) (-261.583) [-259.528] * (-261.570) (-264.618) (-261.849) [-261.765] -- 0:00:22
      655000 -- (-259.820) (-265.654) [-262.421] (-259.545) * (-261.777) (-261.444) (-259.565) [-262.293] -- 0:00:22

      Average standard deviation of split frequencies: 0.010990

      655500 -- [-261.215] (-262.547) (-261.237) (-262.467) * [-261.800] (-267.511) (-262.610) (-261.366) -- 0:00:22
      656000 -- [-261.569] (-260.121) (-259.630) (-261.579) * (-259.884) (-265.955) (-262.712) [-259.754] -- 0:00:22
      656500 -- (-260.867) [-259.618] (-263.931) (-262.289) * (-259.682) (-261.844) [-260.035] (-263.384) -- 0:00:22
      657000 -- (-259.961) (-260.223) (-260.370) [-262.880] * [-260.295] (-260.686) (-261.684) (-261.154) -- 0:00:22
      657500 -- [-261.616] (-261.264) (-260.434) (-262.225) * (-262.036) (-260.637) [-259.580] (-261.950) -- 0:00:22
      658000 -- (-262.843) (-263.643) [-260.336] (-263.687) * (-260.645) (-264.098) (-263.151) [-260.614] -- 0:00:22
      658500 -- [-260.590] (-262.028) (-260.954) (-260.296) * (-262.413) (-263.432) (-260.353) [-262.160] -- 0:00:22
      659000 -- (-261.147) [-263.161] (-260.181) (-263.031) * [-262.027] (-264.047) (-260.965) (-261.872) -- 0:00:22
      659500 -- (-261.536) (-262.882) (-260.377) [-262.163] * (-260.381) (-259.665) [-262.206] (-260.146) -- 0:00:22
      660000 -- [-261.167] (-260.354) (-260.708) (-261.725) * (-265.181) (-261.669) [-260.082] (-262.736) -- 0:00:22

      Average standard deviation of split frequencies: 0.010829

      660500 -- (-262.105) [-260.410] (-259.388) (-260.078) * (-265.528) [-263.910] (-260.497) (-267.461) -- 0:00:22
      661000 -- (-260.053) (-262.151) (-259.309) [-260.852] * (-260.021) (-259.587) (-260.480) [-263.623] -- 0:00:22
      661500 -- (-262.364) (-261.071) (-260.265) [-259.240] * (-259.075) (-261.836) [-260.222] (-259.709) -- 0:00:22
      662000 -- (-262.281) (-260.681) (-263.187) [-259.212] * (-259.324) (-263.684) [-260.046] (-262.647) -- 0:00:21
      662500 -- (-259.984) [-260.494] (-262.256) (-261.416) * (-260.497) [-262.899] (-260.621) (-261.506) -- 0:00:21
      663000 -- (-260.534) (-261.331) [-260.237] (-260.934) * (-259.368) (-261.107) [-264.446] (-259.904) -- 0:00:21
      663500 -- (-259.960) (-260.602) (-260.216) [-260.310] * [-259.746] (-259.380) (-266.382) (-262.448) -- 0:00:21
      664000 -- (-260.985) (-260.080) [-262.328] (-264.388) * (-259.728) (-260.359) (-261.627) [-259.341] -- 0:00:21
      664500 -- (-259.762) (-262.878) [-262.686] (-263.458) * [-259.242] (-265.985) (-260.395) (-263.460) -- 0:00:21
      665000 -- [-260.123] (-260.888) (-264.806) (-259.700) * (-261.162) (-261.375) [-259.983] (-264.428) -- 0:00:22

      Average standard deviation of split frequencies: 0.010492

      665500 -- (-262.326) (-262.747) (-262.328) [-262.817] * [-262.343] (-266.169) (-261.704) (-262.405) -- 0:00:22
      666000 -- (-264.519) [-260.510] (-262.781) (-260.443) * [-260.684] (-263.255) (-260.099) (-259.793) -- 0:00:22
      666500 -- [-262.404] (-262.471) (-265.082) (-262.548) * [-259.865] (-259.989) (-265.629) (-261.260) -- 0:00:22
      667000 -- [-260.694] (-260.392) (-263.245) (-260.436) * (-261.972) (-262.187) [-260.544] (-261.522) -- 0:00:21
      667500 -- (-260.717) (-261.001) (-263.449) [-260.999] * (-260.219) (-262.868) [-259.985] (-263.394) -- 0:00:21
      668000 -- (-259.184) [-260.142] (-260.752) (-265.743) * (-260.207) [-261.602] (-262.807) (-261.554) -- 0:00:21
      668500 -- [-260.527] (-263.250) (-260.432) (-263.484) * (-261.263) (-260.490) (-262.673) [-260.689] -- 0:00:21
      669000 -- [-260.570] (-262.200) (-259.832) (-262.277) * (-260.542) (-260.648) (-264.413) [-260.053] -- 0:00:21
      669500 -- (-259.789) [-260.586] (-262.932) (-262.388) * (-263.771) (-262.879) [-261.489] (-264.239) -- 0:00:21
      670000 -- (-264.735) (-265.639) [-264.007] (-260.006) * (-260.610) (-263.346) (-261.232) [-259.666] -- 0:00:21

      Average standard deviation of split frequencies: 0.010419

      670500 -- (-262.335) (-266.186) [-260.670] (-261.428) * (-261.019) (-261.605) (-264.635) [-260.531] -- 0:00:21
      671000 -- (-262.866) [-259.454] (-261.030) (-262.608) * [-261.695] (-262.410) (-264.749) (-262.701) -- 0:00:21
      671500 -- [-260.834] (-260.390) (-260.064) (-264.028) * (-262.685) (-259.913) (-260.430) [-262.325] -- 0:00:21
      672000 -- [-260.663] (-259.564) (-260.106) (-260.591) * (-262.278) [-260.335] (-261.510) (-260.254) -- 0:00:21
      672500 -- (-260.289) (-261.950) (-260.652) [-261.640] * (-261.044) [-261.929] (-261.553) (-259.232) -- 0:00:21
      673000 -- (-259.517) (-262.204) [-261.884] (-262.644) * [-259.736] (-262.306) (-260.280) (-260.349) -- 0:00:21
      673500 -- [-259.462] (-259.400) (-260.293) (-259.350) * (-263.862) (-261.867) (-259.621) [-260.862] -- 0:00:21
      674000 -- (-261.534) [-260.172] (-260.453) (-260.740) * (-266.828) (-264.732) [-261.077] (-259.959) -- 0:00:21
      674500 -- (-265.067) (-261.551) (-264.175) [-260.821] * (-260.861) [-261.996] (-260.669) (-261.222) -- 0:00:21
      675000 -- (-261.607) (-263.396) (-263.647) [-259.201] * (-260.705) [-262.101] (-259.505) (-261.629) -- 0:00:21

      Average standard deviation of split frequencies: 0.010542

      675500 -- (-259.067) [-260.709] (-260.465) (-265.093) * (-262.251) [-260.447] (-261.192) (-262.777) -- 0:00:21
      676000 -- [-259.114] (-260.611) (-259.747) (-261.924) * (-260.672) (-260.898) (-261.485) [-261.203] -- 0:00:21
      676500 -- (-261.521) (-261.273) [-261.416] (-260.053) * (-261.686) [-259.584] (-261.310) (-260.306) -- 0:00:21
      677000 -- (-259.884) (-261.171) [-259.897] (-260.756) * (-261.073) [-259.796] (-260.048) (-261.089) -- 0:00:20
      677500 -- (-261.845) (-259.495) [-263.251] (-261.996) * (-260.447) [-260.435] (-259.489) (-262.369) -- 0:00:20
      678000 -- [-261.232] (-260.370) (-261.385) (-260.633) * (-261.279) (-260.911) (-261.116) [-261.620] -- 0:00:20
      678500 -- (-259.819) [-262.847] (-260.867) (-262.139) * [-260.300] (-264.885) (-260.174) (-261.466) -- 0:00:20
      679000 -- (-262.686) (-260.363) [-263.912] (-262.402) * (-264.137) (-264.254) (-260.621) [-260.212] -- 0:00:20
      679500 -- (-261.336) (-261.345) [-261.689] (-262.418) * (-261.492) (-263.639) (-261.136) [-263.379] -- 0:00:21
      680000 -- [-259.215] (-260.082) (-260.695) (-263.756) * (-261.795) (-261.126) (-264.941) [-262.982] -- 0:00:21

      Average standard deviation of split frequencies: 0.010307

      680500 -- (-260.192) (-261.247) [-264.361] (-263.076) * (-260.578) [-260.306] (-259.983) (-259.465) -- 0:00:21
      681000 -- (-263.139) (-260.169) (-260.691) [-264.126] * (-259.154) [-259.699] (-261.921) (-260.972) -- 0:00:21
      681500 -- (-259.795) (-260.183) (-261.312) [-262.423] * [-260.681] (-261.026) (-261.419) (-260.800) -- 0:00:21
      682000 -- (-260.063) (-259.603) (-263.175) [-261.311] * (-263.110) [-264.257] (-259.847) (-260.572) -- 0:00:20
      682500 -- (-259.697) [-259.778] (-261.122) (-260.405) * (-264.326) (-260.626) (-260.480) [-259.253] -- 0:00:20
      683000 -- [-261.019] (-266.285) (-262.836) (-260.463) * (-260.048) (-259.768) (-261.345) [-260.804] -- 0:00:20
      683500 -- (-259.932) (-259.103) [-260.739] (-262.042) * (-266.538) [-261.699] (-262.956) (-260.824) -- 0:00:20
      684000 -- (-262.767) [-261.376] (-264.536) (-261.516) * [-261.883] (-264.333) (-260.908) (-262.515) -- 0:00:20
      684500 -- (-262.859) (-262.367) [-262.992] (-261.254) * (-260.285) (-260.491) (-262.021) [-263.901] -- 0:00:20
      685000 -- (-265.148) (-259.633) (-266.595) [-260.066] * (-261.784) (-262.053) [-260.333] (-259.709) -- 0:00:20

      Average standard deviation of split frequencies: 0.010146

      685500 -- [-261.392] (-261.116) (-261.818) (-260.236) * (-261.527) [-259.436] (-264.409) (-261.080) -- 0:00:20
      686000 -- [-261.269] (-260.544) (-262.288) (-260.532) * [-260.233] (-260.731) (-262.935) (-261.995) -- 0:00:20
      686500 -- [-261.334] (-263.139) (-260.270) (-263.429) * [-261.542] (-262.321) (-263.511) (-263.924) -- 0:00:20
      687000 -- (-260.651) (-263.740) [-260.610] (-261.501) * (-264.866) (-263.912) (-262.135) [-263.254] -- 0:00:20
      687500 -- (-265.456) [-260.247] (-259.853) (-260.915) * [-261.618] (-262.066) (-262.123) (-263.635) -- 0:00:20
      688000 -- (-265.919) [-267.260] (-260.563) (-260.372) * [-261.923] (-264.180) (-260.792) (-260.365) -- 0:00:20
      688500 -- (-263.817) (-260.942) (-260.144) [-260.440] * (-260.439) (-263.366) [-261.291] (-262.014) -- 0:00:20
      689000 -- (-260.929) [-260.162] (-261.403) (-263.980) * [-260.561] (-260.168) (-259.224) (-260.297) -- 0:00:20
      689500 -- (-260.259) (-261.534) [-259.264] (-265.184) * (-262.968) [-259.752] (-260.958) (-259.965) -- 0:00:20
      690000 -- (-265.112) (-264.494) (-260.447) [-260.005] * [-260.755] (-263.056) (-260.869) (-260.523) -- 0:00:20

      Average standard deviation of split frequencies: 0.009997

      690500 -- (-260.660) (-260.617) (-260.296) [-260.209] * [-260.974] (-264.769) (-268.260) (-259.338) -- 0:00:20
      691000 -- (-263.073) (-260.245) (-260.729) [-260.778] * [-260.621] (-263.291) (-264.712) (-259.492) -- 0:00:20
      691500 -- (-264.336) [-267.511] (-263.182) (-260.141) * (-260.292) (-259.876) [-260.076] (-262.950) -- 0:00:20
      692000 -- [-263.935] (-264.748) (-261.852) (-261.422) * [-260.088] (-259.996) (-261.032) (-260.972) -- 0:00:20
      692500 -- (-262.921) (-262.358) [-263.127] (-261.006) * (-263.260) [-259.236] (-260.542) (-262.924) -- 0:00:19
      693000 -- (-260.181) [-260.575] (-262.017) (-262.598) * [-262.447] (-259.514) (-260.340) (-260.029) -- 0:00:19
      693500 -- (-260.867) (-261.712) (-259.629) [-261.457] * (-260.821) [-260.851] (-261.304) (-260.887) -- 0:00:19
      694000 -- (-259.792) (-262.402) [-259.058] (-262.612) * (-260.704) [-262.540] (-259.286) (-262.487) -- 0:00:19
      694500 -- (-259.378) (-262.977) [-259.480] (-260.876) * (-263.529) (-262.944) [-260.335] (-260.404) -- 0:00:19
      695000 -- [-263.638] (-262.152) (-260.466) (-260.254) * (-265.935) (-261.024) (-261.630) [-259.246] -- 0:00:20

      Average standard deviation of split frequencies: 0.009960

      695500 -- [-260.585] (-262.584) (-264.757) (-261.411) * [-261.058] (-263.270) (-259.882) (-261.235) -- 0:00:20
      696000 -- (-260.687) (-263.221) [-260.596] (-259.913) * [-259.986] (-260.953) (-260.316) (-260.932) -- 0:00:20
      696500 -- [-260.901] (-260.064) (-261.335) (-261.029) * [-260.609] (-264.254) (-261.169) (-262.887) -- 0:00:20
      697000 -- (-260.410) (-262.714) (-259.732) [-262.678] * (-260.824) (-267.769) (-263.844) [-260.514] -- 0:00:19
      697500 -- (-261.959) (-261.978) [-260.427] (-262.950) * (-262.781) (-265.502) (-261.263) [-260.330] -- 0:00:19
      698000 -- (-260.238) [-259.901] (-261.914) (-263.133) * (-264.094) [-262.016] (-260.671) (-263.733) -- 0:00:19
      698500 -- (-265.676) (-261.745) (-262.868) [-260.585] * (-262.821) (-263.017) [-259.692] (-261.391) -- 0:00:19
      699000 -- (-261.943) (-261.035) [-260.142] (-260.548) * (-262.395) (-267.498) [-260.246] (-261.042) -- 0:00:19
      699500 -- (-265.970) (-261.804) [-261.092] (-265.313) * (-262.095) [-260.551] (-260.377) (-259.945) -- 0:00:19
      700000 -- (-261.841) [-261.570] (-263.622) (-260.497) * (-261.772) [-259.801] (-261.190) (-261.608) -- 0:00:19

      Average standard deviation of split frequencies: 0.010092

      700500 -- (-259.117) (-263.744) [-260.029] (-260.200) * (-261.550) [-263.355] (-260.690) (-259.488) -- 0:00:19
      701000 -- (-261.678) (-262.793) (-260.313) [-263.074] * (-263.969) (-261.970) (-260.375) [-260.397] -- 0:00:19
      701500 -- [-260.934] (-261.471) (-259.856) (-262.683) * (-265.485) [-263.174] (-262.725) (-261.308) -- 0:00:19
      702000 -- (-262.710) (-261.228) (-261.062) [-262.965] * (-263.202) (-262.824) [-259.431] (-261.719) -- 0:00:19
      702500 -- [-259.875] (-263.682) (-260.549) (-264.732) * (-262.507) (-261.109) (-261.123) [-260.982] -- 0:00:19
      703000 -- (-260.085) [-259.837] (-260.656) (-260.667) * [-261.168] (-259.940) (-260.933) (-265.294) -- 0:00:19
      703500 -- (-261.006) [-262.958] (-260.383) (-262.725) * (-261.242) [-260.952] (-262.251) (-259.495) -- 0:00:19
      704000 -- (-259.304) (-262.186) (-263.265) [-261.273] * (-259.611) (-264.588) [-260.317] (-262.618) -- 0:00:19
      704500 -- [-260.134] (-261.239) (-260.497) (-260.382) * (-263.607) (-259.287) (-260.932) [-261.197] -- 0:00:19
      705000 -- [-260.333] (-261.346) (-262.424) (-261.200) * (-267.419) [-260.052] (-260.879) (-260.582) -- 0:00:19

      Average standard deviation of split frequencies: 0.009584

      705500 -- [-259.473] (-262.908) (-259.271) (-266.358) * (-262.045) (-260.409) [-260.472] (-262.235) -- 0:00:19
      706000 -- (-260.546) (-259.974) [-260.214] (-262.639) * (-261.642) [-260.756] (-268.858) (-259.246) -- 0:00:19
      706500 -- (-260.556) [-260.937] (-260.431) (-259.738) * (-262.261) (-260.001) [-259.712] (-261.053) -- 0:00:19
      707000 -- (-260.444) [-259.701] (-260.294) (-259.482) * (-260.969) (-259.382) (-259.806) [-261.826] -- 0:00:19
      707500 -- (-261.303) [-261.822] (-261.533) (-262.093) * (-260.654) (-259.955) (-260.569) [-261.901] -- 0:00:19
      708000 -- (-263.211) (-262.376) (-263.567) [-261.917] * (-263.727) [-264.266] (-265.099) (-259.370) -- 0:00:18
      708500 -- [-261.029] (-261.689) (-264.088) (-263.127) * [-262.256] (-261.894) (-261.575) (-259.596) -- 0:00:18
      709000 -- (-261.946) (-261.942) [-265.076] (-260.725) * (-262.440) (-261.066) (-262.119) [-259.804] -- 0:00:18
      709500 -- (-259.713) (-261.730) (-265.615) [-260.455] * (-262.075) [-261.830] (-265.159) (-265.480) -- 0:00:18
      710000 -- [-264.127] (-263.433) (-268.770) (-262.750) * (-262.063) (-264.370) [-261.793] (-269.610) -- 0:00:19

      Average standard deviation of split frequencies: 0.009833

      710500 -- (-263.239) [-261.269] (-261.286) (-262.244) * [-259.639] (-259.458) (-263.080) (-260.197) -- 0:00:19
      711000 -- (-263.183) (-260.300) [-260.498] (-259.937) * (-261.848) [-262.364] (-262.423) (-261.157) -- 0:00:19
      711500 -- (-261.736) (-260.495) (-259.926) [-261.496] * (-260.303) (-259.521) (-262.410) [-262.017] -- 0:00:19
      712000 -- [-263.181] (-263.491) (-260.757) (-261.680) * (-260.427) (-263.531) (-259.656) [-261.767] -- 0:00:19
      712500 -- (-260.252) (-261.791) (-264.038) [-263.391] * (-262.691) (-263.967) [-263.512] (-266.559) -- 0:00:18
      713000 -- (-260.379) (-260.152) (-263.647) [-260.826] * (-259.804) (-259.692) (-263.465) [-260.385] -- 0:00:18
      713500 -- (-260.511) (-261.146) (-264.931) [-260.539] * (-261.970) (-261.943) (-262.860) [-261.782] -- 0:00:18
      714000 -- (-261.866) (-262.417) (-263.128) [-262.025] * (-263.095) (-261.136) (-259.214) [-260.557] -- 0:00:18
      714500 -- (-260.488) [-262.745] (-261.631) (-266.023) * (-263.033) [-263.031] (-262.163) (-263.210) -- 0:00:18
      715000 -- [-260.463] (-266.743) (-260.728) (-263.981) * (-260.315) [-261.168] (-259.707) (-267.441) -- 0:00:18

      Average standard deviation of split frequencies: 0.009798

      715500 -- [-261.255] (-261.707) (-263.717) (-259.674) * (-262.045) (-263.764) [-261.667] (-262.741) -- 0:00:18
      716000 -- (-261.203) (-260.385) (-263.450) [-261.790] * (-263.990) (-263.723) (-262.988) [-261.090] -- 0:00:18
      716500 -- (-261.267) (-259.120) [-259.413] (-262.476) * (-261.121) (-261.037) [-260.991] (-262.114) -- 0:00:18
      717000 -- [-261.076] (-260.968) (-260.003) (-264.158) * (-260.258) (-259.829) (-261.288) [-262.116] -- 0:00:18
      717500 -- [-261.014] (-264.952) (-259.176) (-261.197) * (-260.874) (-260.603) [-259.928] (-263.131) -- 0:00:18
      718000 -- [-260.520] (-265.597) (-260.201) (-261.051) * (-261.464) [-263.242] (-259.511) (-260.736) -- 0:00:18
      718500 -- (-260.097) (-263.249) [-261.081] (-260.342) * (-261.174) (-261.458) [-261.107] (-261.852) -- 0:00:18
      719000 -- (-260.065) [-263.983] (-261.066) (-262.668) * [-259.751] (-263.131) (-259.714) (-262.303) -- 0:00:18
      719500 -- [-260.180] (-263.128) (-263.187) (-261.640) * (-264.449) (-261.246) [-259.663] (-263.345) -- 0:00:18
      720000 -- (-263.111) [-262.639] (-261.118) (-260.212) * (-260.380) (-262.571) (-265.709) [-262.873] -- 0:00:18

      Average standard deviation of split frequencies: 0.010343

      720500 -- (-262.077) (-262.163) (-266.893) [-259.509] * [-259.667] (-261.560) (-261.218) (-259.312) -- 0:00:18
      721000 -- (-263.512) [-260.707] (-263.897) (-262.243) * (-261.076) (-262.544) [-262.577] (-261.030) -- 0:00:18
      721500 -- [-261.226] (-261.099) (-261.771) (-260.284) * (-259.731) [-261.232] (-263.230) (-261.733) -- 0:00:18
      722000 -- [-261.064] (-259.799) (-259.450) (-260.806) * (-259.946) [-262.205] (-262.258) (-262.881) -- 0:00:18
      722500 -- (-260.157) [-260.110] (-262.120) (-260.891) * [-261.020] (-264.876) (-263.204) (-262.974) -- 0:00:18
      723000 -- (-259.826) (-262.080) (-260.275) [-259.780] * (-260.960) [-260.896] (-260.507) (-261.468) -- 0:00:18
      723500 -- (-259.659) (-259.944) (-260.250) [-259.959] * [-264.361] (-260.987) (-260.828) (-259.848) -- 0:00:17
      724000 -- (-265.171) [-260.003] (-261.938) (-259.374) * [-260.083] (-260.456) (-262.302) (-260.771) -- 0:00:18
      724500 -- (-260.893) (-261.935) [-261.376] (-259.320) * [-260.428] (-259.605) (-266.642) (-261.187) -- 0:00:18
      725000 -- [-263.296] (-259.239) (-262.711) (-259.420) * (-261.013) [-260.523] (-261.382) (-262.236) -- 0:00:18

      Average standard deviation of split frequencies: 0.010957

      725500 -- (-267.375) (-259.658) (-260.421) [-264.412] * (-259.784) (-260.070) [-261.115] (-260.771) -- 0:00:18
      726000 -- (-263.423) [-259.970] (-261.324) (-261.272) * [-259.319] (-260.140) (-263.464) (-261.048) -- 0:00:18
      726500 -- [-260.341] (-259.331) (-261.689) (-260.918) * [-259.828] (-263.562) (-262.045) (-261.150) -- 0:00:18
      727000 -- (-264.853) [-259.728] (-261.740) (-263.518) * (-260.892) [-261.145] (-264.296) (-262.482) -- 0:00:18
      727500 -- [-259.843] (-259.830) (-260.461) (-262.193) * (-263.114) (-260.622) (-259.340) [-261.561] -- 0:00:17
      728000 -- (-267.212) (-261.895) [-260.824] (-260.041) * (-264.233) (-260.802) [-259.501] (-259.835) -- 0:00:17
      728500 -- (-261.620) (-262.639) (-261.663) [-260.039] * (-262.910) (-260.684) (-259.500) [-260.954] -- 0:00:17
      729000 -- (-262.024) [-260.745] (-263.020) (-259.728) * (-261.313) [-259.621] (-259.708) (-264.938) -- 0:00:17
      729500 -- (-263.144) [-259.894] (-262.178) (-262.879) * (-262.257) (-259.749) (-259.552) [-264.849] -- 0:00:17
      730000 -- [-262.582] (-262.469) (-261.302) (-260.491) * (-264.085) [-259.573] (-260.693) (-263.799) -- 0:00:17

      Average standard deviation of split frequencies: 0.011250

      730500 -- (-260.736) (-270.699) [-263.716] (-260.085) * (-261.686) (-262.665) [-263.941] (-264.423) -- 0:00:17
      731000 -- [-261.296] (-264.344) (-260.745) (-261.870) * (-261.615) (-260.835) (-260.725) [-259.547] -- 0:00:17
      731500 -- (-262.228) (-262.404) (-261.168) [-261.412] * (-259.126) [-263.056] (-261.073) (-260.052) -- 0:00:17
      732000 -- [-259.290] (-262.193) (-261.520) (-261.999) * (-259.855) [-262.221] (-261.214) (-264.359) -- 0:00:17
      732500 -- (-259.654) (-264.805) [-261.747] (-266.268) * (-261.165) [-261.991] (-261.476) (-260.978) -- 0:00:17
      733000 -- (-260.106) (-263.450) (-263.128) [-265.195] * [-259.530] (-259.744) (-260.903) (-261.144) -- 0:00:17
      733500 -- [-259.790] (-263.087) (-261.049) (-262.735) * (-262.063) (-261.577) [-262.107] (-264.581) -- 0:00:17
      734000 -- (-260.400) (-262.026) [-260.220] (-262.231) * [-261.245] (-261.107) (-260.228) (-263.847) -- 0:00:17
      734500 -- (-262.875) (-262.453) (-262.987) [-262.629] * (-262.078) [-260.660] (-261.600) (-261.403) -- 0:00:17
      735000 -- (-260.232) (-260.957) (-260.389) [-261.922] * (-261.478) [-260.819] (-262.043) (-261.735) -- 0:00:17

      Average standard deviation of split frequencies: 0.011249

      735500 -- (-264.608) (-260.925) [-262.787] (-262.991) * (-262.894) [-262.826] (-263.314) (-261.327) -- 0:00:17
      736000 -- (-261.212) (-260.364) [-260.077] (-261.183) * (-259.420) [-259.986] (-261.335) (-260.410) -- 0:00:17
      736500 -- (-261.972) (-260.106) [-261.643] (-264.624) * (-262.012) (-259.709) [-261.763] (-262.561) -- 0:00:17
      737000 -- (-264.208) [-259.856] (-259.734) (-262.808) * [-259.203] (-260.225) (-262.516) (-262.418) -- 0:00:17
      737500 -- (-261.854) (-259.605) [-259.782] (-263.238) * [-260.805] (-262.429) (-262.510) (-259.831) -- 0:00:17
      738000 -- (-260.736) (-263.349) [-262.157] (-261.060) * (-260.848) (-264.337) (-261.801) [-261.439] -- 0:00:17
      738500 -- (-262.694) [-263.550] (-262.220) (-262.333) * (-260.201) (-262.194) (-260.328) [-259.777] -- 0:00:17
      739000 -- (-260.269) (-260.285) (-261.223) [-260.405] * (-260.601) (-265.302) (-265.196) [-262.288] -- 0:00:17
      739500 -- (-262.179) (-259.163) (-266.147) [-260.109] * [-260.380] (-264.266) (-262.536) (-260.510) -- 0:00:17
      740000 -- (-262.196) (-260.602) [-264.344] (-262.786) * (-262.241) (-260.829) (-260.046) [-259.273] -- 0:00:17

      Average standard deviation of split frequencies: 0.011058

      740500 -- (-260.713) (-259.362) (-263.990) [-260.176] * (-262.732) (-260.169) [-261.714] (-264.689) -- 0:00:17
      741000 -- [-260.997] (-263.572) (-259.649) (-260.010) * (-261.683) (-261.314) [-261.042] (-260.198) -- 0:00:17
      741500 -- (-259.336) (-265.809) [-260.637] (-260.433) * (-261.731) (-260.209) [-259.953] (-259.965) -- 0:00:17
      742000 -- (-262.660) [-264.434] (-260.897) (-263.609) * (-260.933) (-259.478) (-261.674) [-261.205] -- 0:00:17
      742500 -- [-262.024] (-267.878) (-262.943) (-261.290) * [-259.434] (-264.110) (-259.564) (-261.600) -- 0:00:16
      743000 -- (-263.334) (-265.013) [-259.981] (-262.356) * [-260.144] (-264.096) (-261.083) (-260.888) -- 0:00:16
      743500 -- (-260.218) (-261.856) [-259.715] (-264.481) * (-259.789) (-260.726) [-262.049] (-260.588) -- 0:00:16
      744000 -- [-260.624] (-260.380) (-264.458) (-265.064) * [-262.341] (-261.947) (-262.832) (-259.279) -- 0:00:16
      744500 -- (-260.899) (-262.345) (-261.156) [-259.696] * (-262.903) (-262.899) (-267.839) [-259.784] -- 0:00:16
      745000 -- [-259.391] (-259.549) (-261.505) (-260.550) * (-261.317) (-265.647) (-262.367) [-259.412] -- 0:00:16

      Average standard deviation of split frequencies: 0.010703

      745500 -- (-261.587) (-263.891) [-261.257] (-260.106) * [-259.699] (-264.142) (-263.842) (-261.420) -- 0:00:16
      746000 -- [-261.096] (-261.506) (-259.979) (-261.068) * [-263.788] (-260.768) (-259.764) (-263.736) -- 0:00:16
      746500 -- (-259.258) (-261.722) (-261.730) [-263.667] * (-262.789) [-264.698] (-259.865) (-259.492) -- 0:00:16
      747000 -- [-259.545] (-260.879) (-259.464) (-262.073) * (-262.531) [-262.030] (-262.721) (-259.153) -- 0:00:16
      747500 -- [-261.021] (-261.608) (-260.327) (-260.112) * (-266.244) (-261.885) [-261.510] (-260.970) -- 0:00:16
      748000 -- (-261.233) (-262.823) (-261.153) [-260.458] * (-262.909) [-261.591] (-263.650) (-259.898) -- 0:00:16
      748500 -- [-259.453] (-262.979) (-262.218) (-262.358) * [-262.115] (-265.741) (-259.955) (-260.476) -- 0:00:16
      749000 -- (-259.527) (-261.233) (-260.281) [-259.732] * (-261.144) [-262.210] (-259.935) (-260.512) -- 0:00:16
      749500 -- [-260.535] (-262.544) (-261.653) (-261.958) * [-260.842] (-267.549) (-261.639) (-262.228) -- 0:00:16
      750000 -- (-261.911) [-259.978] (-264.199) (-261.364) * (-259.913) (-263.221) [-262.038] (-260.524) -- 0:00:16

      Average standard deviation of split frequencies: 0.010676

      750500 -- (-263.942) (-261.382) [-263.954] (-260.020) * (-259.398) (-263.660) (-265.828) [-263.202] -- 0:00:16
      751000 -- [-262.976] (-261.726) (-268.231) (-259.828) * (-259.675) (-259.093) [-261.973] (-260.074) -- 0:00:16
      751500 -- [-266.454] (-261.715) (-265.316) (-260.499) * (-261.000) [-259.859] (-260.219) (-260.705) -- 0:00:16
      752000 -- (-260.877) [-263.278] (-259.645) (-260.854) * (-261.542) (-260.407) (-260.433) [-263.148] -- 0:00:16
      752500 -- (-260.787) (-262.092) (-259.526) [-260.957] * (-262.184) (-259.910) [-259.882] (-263.296) -- 0:00:16
      753000 -- (-260.806) (-262.596) [-261.932] (-260.900) * (-260.505) (-262.014) (-260.162) [-263.028] -- 0:00:16
      753500 -- [-263.856] (-263.934) (-262.679) (-262.022) * (-261.080) (-259.532) (-263.261) [-260.621] -- 0:00:16
      754000 -- [-260.739] (-270.299) (-260.347) (-259.720) * [-259.768] (-265.437) (-262.405) (-264.236) -- 0:00:16
      754500 -- (-261.737) (-262.237) [-259.249] (-259.794) * (-262.200) [-269.754] (-262.462) (-267.288) -- 0:00:16
      755000 -- (-259.359) [-261.855] (-260.112) (-262.532) * [-260.323] (-264.357) (-264.055) (-263.719) -- 0:00:16

      Average standard deviation of split frequencies: 0.010522

      755500 -- (-260.931) [-262.304] (-260.448) (-262.621) * (-260.936) [-261.293] (-263.393) (-261.005) -- 0:00:16
      756000 -- (-263.280) [-262.539] (-266.920) (-259.525) * (-261.831) (-261.236) (-265.699) [-260.396] -- 0:00:16
      756500 -- (-268.199) (-264.063) [-260.953] (-260.442) * [-260.975] (-261.164) (-261.884) (-260.422) -- 0:00:16
      757000 -- (-265.375) (-259.584) [-261.320] (-263.152) * [-260.950] (-261.300) (-260.293) (-259.913) -- 0:00:16
      757500 -- (-264.857) (-261.860) (-264.055) [-264.633] * (-261.758) [-260.749] (-261.817) (-261.522) -- 0:00:16
      758000 -- (-264.771) (-260.221) (-264.594) [-260.520] * (-264.369) (-260.180) (-261.608) [-260.253] -- 0:00:15
      758500 -- [-262.180] (-262.164) (-259.841) (-260.107) * (-261.684) (-265.593) [-259.837] (-261.618) -- 0:00:15
      759000 -- [-260.444] (-262.974) (-260.978) (-259.684) * [-261.487] (-262.628) (-261.239) (-259.863) -- 0:00:15
      759500 -- (-263.189) (-263.723) [-260.534] (-262.437) * (-260.299) (-260.376) (-259.840) [-260.030] -- 0:00:15
      760000 -- (-263.651) (-261.842) [-260.487] (-264.589) * (-260.861) [-261.498] (-260.767) (-262.192) -- 0:00:15

      Average standard deviation of split frequencies: 0.010419

      760500 -- (-260.857) (-264.711) [-260.837] (-262.375) * [-262.345] (-264.202) (-262.310) (-261.661) -- 0:00:15
      761000 -- [-262.979] (-266.735) (-264.595) (-261.156) * (-264.913) (-261.053) (-261.564) [-260.060] -- 0:00:15
      761500 -- (-263.409) (-260.519) [-260.854] (-263.433) * (-262.720) (-261.681) (-260.831) [-261.703] -- 0:00:15
      762000 -- [-263.321] (-262.495) (-261.058) (-262.148) * (-265.353) [-261.721] (-262.425) (-264.207) -- 0:00:15
      762500 -- (-261.712) [-260.308] (-261.021) (-259.438) * (-261.206) (-261.061) [-265.074] (-264.648) -- 0:00:15
      763000 -- (-260.875) (-262.963) [-262.212] (-260.244) * (-261.403) [-265.392] (-260.248) (-267.213) -- 0:00:15
      763500 -- (-260.178) (-261.782) [-264.475] (-259.713) * (-260.190) [-259.205] (-260.192) (-261.304) -- 0:00:15
      764000 -- (-264.066) (-260.882) [-261.793] (-260.208) * (-259.870) (-259.368) [-260.166] (-261.372) -- 0:00:15
      764500 -- (-261.646) (-264.936) [-266.786] (-262.627) * [-261.060] (-261.264) (-262.624) (-261.581) -- 0:00:15
      765000 -- [-262.491] (-263.264) (-261.341) (-265.040) * [-260.311] (-260.315) (-260.308) (-261.710) -- 0:00:15

      Average standard deviation of split frequencies: 0.010500

      765500 -- (-261.120) (-262.394) (-261.818) [-263.460] * [-260.843] (-264.345) (-260.749) (-260.911) -- 0:00:15
      766000 -- [-260.636] (-265.364) (-262.635) (-260.818) * (-263.054) (-263.574) [-259.459] (-261.571) -- 0:00:15
      766500 -- [-264.182] (-260.335) (-260.076) (-259.654) * [-263.993] (-264.540) (-259.648) (-263.853) -- 0:00:15
      767000 -- [-261.607] (-259.511) (-261.890) (-261.575) * (-262.640) [-260.565] (-261.781) (-263.665) -- 0:00:15
      767500 -- (-259.513) (-264.908) [-261.308] (-259.934) * (-263.894) (-260.420) [-259.477] (-259.816) -- 0:00:15
      768000 -- (-261.188) [-262.672] (-261.651) (-261.685) * [-262.585] (-261.043) (-260.405) (-259.800) -- 0:00:15
      768500 -- (-262.449) (-263.211) (-261.727) [-261.173] * [-259.917] (-260.842) (-262.332) (-265.837) -- 0:00:15
      769000 -- [-259.389] (-260.930) (-261.506) (-266.545) * (-262.171) [-260.541] (-259.911) (-262.165) -- 0:00:15
      769500 -- [-259.802] (-260.775) (-260.502) (-263.166) * [-261.029] (-261.257) (-259.535) (-262.830) -- 0:00:15
      770000 -- (-259.717) (-260.138) [-261.083] (-261.443) * (-261.002) (-262.541) [-261.381] (-261.729) -- 0:00:15

      Average standard deviation of split frequencies: 0.010437

      770500 -- [-260.908] (-265.424) (-260.478) (-261.021) * (-263.165) (-261.522) (-263.014) [-259.077] -- 0:00:15
      771000 -- (-259.674) (-260.277) (-262.530) [-260.925] * (-260.854) (-262.347) [-262.640] (-266.428) -- 0:00:15
      771500 -- [-260.073] (-262.694) (-262.287) (-260.283) * (-265.575) [-261.538] (-260.505) (-261.979) -- 0:00:15
      772000 -- (-261.733) (-260.241) (-261.097) [-262.403] * (-262.834) (-259.782) (-261.000) [-262.475] -- 0:00:15
      772500 -- (-263.667) [-258.918] (-261.314) (-259.812) * [-259.880] (-260.921) (-260.427) (-260.164) -- 0:00:15
      773000 -- (-264.618) (-260.123) [-261.372] (-260.458) * (-267.483) (-261.017) [-259.612] (-265.055) -- 0:00:14
      773500 -- (-261.626) (-260.917) [-260.046] (-260.515) * (-271.243) (-262.165) (-260.862) [-260.554] -- 0:00:14
      774000 -- (-259.754) (-260.762) (-260.737) [-261.378] * (-267.743) (-260.881) [-259.744] (-259.550) -- 0:00:14
      774500 -- [-263.411] (-260.379) (-260.751) (-263.385) * [-263.489] (-260.206) (-263.629) (-266.939) -- 0:00:14
      775000 -- [-260.522] (-261.830) (-262.563) (-261.599) * [-261.344] (-263.603) (-262.065) (-262.222) -- 0:00:15

      Average standard deviation of split frequencies: 0.011006

      775500 -- (-262.599) [-260.795] (-261.957) (-260.578) * (-260.453) (-262.911) [-260.743] (-264.207) -- 0:00:15
      776000 -- [-261.581] (-260.524) (-260.209) (-260.387) * (-261.667) [-262.201] (-260.710) (-261.669) -- 0:00:15
      776500 -- [-261.871] (-260.691) (-265.047) (-261.657) * (-266.822) (-259.743) [-261.945] (-261.075) -- 0:00:14
      777000 -- (-263.063) [-262.353] (-263.750) (-261.236) * (-262.438) (-261.559) [-259.958] (-268.911) -- 0:00:14
      777500 -- (-260.276) [-260.095] (-264.349) (-261.229) * [-260.024] (-261.949) (-261.758) (-267.915) -- 0:00:14
      778000 -- [-260.541] (-262.822) (-262.821) (-260.080) * [-259.984] (-261.171) (-260.257) (-259.007) -- 0:00:14
      778500 -- (-260.626) [-263.427] (-262.315) (-259.834) * (-260.226) (-265.168) (-262.420) [-259.938] -- 0:00:14
      779000 -- (-258.939) (-262.810) (-262.001) [-261.233] * (-260.843) [-259.758] (-259.925) (-263.620) -- 0:00:14
      779500 -- [-259.849] (-261.263) (-260.882) (-260.511) * (-263.266) (-260.448) [-261.027] (-262.408) -- 0:00:14
      780000 -- (-260.464) (-261.480) [-261.381] (-259.599) * (-261.499) [-259.511] (-260.147) (-261.459) -- 0:00:14

      Average standard deviation of split frequencies: 0.010379

      780500 -- (-262.347) [-263.345] (-261.972) (-260.461) * [-264.916] (-263.040) (-260.649) (-261.601) -- 0:00:14
      781000 -- (-262.248) [-261.927] (-267.229) (-261.869) * [-261.929] (-262.007) (-260.019) (-262.701) -- 0:00:14
      781500 -- [-259.007] (-269.987) (-261.490) (-263.636) * (-260.236) [-260.295] (-265.344) (-261.428) -- 0:00:14
      782000 -- [-259.441] (-265.945) (-261.360) (-262.711) * (-260.971) (-263.558) (-260.414) [-259.482] -- 0:00:14
      782500 -- (-259.556) (-274.854) [-261.317] (-259.984) * [-260.299] (-262.150) (-263.608) (-260.617) -- 0:00:14
      783000 -- (-260.037) (-264.256) (-260.425) [-259.981] * (-262.483) (-262.833) (-262.279) [-259.613] -- 0:00:14
      783500 -- [-261.046] (-264.933) (-261.272) (-262.608) * (-263.102) [-260.815] (-262.563) (-261.967) -- 0:00:14
      784000 -- [-260.685] (-268.115) (-261.427) (-263.067) * [-260.170] (-260.068) (-262.393) (-259.894) -- 0:00:14
      784500 -- (-263.998) [-261.995] (-260.779) (-259.664) * (-259.211) (-264.571) (-262.876) [-260.538] -- 0:00:14
      785000 -- [-261.634] (-266.492) (-259.697) (-261.496) * (-261.967) (-262.289) (-261.779) [-259.871] -- 0:00:14

      Average standard deviation of split frequencies: 0.010478

      785500 -- (-262.386) (-262.521) (-260.793) [-259.431] * (-260.864) (-261.451) [-260.790] (-260.129) -- 0:00:14
      786000 -- [-261.293] (-261.664) (-265.592) (-259.800) * (-262.057) [-259.859] (-262.423) (-262.656) -- 0:00:14
      786500 -- [-260.754] (-260.277) (-262.781) (-262.906) * (-262.673) (-259.210) (-261.240) [-264.402] -- 0:00:14
      787000 -- (-262.549) (-261.085) [-259.158] (-260.350) * (-259.687) [-261.808] (-260.980) (-260.671) -- 0:00:14
      787500 -- (-264.231) (-262.264) (-262.923) [-259.046] * [-260.410] (-261.464) (-260.189) (-260.561) -- 0:00:14
      788000 -- [-259.935] (-260.917) (-262.597) (-260.285) * (-261.101) (-262.610) [-260.104] (-262.066) -- 0:00:13
      788500 -- [-261.128] (-264.482) (-262.693) (-261.134) * (-260.127) (-265.564) [-259.249] (-261.353) -- 0:00:14
      789000 -- (-261.636) [-260.239] (-264.956) (-261.380) * (-263.711) (-259.521) [-260.424] (-264.498) -- 0:00:14
      789500 -- (-259.237) (-263.534) [-262.321] (-262.556) * (-259.608) (-263.041) (-260.582) [-259.037] -- 0:00:14
      790000 -- [-259.186] (-259.880) (-261.903) (-262.689) * (-259.732) [-259.204] (-259.635) (-263.699) -- 0:00:14

      Average standard deviation of split frequencies: 0.010247

      790500 -- [-259.435] (-260.784) (-260.392) (-262.312) * (-264.165) (-264.810) [-258.946] (-264.624) -- 0:00:14
      791000 -- (-261.007) (-260.043) (-260.885) [-264.900] * (-263.200) (-259.509) [-261.193] (-263.985) -- 0:00:14
      791500 -- (-262.572) [-261.033] (-262.362) (-259.289) * (-261.459) [-258.922] (-260.741) (-263.681) -- 0:00:13
      792000 -- (-262.420) (-261.783) [-261.324] (-259.992) * (-262.238) [-264.137] (-260.780) (-262.940) -- 0:00:13
      792500 -- [-262.080] (-261.594) (-261.958) (-262.554) * (-262.715) [-259.642] (-260.977) (-265.515) -- 0:00:13
      793000 -- [-262.024] (-259.572) (-264.901) (-260.751) * (-267.706) [-263.093] (-263.060) (-263.758) -- 0:00:13
      793500 -- (-261.728) (-260.142) (-266.453) [-260.075] * (-261.611) (-263.597) (-271.768) [-261.040] -- 0:00:13
      794000 -- (-260.765) (-260.065) (-263.293) [-259.531] * [-262.262] (-262.818) (-261.802) (-259.674) -- 0:00:13
      794500 -- [-260.077] (-261.184) (-260.937) (-266.239) * (-260.199) [-259.154] (-261.387) (-259.924) -- 0:00:13
      795000 -- (-264.275) [-260.931] (-260.083) (-262.834) * (-259.652) (-259.641) [-262.948] (-260.016) -- 0:00:13

      Average standard deviation of split frequencies: 0.009957

      795500 -- (-260.864) (-264.474) [-260.269] (-266.383) * (-261.867) [-261.339] (-264.164) (-260.770) -- 0:00:13
      796000 -- [-259.649] (-261.744) (-259.310) (-267.363) * [-263.184] (-265.810) (-261.817) (-259.979) -- 0:00:13
      796500 -- (-261.104) [-261.015] (-260.622) (-262.700) * [-260.859] (-263.480) (-261.997) (-259.721) -- 0:00:13
      797000 -- [-264.672] (-259.971) (-260.536) (-260.350) * [-261.712] (-261.518) (-262.849) (-259.632) -- 0:00:13
      797500 -- (-261.155) (-261.158) [-260.531] (-262.909) * (-262.674) [-260.261] (-261.378) (-262.546) -- 0:00:13
      798000 -- (-263.250) (-265.666) (-259.972) [-260.543] * (-263.040) [-260.861] (-263.794) (-259.644) -- 0:00:13
      798500 -- (-264.362) [-259.682] (-259.728) (-261.020) * (-260.739) [-260.576] (-264.684) (-260.811) -- 0:00:13
      799000 -- (-261.737) [-260.496] (-262.102) (-260.763) * (-266.338) (-260.849) [-261.956] (-260.349) -- 0:00:13
      799500 -- (-260.881) (-260.601) (-262.723) [-261.232] * (-267.908) (-261.919) (-260.909) [-259.466] -- 0:00:13
      800000 -- (-267.014) (-262.394) [-260.905] (-260.283) * (-262.175) [-262.580] (-262.047) (-259.828) -- 0:00:13

      Average standard deviation of split frequencies: 0.009899

      800500 -- (-261.077) (-260.202) [-260.808] (-263.347) * [-262.610] (-260.920) (-263.866) (-259.859) -- 0:00:13
      801000 -- (-261.384) [-259.799] (-264.002) (-259.052) * (-260.615) (-260.660) [-260.891] (-261.126) -- 0:00:13
      801500 -- (-261.224) [-260.246] (-260.804) (-261.211) * (-261.708) [-261.560] (-264.721) (-261.246) -- 0:00:13
      802000 -- (-265.247) (-261.254) (-262.462) [-260.423] * (-266.156) (-259.379) (-263.423) [-260.179] -- 0:00:13
      802500 -- (-261.197) [-262.873] (-260.050) (-260.425) * (-268.151) [-262.813] (-260.404) (-262.036) -- 0:00:13
      803000 -- (-264.858) (-264.557) (-260.159) [-261.141] * (-264.524) (-265.108) [-260.526] (-261.596) -- 0:00:13
      803500 -- (-263.025) (-260.109) [-259.502] (-259.426) * (-260.853) (-261.662) (-261.360) [-261.943] -- 0:00:12
      804000 -- (-261.537) [-261.742] (-259.970) (-261.793) * (-262.322) (-260.669) [-262.244] (-262.632) -- 0:00:13
      804500 -- [-261.508] (-262.795) (-262.351) (-265.472) * [-262.789] (-259.537) (-260.210) (-261.533) -- 0:00:13
      805000 -- [-260.611] (-261.695) (-260.872) (-261.326) * (-260.315) [-259.370] (-260.440) (-262.552) -- 0:00:13

      Average standard deviation of split frequencies: 0.009870

      805500 -- (-261.276) (-261.372) [-265.084] (-260.313) * (-259.930) [-261.241] (-262.215) (-260.891) -- 0:00:13
      806000 -- (-270.001) (-264.060) (-260.101) [-263.812] * (-259.922) [-259.401] (-262.058) (-262.719) -- 0:00:12
      806500 -- (-262.466) [-260.050] (-262.091) (-261.647) * [-259.520] (-260.476) (-261.062) (-263.285) -- 0:00:12
      807000 -- (-262.648) (-259.101) (-260.939) [-263.130] * (-261.487) (-260.987) [-260.172] (-263.541) -- 0:00:12
      807500 -- [-266.355] (-259.279) (-267.518) (-259.824) * (-260.724) (-264.017) (-263.839) [-261.874] -- 0:00:12
      808000 -- (-262.924) [-259.069] (-264.428) (-261.523) * (-260.843) (-264.354) (-261.969) [-261.221] -- 0:00:12
      808500 -- (-261.287) (-259.816) [-261.983] (-261.266) * [-260.124] (-261.490) (-259.830) (-263.197) -- 0:00:12
      809000 -- (-261.665) (-260.696) [-262.981] (-263.570) * (-260.347) (-262.420) [-260.179] (-263.806) -- 0:00:12
      809500 -- (-259.111) [-259.495] (-266.817) (-262.731) * (-259.232) (-262.175) [-260.574] (-259.189) -- 0:00:12
      810000 -- [-259.216] (-260.435) (-264.964) (-266.533) * [-263.071] (-263.264) (-259.563) (-260.822) -- 0:00:12

      Average standard deviation of split frequencies: 0.009631

      810500 -- [-261.587] (-265.210) (-259.346) (-269.555) * (-261.918) (-259.134) [-260.971] (-260.532) -- 0:00:12
      811000 -- (-263.815) (-263.378) [-261.759] (-260.309) * [-259.114] (-259.566) (-261.874) (-259.852) -- 0:00:12
      811500 -- (-262.082) (-263.624) (-261.583) [-260.424] * [-260.260] (-260.970) (-259.955) (-261.159) -- 0:00:12
      812000 -- [-261.804] (-260.209) (-261.058) (-261.265) * [-260.457] (-261.042) (-262.465) (-260.183) -- 0:00:12
      812500 -- (-260.850) (-264.582) (-260.793) [-262.372] * (-268.932) [-261.587] (-261.863) (-259.631) -- 0:00:12
      813000 -- (-262.863) [-260.929] (-260.502) (-266.834) * (-267.979) (-263.645) (-261.010) [-259.179] -- 0:00:12
      813500 -- [-261.924] (-259.925) (-259.022) (-264.168) * (-260.109) (-262.191) (-259.568) [-259.353] -- 0:00:12
      814000 -- (-262.678) (-260.067) (-259.184) [-260.613] * (-261.400) [-263.096] (-259.652) (-261.529) -- 0:00:12
      814500 -- (-262.233) (-262.083) (-260.510) [-263.469] * (-261.360) (-261.380) [-259.561] (-261.749) -- 0:00:12
      815000 -- (-259.286) [-259.840] (-262.208) (-260.322) * (-263.894) (-259.317) (-263.489) [-266.209] -- 0:00:12

      Average standard deviation of split frequencies: 0.009677

      815500 -- (-262.378) (-260.858) (-260.784) [-260.987] * (-261.077) (-260.677) (-262.722) [-259.924] -- 0:00:12
      816000 -- (-261.250) (-260.055) [-262.796] (-261.740) * (-259.711) (-265.125) (-259.899) [-264.275] -- 0:00:12
      816500 -- (-260.144) (-259.691) (-262.709) [-264.542] * (-263.859) (-259.455) (-263.239) [-262.203] -- 0:00:12
      817000 -- [-264.090] (-261.884) (-260.980) (-261.523) * (-263.619) (-261.450) (-266.443) [-263.263] -- 0:00:12
      817500 -- (-268.556) (-264.589) [-259.014] (-265.242) * (-262.348) (-266.199) [-261.675] (-262.208) -- 0:00:12
      818000 -- [-261.925] (-259.665) (-261.420) (-260.743) * [-261.627] (-260.286) (-263.738) (-260.273) -- 0:00:12
      818500 -- (-260.053) (-262.009) (-260.525) [-259.994] * (-261.903) (-260.310) [-259.398] (-262.001) -- 0:00:11
      819000 -- [-260.562] (-259.839) (-261.274) (-259.919) * (-264.876) (-259.803) (-261.543) [-261.803] -- 0:00:12
      819500 -- [-265.318] (-259.802) (-263.450) (-260.980) * [-259.930] (-264.429) (-261.347) (-262.927) -- 0:00:12
      820000 -- (-262.463) [-259.380] (-262.236) (-260.914) * [-259.941] (-260.774) (-259.229) (-260.616) -- 0:00:12

      Average standard deviation of split frequencies: 0.009693

      820500 -- (