--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:05:20 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpmI/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -260.56 -264.01
2 -260.55 -266.04
--------------------------------------
TOTAL -260.55 -265.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892706 0.084457 0.361475 1.470542 0.860392 1161.08 1331.04 1.001
r(A<->C){all} 0.168765 0.020473 0.000086 0.453337 0.126834 130.34 277.76 1.000
r(A<->G){all} 0.161664 0.019119 0.000059 0.435086 0.125719 158.74 197.89 1.008
r(A<->T){all} 0.167705 0.020977 0.000070 0.452850 0.128453 224.69 240.58 1.000
r(C<->G){all} 0.166912 0.019082 0.000139 0.437465 0.132201 255.98 271.31 1.003
r(C<->T){all} 0.156395 0.017698 0.000036 0.429743 0.121762 188.93 217.08 1.004
r(G<->T){all} 0.178560 0.021794 0.000053 0.471430 0.140978 192.73 327.62 1.000
pi(A){all} 0.239230 0.000910 0.180514 0.299419 0.238491 1130.77 1315.88 1.000
pi(C){all} 0.315046 0.001081 0.251174 0.377104 0.314444 1229.46 1264.85 1.000
pi(G){all} 0.297188 0.001059 0.236939 0.363530 0.296298 1199.58 1236.90 1.000
pi(T){all} 0.148536 0.000678 0.100978 0.200612 0.147031 997.60 1019.80 1.001
alpha{1,2} 0.422856 0.240358 0.000222 1.362852 0.253647 1414.54 1439.03 1.000
alpha{3} 0.436903 0.217933 0.000281 1.417373 0.289340 1244.60 1342.80 1.000
pinvar{all} 0.991023 0.000132 0.969171 0.999996 0.994734 1220.96 1284.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -249.399801
Model 2: PositiveSelection -249.399752
Model 0: one-ratio -249.39975
Model 7: beta -249.399832
Model 8: beta&w>1 -249.399782
Model 0 vs 1 1.0199999996984843E-4
Model 2 vs 1 9.799999997994746E-5
Model 8 vs 7 1.0000000003174137E-4
>C1
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C2
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C3
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C4
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C5
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C6
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=64
C1 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C2 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C3 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C4 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C5 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C6 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
**************************************************
C1 SANDTQRVNSLLNG
C2 SANDTQRVNSLLNG
C3 SANDTQRVNSLLNG
C4 SANDTQRVNSLLNG
C5 SANDTQRVNSLLNG
C6 SANDTQRVNSLLNG
**************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 64 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 64 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1920]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [1920]--->[1920]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.444 Mb, Max= 30.582 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C2 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C3 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C4 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C5 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
C6 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
**************************************************
C1 SANDTQRVNSLLNG
C2 SANDTQRVNSLLNG
C3 SANDTQRVNSLLNG
C4 SANDTQRVNSLLNG
C5 SANDTQRVNSLLNG
C6 SANDTQRVNSLLNG
**************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
C2 ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
C3 ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
C4 ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
C5 ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
C6 ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
**************************************************
C1 CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
C2 CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
C3 CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
C4 CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
C5 CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
C6 CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
**************************************************
C1 AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
C2 AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
C3 AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
C4 AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
C5 AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
C6 AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
**************************************************
C1 TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
C2 TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
C3 TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
C4 TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
C5 TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
C6 TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
******************************************
>C1
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C2
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C3
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C4
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C5
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C6
ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC
CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG
AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT
TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>C1
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C2
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C3
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C4
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C5
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
>C6
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
SANDTQRVNSLLNG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 192 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791831
Setting output file names to "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1364270936
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0146483075
Seed = 1800838567
Swapseed = 1579791831
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -429.705182 -- -24.965149
Chain 2 -- -429.705141 -- -24.965149
Chain 3 -- -429.705182 -- -24.965149
Chain 4 -- -429.705206 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -429.705141 -- -24.965149
Chain 2 -- -429.705206 -- -24.965149
Chain 3 -- -429.705182 -- -24.965149
Chain 4 -- -429.705206 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-429.705] (-429.705) (-429.705) (-429.705) * [-429.705] (-429.705) (-429.705) (-429.705)
500 -- [-265.712] (-264.740) (-288.256) (-271.905) * (-274.776) (-271.603) [-268.208] (-266.741) -- 0:00:00
1000 -- (-270.227) [-273.920] (-272.685) (-274.640) * (-265.877) [-268.053] (-271.526) (-273.636) -- 0:00:00
1500 -- [-271.027] (-275.568) (-278.255) (-275.390) * (-265.057) [-263.786] (-276.014) (-274.184) -- 0:00:00
2000 -- [-269.456] (-276.912) (-272.226) (-270.750) * (-266.766) (-266.756) [-266.015] (-269.177) -- 0:00:00
2500 -- (-281.408) (-271.274) (-276.619) [-269.315] * (-271.919) (-273.516) [-268.902] (-269.451) -- 0:00:00
3000 -- [-272.035] (-271.911) (-271.038) (-265.747) * (-277.891) [-267.743] (-267.619) (-268.114) -- 0:00:00
3500 -- (-267.478) (-279.089) [-273.178] (-269.761) * (-265.924) (-274.032) [-269.437] (-266.295) -- 0:00:00
4000 -- (-272.534) (-268.609) (-267.989) [-263.810] * [-273.542] (-265.188) (-267.901) (-271.762) -- 0:00:00
4500 -- (-268.511) (-273.401) (-269.223) [-268.006] * [-270.114] (-274.543) (-268.247) (-272.029) -- 0:00:00
5000 -- (-268.256) (-265.426) (-266.590) [-266.426] * (-271.383) [-274.571] (-275.278) (-272.813) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- (-276.942) (-276.388) [-267.042] (-266.995) * (-270.487) (-269.699) (-273.892) [-271.027] -- 0:00:00
6000 -- [-269.219] (-270.935) (-268.510) (-275.000) * (-273.939) (-267.831) (-271.649) [-269.439] -- 0:00:00
6500 -- [-271.169] (-269.061) (-272.289) (-279.514) * (-267.445) [-274.859] (-271.477) (-265.144) -- 0:00:00
7000 -- (-269.219) (-263.840) [-271.725] (-275.265) * (-278.339) (-272.369) [-272.100] (-272.639) -- 0:00:00
7500 -- (-274.452) (-260.521) [-268.263] (-272.824) * (-270.275) (-269.502) [-266.788] (-271.997) -- 0:00:00
8000 -- (-267.655) (-262.866) [-270.644] (-285.572) * (-277.346) (-270.152) (-277.829) [-272.032] -- 0:00:00
8500 -- (-268.618) (-261.609) (-270.416) [-278.488] * (-284.044) (-276.108) (-276.332) [-269.519] -- 0:00:00
9000 -- [-267.671] (-259.721) (-271.038) (-272.554) * [-270.440] (-273.259) (-268.068) (-279.477) -- 0:00:00
9500 -- (-269.189) [-261.674] (-268.671) (-272.417) * [-270.242] (-278.500) (-274.338) (-276.058) -- 0:00:00
10000 -- (-271.659) (-261.284) [-271.290] (-268.281) * (-270.782) (-273.292) [-271.125] (-273.309) -- 0:00:00
Average standard deviation of split frequencies: 0.090493
10500 -- [-269.812] (-261.271) (-274.835) (-259.843) * (-281.526) (-281.882) [-267.438] (-275.800) -- 0:00:00
11000 -- (-269.338) (-261.258) (-275.948) [-259.591] * [-271.100] (-275.051) (-273.463) (-275.287) -- 0:00:00
11500 -- [-269.333] (-260.082) (-269.618) (-265.202) * (-268.298) (-274.800) (-269.896) [-268.092] -- 0:00:00
12000 -- (-269.207) (-269.735) (-264.944) [-260.184] * (-264.147) [-270.122] (-272.883) (-273.098) -- 0:00:00
12500 -- (-272.100) (-260.129) (-259.615) [-259.705] * [-261.537] (-262.286) (-274.229) (-270.983) -- 0:00:00
13000 -- (-278.345) (-259.383) [-261.085] (-260.730) * (-261.112) (-266.063) [-269.447] (-262.440) -- 0:00:00
13500 -- (-275.579) (-263.226) [-261.084] (-262.594) * (-263.679) (-260.695) [-268.550] (-260.705) -- 0:00:00
14000 -- (-276.770) (-263.855) [-259.147] (-262.682) * [-261.847] (-259.524) (-270.849) (-262.474) -- 0:00:00
14500 -- [-262.449] (-259.464) (-262.789) (-263.407) * (-259.382) (-261.934) (-285.175) [-259.589] -- 0:01:07
15000 -- (-263.800) [-260.973] (-261.433) (-262.400) * (-260.759) [-261.908] (-269.916) (-260.835) -- 0:01:05
Average standard deviation of split frequencies: 0.091662
15500 -- (-259.418) (-260.399) (-260.320) [-262.587] * (-264.189) [-259.119] (-263.259) (-264.021) -- 0:01:03
16000 -- (-259.337) (-260.552) (-259.449) [-262.713] * (-259.942) (-260.381) [-275.254] (-259.856) -- 0:01:01
16500 -- (-259.208) (-266.690) [-259.965] (-268.070) * (-263.747) [-260.785] (-266.445) (-260.583) -- 0:00:59
17000 -- (-260.219) (-263.314) [-260.417] (-260.203) * [-262.352] (-263.469) (-270.519) (-259.823) -- 0:00:57
17500 -- (-260.773) [-262.621] (-259.983) (-260.399) * (-261.369) (-260.142) (-267.183) [-260.952] -- 0:00:56
18000 -- (-258.841) (-260.487) [-260.765] (-261.813) * [-261.054] (-259.824) (-274.800) (-259.833) -- 0:00:54
18500 -- (-259.379) (-259.395) (-263.044) [-259.906] * (-259.151) [-259.813] (-273.591) (-260.305) -- 0:00:53
19000 -- (-265.549) [-263.313] (-260.463) (-260.932) * (-262.594) (-259.843) (-273.544) [-261.948] -- 0:00:51
19500 -- (-263.436) [-264.210] (-261.059) (-260.734) * [-265.926] (-260.445) (-270.269) (-261.364) -- 0:00:50
20000 -- (-262.267) (-264.073) (-261.332) [-260.809] * [-259.250] (-260.260) (-273.329) (-261.272) -- 0:00:49
Average standard deviation of split frequencies: 0.076480
20500 -- (-263.276) (-262.602) [-259.885] (-261.101) * (-260.341) (-260.754) (-287.029) [-260.536] -- 0:00:47
21000 -- (-259.646) (-260.082) [-260.818] (-262.689) * [-260.996] (-260.405) (-278.281) (-260.091) -- 0:00:46
21500 -- (-261.733) [-260.545] (-260.053) (-260.726) * (-259.267) [-261.537] (-272.648) (-260.895) -- 0:00:45
22000 -- (-260.852) (-261.405) [-261.263] (-260.914) * (-259.399) [-259.808] (-266.672) (-261.668) -- 0:00:44
22500 -- (-261.120) [-259.835] (-262.272) (-261.670) * [-259.889] (-266.076) (-260.870) (-259.871) -- 0:00:43
23000 -- (-261.902) [-260.583] (-261.799) (-262.713) * [-259.667] (-266.543) (-261.095) (-259.796) -- 0:00:42
23500 -- (-262.656) [-261.054] (-264.315) (-263.597) * (-260.957) (-264.331) (-263.087) [-260.771] -- 0:00:41
24000 -- (-262.853) (-258.920) [-272.467] (-260.445) * (-259.837) (-260.449) [-264.219] (-260.336) -- 0:00:40
24500 -- (-260.831) (-259.821) [-261.086] (-260.350) * (-265.806) (-261.536) (-262.995) [-260.629] -- 0:00:39
25000 -- (-263.693) (-260.510) (-263.391) [-259.546] * (-262.086) [-261.422] (-263.225) (-260.973) -- 0:00:39
Average standard deviation of split frequencies: 0.067344
25500 -- (-265.570) (-261.438) [-263.758] (-260.634) * [-260.701] (-259.656) (-260.663) (-263.998) -- 0:00:38
26000 -- (-264.469) [-261.890] (-264.589) (-261.482) * (-261.137) [-264.070] (-260.466) (-260.884) -- 0:00:37
26500 -- [-262.380] (-261.646) (-264.357) (-259.740) * [-261.528] (-268.172) (-263.312) (-264.533) -- 0:00:36
27000 -- [-263.773] (-261.058) (-263.575) (-259.350) * [-263.386] (-265.117) (-261.436) (-259.632) -- 0:00:36
27500 -- [-259.463] (-262.715) (-260.636) (-260.937) * (-262.276) (-264.493) (-263.097) [-259.262] -- 0:00:35
28000 -- [-259.802] (-261.999) (-261.819) (-260.393) * (-261.355) (-263.091) (-267.090) [-261.870] -- 0:00:34
28500 -- (-260.887) (-265.366) [-260.266] (-261.292) * [-262.714] (-259.471) (-271.311) (-262.213) -- 0:00:34
29000 -- (-260.860) (-260.672) [-261.465] (-265.912) * (-261.107) [-261.119] (-263.473) (-263.406) -- 0:00:33
29500 -- (-259.806) (-262.544) (-260.387) [-262.867] * (-261.991) (-263.649) (-259.967) [-260.599] -- 0:00:32
30000 -- [-259.958] (-260.262) (-261.885) (-259.610) * (-268.828) [-260.698] (-263.633) (-261.801) -- 0:00:32
Average standard deviation of split frequencies: 0.049733
30500 -- (-260.919) [-260.430] (-260.289) (-262.992) * (-267.975) [-259.240] (-262.510) (-260.559) -- 0:00:31
31000 -- (-263.255) (-261.826) (-259.701) [-263.055] * (-263.384) (-259.925) [-264.262] (-261.107) -- 0:00:31
31500 -- (-262.112) [-259.997] (-262.279) (-262.013) * (-264.561) (-261.011) (-262.451) [-259.590] -- 0:01:01
32000 -- (-259.805) (-263.048) [-261.262] (-261.525) * (-266.990) (-260.844) [-263.626] (-260.135) -- 0:01:00
32500 -- (-262.274) (-259.929) [-261.070] (-259.884) * (-262.208) [-259.546] (-264.014) (-260.248) -- 0:00:59
33000 -- [-262.685] (-260.648) (-262.948) (-261.891) * [-265.470] (-263.751) (-263.352) (-261.494) -- 0:00:58
33500 -- (-262.569) (-261.381) [-261.842] (-262.192) * (-261.693) (-261.272) [-259.861] (-260.786) -- 0:00:57
34000 -- (-260.437) (-260.703) [-261.727] (-267.889) * (-259.699) (-259.985) (-262.877) [-260.001] -- 0:00:56
34500 -- (-260.315) (-260.455) [-263.101] (-261.418) * (-263.199) [-260.939] (-261.935) (-263.889) -- 0:00:55
35000 -- (-260.351) (-260.683) [-262.357] (-262.033) * (-263.570) (-261.195) (-266.028) [-265.641] -- 0:00:55
Average standard deviation of split frequencies: 0.042557
35500 -- [-260.935] (-262.412) (-260.651) (-263.614) * (-262.081) [-261.383] (-260.179) (-265.367) -- 0:00:54
36000 -- [-264.503] (-259.391) (-259.732) (-260.772) * [-259.479] (-262.093) (-263.629) (-261.389) -- 0:00:53
36500 -- (-262.153) (-259.662) (-259.582) [-259.328] * [-259.493] (-260.298) (-261.230) (-261.434) -- 0:00:52
37000 -- (-260.476) (-261.073) (-261.118) [-259.098] * (-260.694) [-259.804] (-263.393) (-260.234) -- 0:00:52
37500 -- (-258.936) (-265.770) (-262.961) [-258.963] * (-261.518) [-261.190] (-260.907) (-260.268) -- 0:00:51
38000 -- [-262.214] (-263.833) (-261.423) (-259.248) * (-261.711) (-260.861) [-262.667] (-262.002) -- 0:00:50
38500 -- (-259.570) (-259.626) [-260.593] (-259.271) * (-260.337) (-263.812) (-260.470) [-260.385] -- 0:00:49
39000 -- (-261.628) (-260.432) (-263.563) [-265.255] * (-263.301) (-262.331) (-265.313) [-261.186] -- 0:00:49
39500 -- [-261.358] (-263.748) (-264.433) (-265.759) * [-261.586] (-260.195) (-262.091) (-261.029) -- 0:00:48
40000 -- [-261.145] (-261.731) (-261.790) (-260.542) * (-262.973) [-259.748] (-262.300) (-264.683) -- 0:00:48
Average standard deviation of split frequencies: 0.047527
40500 -- (-260.492) [-264.051] (-263.653) (-259.631) * (-262.100) [-260.475] (-261.497) (-260.841) -- 0:00:47
41000 -- (-258.988) (-261.772) (-264.092) [-260.737] * [-259.433] (-261.252) (-260.504) (-260.020) -- 0:00:46
41500 -- (-262.306) [-259.476] (-260.837) (-259.048) * (-261.118) (-259.534) (-260.355) [-261.673] -- 0:00:46
42000 -- (-263.994) (-260.381) (-263.640) [-259.805] * [-260.737] (-265.189) (-266.543) (-262.316) -- 0:00:45
42500 -- [-259.522] (-261.029) (-262.152) (-260.782) * (-263.244) [-264.316] (-262.966) (-260.556) -- 0:00:45
43000 -- [-261.166] (-262.949) (-260.062) (-260.486) * (-263.286) (-265.478) [-261.738] (-260.404) -- 0:00:44
43500 -- (-260.312) (-262.856) (-260.108) [-261.545] * [-260.820] (-265.559) (-259.144) (-260.522) -- 0:00:43
44000 -- [-260.885] (-262.540) (-264.440) (-260.361) * (-261.366) (-262.608) (-259.937) [-261.005] -- 0:00:43
44500 -- [-259.301] (-261.342) (-261.052) (-259.857) * (-260.575) [-261.626] (-260.377) (-263.258) -- 0:00:42
45000 -- [-259.409] (-262.802) (-260.405) (-259.970) * [-259.949] (-261.245) (-263.107) (-261.658) -- 0:00:42
Average standard deviation of split frequencies: 0.044556
45500 -- (-260.629) [-260.076] (-262.312) (-262.414) * [-259.462] (-261.118) (-260.685) (-262.275) -- 0:00:41
46000 -- (-264.590) (-261.181) (-263.056) [-259.835] * (-262.506) (-262.902) [-262.200] (-261.708) -- 0:00:41
46500 -- (-262.819) (-261.813) [-259.282] (-259.765) * (-261.516) (-263.690) [-260.689] (-262.194) -- 0:01:01
47000 -- (-260.428) (-262.772) [-262.060] (-260.126) * (-262.028) [-261.863] (-261.424) (-268.817) -- 0:01:00
47500 -- (-260.439) (-261.099) [-260.827] (-259.692) * (-264.189) (-260.682) (-261.040) [-267.102] -- 0:01:00
48000 -- (-259.427) (-264.274) (-261.436) [-260.820] * (-265.702) [-259.942] (-262.045) (-261.342) -- 0:00:59
48500 -- (-262.351) [-270.585] (-261.195) (-262.755) * (-262.081) (-262.094) (-260.516) [-261.759] -- 0:00:58
49000 -- [-261.007] (-261.469) (-262.025) (-266.624) * [-260.517] (-259.799) (-260.510) (-259.488) -- 0:00:58
49500 -- (-260.886) [-260.126] (-260.942) (-264.804) * [-261.262] (-262.512) (-261.119) (-260.237) -- 0:00:57
50000 -- (-261.419) (-259.491) [-260.362] (-263.622) * (-259.907) (-260.353) [-259.979] (-263.552) -- 0:00:57
Average standard deviation of split frequencies: 0.042333
50500 -- (-263.067) (-260.022) [-260.837] (-260.333) * (-260.590) [-262.317] (-260.597) (-264.438) -- 0:00:56
51000 -- (-261.033) (-265.984) (-260.032) [-264.152] * (-264.740) (-260.979) (-266.362) [-259.750] -- 0:00:55
51500 -- (-260.412) (-260.813) [-260.257] (-259.338) * (-260.157) (-260.336) (-260.806) [-260.217] -- 0:00:55
52000 -- [-259.799] (-260.283) (-260.551) (-260.888) * (-259.398) (-259.278) (-260.877) [-263.856] -- 0:00:54
52500 -- (-261.619) (-261.535) (-262.187) [-262.190] * [-259.248] (-259.294) (-261.137) (-261.173) -- 0:00:54
53000 -- (-263.290) (-264.907) (-262.201) [-259.287] * (-260.092) [-261.281] (-263.077) (-261.354) -- 0:00:53
53500 -- (-262.248) [-266.207] (-262.548) (-264.260) * [-259.424] (-260.978) (-262.090) (-259.525) -- 0:00:53
54000 -- [-261.026] (-260.373) (-260.942) (-262.223) * (-262.173) [-262.034] (-267.128) (-261.318) -- 0:00:52
54500 -- (-260.821) (-260.881) [-261.179] (-261.307) * (-260.526) (-263.627) [-260.631] (-260.146) -- 0:00:52
55000 -- [-259.847] (-260.428) (-259.295) (-259.813) * (-263.503) [-262.856] (-261.667) (-261.153) -- 0:00:51
Average standard deviation of split frequencies: 0.036879
55500 -- [-259.813] (-260.043) (-261.377) (-263.602) * [-265.741] (-263.473) (-263.530) (-262.321) -- 0:00:51
56000 -- (-259.046) (-261.853) [-259.642] (-260.753) * (-262.185) [-261.693] (-265.185) (-261.432) -- 0:00:50
56500 -- (-260.310) (-259.520) (-260.962) [-259.774] * [-260.959] (-261.113) (-262.155) (-263.688) -- 0:00:50
57000 -- (-262.823) (-263.547) (-262.170) [-261.189] * (-261.150) [-259.396] (-262.735) (-263.138) -- 0:00:49
57500 -- (-263.202) (-260.640) [-263.528] (-261.930) * (-260.508) (-263.581) (-261.195) [-260.564] -- 0:00:49
58000 -- [-261.895] (-259.387) (-262.332) (-261.919) * (-260.083) (-262.749) [-259.919] (-259.605) -- 0:00:48
58500 -- (-259.993) (-260.005) [-260.678] (-263.191) * (-261.055) (-260.796) [-259.637] (-261.904) -- 0:00:48
59000 -- (-260.657) (-259.009) [-260.641] (-265.276) * (-260.394) (-261.655) (-260.877) [-264.951] -- 0:00:47
59500 -- [-261.213] (-260.069) (-263.939) (-265.327) * (-261.578) [-260.479] (-260.363) (-264.935) -- 0:00:47
60000 -- [-263.256] (-261.886) (-261.360) (-261.654) * (-263.394) (-259.461) (-260.434) [-263.967] -- 0:00:47
Average standard deviation of split frequencies: 0.030673
60500 -- (-261.532) (-265.476) [-259.801] (-260.221) * (-261.271) (-263.080) [-261.571] (-261.310) -- 0:00:46
61000 -- [-259.821] (-263.600) (-260.255) (-260.820) * (-262.466) (-263.911) (-259.437) [-262.926] -- 0:00:46
61500 -- (-265.374) (-260.715) (-260.534) [-261.448] * (-262.545) [-258.947] (-264.984) (-262.298) -- 0:00:45
62000 -- [-259.512] (-263.576) (-259.750) (-260.102) * (-262.316) (-263.483) [-259.509] (-265.402) -- 0:01:00
62500 -- (-259.216) (-265.472) (-262.544) [-260.018] * [-260.497] (-261.019) (-261.642) (-262.172) -- 0:01:00
63000 -- (-261.246) (-260.730) [-260.403] (-261.388) * (-262.777) [-263.672] (-261.520) (-264.495) -- 0:00:59
63500 -- [-259.514] (-261.206) (-260.421) (-262.393) * [-261.014] (-262.890) (-264.260) (-263.683) -- 0:00:58
64000 -- (-259.545) (-262.092) (-261.583) [-261.138] * (-262.456) (-263.885) [-263.683] (-265.267) -- 0:00:58
64500 -- (-266.742) (-260.170) (-259.125) [-261.377] * (-260.219) [-261.497] (-263.669) (-261.740) -- 0:00:58
65000 -- (-259.558) (-261.919) [-262.553] (-265.616) * (-261.501) (-260.331) [-260.070] (-266.398) -- 0:00:57
Average standard deviation of split frequencies: 0.027596
65500 -- [-259.200] (-260.663) (-262.753) (-262.221) * (-264.044) [-262.666] (-262.793) (-260.280) -- 0:00:57
66000 -- [-259.870] (-263.128) (-261.345) (-260.812) * [-261.482] (-269.911) (-260.136) (-260.538) -- 0:00:56
66500 -- (-260.700) (-260.209) (-261.151) [-259.651] * (-261.954) (-263.920) [-261.194] (-266.258) -- 0:00:56
67000 -- [-259.444] (-261.350) (-260.899) (-259.743) * [-265.339] (-265.841) (-262.070) (-261.739) -- 0:00:55
67500 -- (-259.256) [-259.849] (-265.615) (-261.929) * (-263.626) [-263.138] (-259.332) (-261.205) -- 0:00:55
68000 -- (-263.725) (-263.622) (-268.055) [-261.282] * (-263.724) (-262.465) (-262.366) [-259.349] -- 0:00:54
68500 -- (-268.777) (-262.608) (-264.725) [-259.969] * (-261.346) (-260.292) [-261.553] (-259.514) -- 0:00:54
69000 -- (-265.787) (-263.211) [-261.901] (-259.362) * (-262.076) (-261.342) [-261.907] (-260.216) -- 0:00:53
69500 -- (-263.608) (-260.375) [-259.721] (-262.332) * (-263.695) (-261.147) [-264.683] (-261.789) -- 0:00:53
70000 -- (-261.358) [-259.000] (-260.741) (-259.845) * (-265.859) (-259.127) [-261.337] (-260.731) -- 0:00:53
Average standard deviation of split frequencies: 0.027636
70500 -- [-262.312] (-260.384) (-263.136) (-261.067) * (-259.632) (-259.920) (-266.280) [-259.585] -- 0:00:52
71000 -- (-264.235) (-262.099) (-261.206) [-262.534] * (-260.115) (-261.394) (-263.860) [-259.743] -- 0:00:52
71500 -- (-260.533) [-260.762] (-265.304) (-262.140) * (-259.665) (-263.891) [-262.534] (-259.993) -- 0:00:51
72000 -- (-265.406) (-260.881) (-259.787) [-261.077] * (-261.365) [-261.192] (-262.296) (-261.937) -- 0:00:51
72500 -- [-260.738] (-259.380) (-263.277) (-260.792) * (-261.206) (-260.664) (-263.090) [-260.994] -- 0:00:51
73000 -- (-261.697) [-263.998] (-263.310) (-261.932) * (-260.385) (-263.825) [-262.818] (-259.343) -- 0:00:50
73500 -- (-260.749) (-259.655) [-260.161] (-260.862) * (-261.310) [-262.082] (-265.641) (-259.549) -- 0:00:50
74000 -- (-260.830) (-260.620) [-263.313] (-260.907) * (-262.377) (-261.100) [-260.326] (-259.723) -- 0:00:50
74500 -- [-260.067] (-260.029) (-266.470) (-262.397) * (-263.332) [-260.968] (-260.540) (-263.725) -- 0:00:49
75000 -- (-262.785) [-259.849] (-262.230) (-261.695) * [-261.592] (-261.002) (-259.946) (-260.895) -- 0:00:49
Average standard deviation of split frequencies: 0.023880
75500 -- (-269.970) (-262.859) (-259.380) [-260.128] * [-260.426] (-266.166) (-260.421) (-260.962) -- 0:00:48
76000 -- (-262.157) (-263.935) (-264.375) [-263.012] * (-260.292) (-261.850) [-261.668] (-261.283) -- 0:00:48
76500 -- (-259.546) (-264.669) (-263.951) [-263.742] * [-263.181] (-260.850) (-260.178) (-259.995) -- 0:00:48
77000 -- (-261.737) (-260.101) (-264.223) [-260.311] * (-261.100) (-260.493) [-260.225] (-263.600) -- 0:00:59
77500 -- [-261.140] (-259.690) (-260.589) (-271.535) * [-261.123] (-260.886) (-260.647) (-260.762) -- 0:00:59
78000 -- [-259.824] (-260.643) (-261.271) (-262.201) * (-259.886) (-260.704) [-259.164] (-260.825) -- 0:00:59
78500 -- (-260.767) (-259.756) [-261.177] (-260.987) * (-261.513) (-260.411) (-259.390) [-260.506] -- 0:00:58
79000 -- (-260.012) (-261.293) [-260.605] (-261.330) * [-260.777] (-260.830) (-262.929) (-260.195) -- 0:00:58
79500 -- [-260.320] (-262.579) (-261.493) (-262.751) * (-261.272) [-261.400] (-261.533) (-260.162) -- 0:00:57
80000 -- (-264.025) (-263.723) (-261.759) [-263.729] * (-261.003) (-264.603) [-262.916] (-259.970) -- 0:00:57
Average standard deviation of split frequencies: 0.024836
80500 -- [-260.881] (-262.776) (-261.544) (-262.810) * (-262.333) (-265.971) [-263.236] (-260.781) -- 0:00:57
81000 -- (-260.728) (-262.129) [-260.974] (-263.861) * (-261.104) [-260.593] (-260.910) (-265.599) -- 0:00:56
81500 -- (-261.244) (-259.339) [-260.660] (-261.210) * (-260.283) (-260.665) (-261.269) [-262.888] -- 0:00:56
82000 -- [-261.996] (-263.761) (-261.812) (-261.897) * (-260.409) (-259.671) [-260.479] (-263.503) -- 0:00:55
82500 -- (-262.421) [-263.814] (-259.460) (-261.114) * (-263.378) (-259.914) [-260.878] (-262.508) -- 0:00:55
83000 -- (-261.827) (-261.212) [-263.771] (-261.317) * (-263.836) (-260.193) [-261.782] (-261.635) -- 0:00:55
83500 -- [-263.268] (-261.477) (-260.114) (-264.353) * [-261.757] (-261.612) (-261.594) (-260.350) -- 0:00:54
84000 -- (-259.772) [-260.320] (-261.372) (-263.710) * (-260.176) (-261.865) [-260.968] (-263.652) -- 0:00:54
84500 -- (-261.577) (-260.085) [-260.991] (-263.109) * (-258.943) (-260.669) [-260.361] (-259.286) -- 0:00:54
85000 -- (-262.127) (-261.513) [-261.501] (-261.336) * (-260.172) (-264.455) [-260.285] (-259.904) -- 0:00:53
Average standard deviation of split frequencies: 0.024275
85500 -- [-261.064] (-264.658) (-262.016) (-262.795) * (-261.417) [-262.017] (-262.710) (-259.256) -- 0:00:53
86000 -- [-260.301] (-259.922) (-259.216) (-260.858) * (-262.716) [-259.377] (-260.495) (-260.482) -- 0:00:53
86500 -- (-260.819) [-261.944] (-266.906) (-260.578) * (-262.588) [-260.821] (-261.201) (-260.061) -- 0:00:52
87000 -- [-261.013] (-262.082) (-268.121) (-265.300) * (-262.691) (-262.070) (-261.865) [-262.972] -- 0:00:52
87500 -- (-263.832) [-260.548] (-260.029) (-268.481) * [-263.110] (-265.858) (-261.834) (-262.064) -- 0:00:52
88000 -- [-260.750] (-260.252) (-260.099) (-267.975) * (-261.843) (-263.042) (-259.767) [-263.318] -- 0:00:51
88500 -- (-260.145) [-264.247] (-268.337) (-261.208) * [-260.399] (-262.876) (-261.275) (-261.805) -- 0:00:51
89000 -- (-259.516) (-259.845) (-261.437) [-259.413] * (-262.796) (-263.032) [-261.617] (-260.386) -- 0:00:51
89500 -- (-260.467) [-260.862] (-262.360) (-259.873) * (-265.858) [-259.957] (-264.972) (-259.447) -- 0:00:50
90000 -- (-260.165) (-263.998) (-260.912) [-260.053] * (-259.834) (-260.435) (-260.494) [-260.442] -- 0:00:50
Average standard deviation of split frequencies: 0.023137
90500 -- (-261.130) [-261.006] (-260.640) (-262.068) * [-263.138] (-260.600) (-261.486) (-263.717) -- 0:00:50
91000 -- [-260.709] (-260.892) (-259.470) (-268.036) * [-261.163] (-262.887) (-262.324) (-260.147) -- 0:00:49
91500 -- (-260.773) [-262.663] (-262.431) (-264.224) * [-263.007] (-259.701) (-259.832) (-264.918) -- 0:00:49
92000 -- (-267.629) [-268.448] (-260.851) (-261.706) * (-261.440) (-261.421) [-261.604] (-259.911) -- 0:00:59
92500 -- (-260.110) (-260.046) [-260.058] (-262.683) * (-263.502) [-259.636] (-262.000) (-261.125) -- 0:00:58
93000 -- (-260.429) [-263.673] (-260.009) (-260.978) * (-262.007) [-259.923] (-262.213) (-262.075) -- 0:00:58
93500 -- (-261.952) [-260.290] (-262.239) (-262.209) * (-260.803) (-263.894) (-259.468) [-261.361] -- 0:00:58
94000 -- (-260.360) [-261.032] (-260.502) (-260.042) * [-260.669] (-261.203) (-260.685) (-259.578) -- 0:00:57
94500 -- [-260.514] (-260.213) (-261.047) (-261.679) * [-259.792] (-263.215) (-261.713) (-262.656) -- 0:00:57
95000 -- (-259.919) (-260.757) [-261.078] (-261.603) * (-259.656) (-261.048) [-262.558] (-262.807) -- 0:00:57
Average standard deviation of split frequencies: 0.021361
95500 -- (-259.618) (-259.817) (-263.387) [-259.931] * [-259.732] (-266.788) (-260.585) (-261.652) -- 0:00:56
96000 -- [-259.646] (-260.097) (-261.264) (-260.560) * (-262.311) (-262.386) [-259.787] (-260.751) -- 0:00:56
96500 -- (-260.871) (-261.029) [-263.056] (-261.860) * (-264.332) [-261.747] (-263.042) (-265.008) -- 0:00:56
97000 -- (-261.412) (-260.478) (-260.685) [-261.421] * (-261.682) [-260.242] (-264.783) (-263.164) -- 0:00:55
97500 -- (-261.593) [-259.665] (-260.781) (-262.210) * (-261.351) (-264.454) (-261.734) [-263.868] -- 0:00:55
98000 -- [-266.364] (-261.469) (-261.996) (-262.871) * [-261.812] (-259.776) (-260.440) (-262.998) -- 0:00:55
98500 -- (-263.144) (-259.462) (-259.768) [-259.308] * [-261.217] (-259.142) (-259.349) (-261.360) -- 0:00:54
99000 -- (-263.955) (-260.225) [-259.774] (-266.253) * (-261.775) [-260.686] (-260.571) (-261.270) -- 0:00:54
99500 -- (-263.841) (-260.392) [-260.281] (-259.335) * [-265.559] (-261.835) (-259.863) (-261.630) -- 0:00:54
100000 -- (-261.604) [-260.080] (-264.441) (-260.648) * (-261.790) (-262.012) (-262.730) [-263.502] -- 0:00:54
Average standard deviation of split frequencies: 0.019772
100500 -- [-262.718] (-261.521) (-262.579) (-261.235) * [-260.461] (-261.422) (-261.016) (-263.321) -- 0:00:53
101000 -- (-259.449) (-260.812) [-262.336] (-259.593) * (-263.828) [-260.950] (-261.461) (-266.174) -- 0:00:53
101500 -- [-259.999] (-265.851) (-260.395) (-261.511) * (-263.346) (-259.588) (-262.027) [-260.248] -- 0:00:53
102000 -- (-262.598) [-260.957] (-261.085) (-266.546) * (-262.418) (-260.345) (-260.479) [-261.042] -- 0:00:52
102500 -- (-260.969) (-260.432) (-260.651) [-260.763] * (-261.570) (-261.196) (-261.854) [-265.076] -- 0:00:52
103000 -- (-261.065) (-261.053) (-262.590) [-262.565] * (-259.913) [-262.516] (-261.121) (-262.742) -- 0:00:52
103500 -- (-261.418) (-261.078) [-260.243] (-259.681) * (-264.375) (-261.153) (-263.950) [-261.761] -- 0:00:51
104000 -- (-261.990) (-260.219) (-261.305) [-259.883] * (-264.785) [-263.026] (-260.863) (-260.434) -- 0:00:51
104500 -- [-260.003] (-262.449) (-263.477) (-263.729) * (-259.622) (-268.423) (-262.834) [-260.640] -- 0:00:51
105000 -- (-262.107) [-260.073] (-262.593) (-263.403) * [-261.462] (-263.945) (-264.567) (-267.207) -- 0:00:51
Average standard deviation of split frequencies: 0.018530
105500 -- (-262.312) (-261.714) [-262.141] (-261.024) * (-260.418) (-265.485) (-260.695) [-262.304] -- 0:00:59
106000 -- (-262.784) (-263.090) (-259.857) [-260.535] * (-260.889) (-262.929) [-261.055] (-262.845) -- 0:00:59
106500 -- (-261.141) [-260.001] (-261.974) (-260.295) * [-259.313] (-261.180) (-259.837) (-266.579) -- 0:00:58
107000 -- [-261.710] (-259.475) (-261.618) (-263.097) * (-261.549) [-261.087] (-260.928) (-262.715) -- 0:00:58
107500 -- (-262.776) (-260.715) [-264.471] (-259.912) * (-260.298) (-260.559) [-263.683] (-265.028) -- 0:00:58
108000 -- (-260.244) (-261.170) [-260.984] (-261.197) * (-262.701) (-262.251) [-262.826] (-270.018) -- 0:00:57
108500 -- (-262.391) [-259.977] (-261.569) (-259.765) * (-271.104) [-260.705] (-260.727) (-263.481) -- 0:00:57
109000 -- (-263.641) [-261.496] (-261.949) (-259.187) * (-261.758) (-259.660) [-261.606] (-260.531) -- 0:00:57
109500 -- (-266.484) (-260.355) (-261.963) [-259.165] * (-266.290) (-260.408) [-260.906] (-260.264) -- 0:00:56
110000 -- (-261.221) (-261.397) (-263.616) [-265.472] * [-263.693] (-262.967) (-260.019) (-260.053) -- 0:00:56
Average standard deviation of split frequencies: 0.018832
110500 -- (-263.433) [-260.944] (-261.321) (-264.341) * (-271.322) (-263.431) (-261.047) [-260.340] -- 0:00:56
111000 -- (-259.111) [-260.292] (-263.273) (-261.607) * (-262.297) [-262.514] (-260.539) (-259.529) -- 0:00:56
111500 -- [-260.538] (-261.957) (-261.554) (-261.524) * (-262.123) [-262.013] (-260.779) (-260.868) -- 0:00:55
112000 -- (-262.036) (-261.393) [-260.758] (-260.089) * [-260.261] (-260.165) (-262.229) (-262.102) -- 0:00:55
112500 -- (-262.810) (-261.482) (-263.643) [-259.877] * [-259.853] (-259.725) (-260.757) (-259.523) -- 0:00:55
113000 -- [-261.165] (-260.411) (-262.199) (-262.778) * (-261.356) [-261.177] (-259.751) (-261.257) -- 0:00:54
113500 -- (-264.281) [-259.864] (-262.620) (-266.846) * (-259.991) [-260.489] (-259.240) (-263.321) -- 0:00:54
114000 -- (-260.191) [-260.713] (-261.459) (-261.194) * (-259.630) (-263.417) (-262.254) [-259.771] -- 0:00:54
114500 -- [-259.457] (-267.483) (-260.836) (-263.989) * (-261.001) [-261.259] (-261.271) (-263.893) -- 0:00:54
115000 -- (-259.995) (-267.061) [-261.711] (-260.216) * (-259.766) (-263.704) (-259.861) [-263.253] -- 0:00:53
Average standard deviation of split frequencies: 0.021175
115500 -- (-263.526) (-263.419) [-259.724] (-260.669) * (-261.610) [-261.272] (-261.337) (-260.817) -- 0:00:53
116000 -- [-259.409] (-260.234) (-262.858) (-262.745) * (-261.531) [-259.918] (-261.031) (-262.339) -- 0:00:53
116500 -- [-260.628] (-259.745) (-262.480) (-259.978) * [-261.900] (-261.110) (-262.168) (-261.664) -- 0:00:53
117000 -- (-261.424) [-260.336] (-261.331) (-260.953) * [-259.830] (-263.597) (-263.761) (-263.009) -- 0:00:52
117500 -- [-262.887] (-267.055) (-265.028) (-268.048) * (-259.884) (-263.712) [-259.640] (-262.127) -- 0:00:52
118000 -- (-261.669) [-265.004] (-262.366) (-261.094) * (-261.465) [-267.656] (-259.972) (-262.276) -- 0:00:52
118500 -- (-260.579) [-259.083] (-262.615) (-261.335) * (-259.630) (-262.223) [-261.562] (-265.542) -- 0:00:52
119000 -- (-261.525) [-262.123] (-263.665) (-262.706) * [-264.500] (-264.659) (-262.746) (-262.689) -- 0:00:51
119500 -- (-261.794) [-260.362] (-261.613) (-262.076) * (-260.764) [-264.181] (-262.852) (-259.385) -- 0:00:58
120000 -- (-260.148) [-261.491] (-264.589) (-261.102) * (-261.222) (-260.473) [-261.895] (-261.337) -- 0:00:58
Average standard deviation of split frequencies: 0.022618
120500 -- [-259.885] (-260.596) (-264.246) (-263.180) * (-261.852) (-261.671) (-265.587) [-259.270] -- 0:00:58
121000 -- (-260.737) (-259.728) (-264.628) [-258.900] * (-259.908) [-262.264] (-260.669) (-262.260) -- 0:00:58
121500 -- (-262.269) [-262.899] (-262.917) (-263.511) * (-259.603) [-262.291] (-264.183) (-259.851) -- 0:00:57
122000 -- [-260.676] (-262.793) (-263.252) (-260.799) * (-259.527) (-260.482) (-260.214) [-264.237] -- 0:00:57
122500 -- (-261.204) (-263.380) [-259.807] (-264.802) * [-259.603] (-260.995) (-262.166) (-260.507) -- 0:00:57
123000 -- [-259.232] (-259.806) (-259.650) (-262.879) * (-260.092) (-259.736) (-263.436) [-260.672] -- 0:00:57
123500 -- (-259.714) (-260.744) [-261.115] (-260.643) * (-262.791) [-259.440] (-263.141) (-260.695) -- 0:00:56
124000 -- (-259.488) (-265.851) [-264.040] (-259.502) * (-263.327) (-259.562) (-260.115) [-259.518] -- 0:00:56
124500 -- [-260.588] (-265.991) (-263.253) (-259.458) * (-264.043) (-260.511) (-262.455) [-261.326] -- 0:00:56
125000 -- (-261.102) [-265.212] (-263.156) (-261.130) * [-262.241] (-260.052) (-260.407) (-262.261) -- 0:00:56
Average standard deviation of split frequencies: 0.024023
125500 -- [-261.413] (-260.615) (-259.431) (-263.668) * (-263.028) (-261.438) (-265.287) [-262.465] -- 0:00:55
126000 -- (-258.901) (-260.749) (-262.396) [-260.882] * (-263.623) (-261.653) [-267.632] (-261.838) -- 0:00:55
126500 -- [-258.901] (-259.498) (-259.304) (-261.617) * (-262.348) [-264.419] (-266.638) (-263.167) -- 0:00:55
127000 -- (-261.541) (-260.341) [-263.605] (-261.197) * (-264.728) (-262.186) [-265.145] (-265.702) -- 0:00:54
127500 -- (-261.156) (-261.987) (-265.422) [-262.481] * [-261.342] (-262.752) (-260.715) (-268.082) -- 0:00:54
128000 -- [-260.711] (-261.404) (-263.386) (-261.739) * (-260.814) (-263.439) (-259.440) [-263.424] -- 0:00:54
128500 -- (-260.394) [-259.559] (-262.956) (-263.985) * (-263.502) [-261.067] (-260.780) (-261.736) -- 0:00:54
129000 -- (-261.890) (-259.634) (-262.642) [-259.751] * [-261.032] (-267.614) (-261.163) (-265.391) -- 0:00:54
129500 -- (-259.010) (-259.798) [-260.141] (-262.292) * (-259.818) (-259.017) (-260.388) [-263.605] -- 0:00:53
130000 -- (-260.548) [-259.523] (-261.350) (-265.205) * (-262.082) [-261.841] (-263.663) (-263.119) -- 0:00:53
Average standard deviation of split frequencies: 0.019842
130500 -- (-265.224) [-260.941] (-261.240) (-263.213) * [-261.774] (-263.235) (-261.590) (-260.620) -- 0:00:53
131000 -- (-261.876) (-259.384) (-264.947) [-260.986] * (-260.526) (-263.871) (-264.691) [-260.714] -- 0:00:53
131500 -- (-262.892) (-263.055) (-262.644) [-263.238] * (-260.735) (-265.058) [-260.198] (-261.213) -- 0:00:52
132000 -- [-266.820] (-261.137) (-261.764) (-261.424) * (-263.775) (-264.897) [-262.046] (-260.522) -- 0:00:59
132500 -- (-265.574) (-259.157) (-260.451) [-261.394] * [-259.438] (-264.242) (-261.820) (-260.144) -- 0:00:58
133000 -- (-264.869) (-263.095) (-260.200) [-261.916] * (-259.415) (-260.953) (-259.548) [-261.158] -- 0:00:58
133500 -- (-265.997) [-260.106] (-259.460) (-260.081) * [-259.585] (-261.034) (-262.682) (-260.349) -- 0:00:58
134000 -- (-266.684) [-262.885] (-259.824) (-259.246) * [-262.593] (-261.716) (-260.126) (-261.928) -- 0:00:58
134500 -- (-262.731) (-261.360) (-262.149) [-260.129] * (-259.957) [-266.062] (-260.413) (-261.465) -- 0:00:57
135000 -- (-261.070) (-260.909) [-259.881] (-260.257) * (-260.635) [-261.717] (-261.294) (-259.772) -- 0:00:57
Average standard deviation of split frequencies: 0.020104
135500 -- [-260.889] (-261.138) (-261.788) (-260.417) * [-260.327] (-260.312) (-260.415) (-261.473) -- 0:00:57
136000 -- [-259.407] (-259.864) (-263.494) (-262.270) * [-261.488] (-262.219) (-259.780) (-262.084) -- 0:00:57
136500 -- (-259.434) (-261.699) (-261.786) [-259.989] * (-259.676) [-259.858] (-260.623) (-263.482) -- 0:00:56
137000 -- (-260.429) [-260.903] (-261.615) (-265.302) * (-261.020) (-259.851) (-263.121) [-260.908] -- 0:00:56
137500 -- (-263.362) [-259.377] (-263.967) (-262.258) * (-261.337) (-260.353) [-263.766] (-260.161) -- 0:00:56
138000 -- [-261.617] (-261.161) (-261.478) (-260.234) * (-261.086) (-260.159) [-266.955] (-260.915) -- 0:00:56
138500 -- (-263.317) [-262.031] (-262.679) (-259.029) * (-262.931) (-261.599) (-261.212) [-261.280] -- 0:00:55
139000 -- (-261.279) [-263.163] (-259.165) (-259.905) * [-259.583] (-262.132) (-262.125) (-260.399) -- 0:00:55
139500 -- [-260.782] (-262.630) (-260.506) (-259.355) * (-260.947) (-259.813) [-260.857] (-259.025) -- 0:00:55
140000 -- (-260.137) (-259.795) (-259.831) [-259.756] * (-265.381) (-260.349) (-259.918) [-259.226] -- 0:00:55
Average standard deviation of split frequencies: 0.020293
140500 -- (-259.729) (-261.480) [-261.614] (-259.990) * (-263.366) (-260.913) [-264.214] (-261.378) -- 0:00:55
141000 -- (-259.794) (-261.372) [-261.887] (-261.661) * (-260.853) (-264.163) (-262.290) [-260.867] -- 0:00:54
141500 -- (-262.071) [-260.397] (-265.367) (-260.510) * [-262.865] (-260.604) (-263.123) (-260.475) -- 0:00:54
142000 -- [-260.302] (-260.013) (-261.085) (-261.127) * (-263.402) (-260.656) (-261.669) [-262.514] -- 0:00:54
142500 -- [-259.191] (-259.782) (-261.112) (-264.166) * [-261.527] (-261.152) (-265.817) (-261.800) -- 0:00:54
143000 -- (-260.575) [-262.627] (-262.059) (-259.998) * (-259.311) (-263.295) (-260.437) [-261.963] -- 0:00:53
143500 -- (-260.111) (-262.508) [-262.703] (-260.419) * [-259.340] (-260.844) (-262.167) (-261.902) -- 0:00:53
144000 -- (-260.161) (-263.224) [-259.269] (-261.962) * [-259.440] (-260.859) (-259.900) (-261.227) -- 0:00:53
144500 -- [-259.953] (-261.077) (-261.967) (-263.090) * (-261.606) (-263.867) [-261.390] (-261.404) -- 0:00:59
145000 -- (-259.543) [-263.869] (-259.602) (-265.371) * (-264.500) (-262.097) [-262.472] (-260.049) -- 0:00:58
Average standard deviation of split frequencies: 0.021794
145500 -- (-260.237) (-267.987) [-259.433] (-263.450) * (-265.114) (-261.946) (-265.828) [-262.568] -- 0:00:58
146000 -- (-262.103) (-263.652) [-263.888] (-259.157) * [-263.016] (-259.521) (-260.685) (-261.122) -- 0:00:58
146500 -- (-261.964) (-263.638) [-260.060] (-260.119) * [-262.683] (-264.119) (-260.040) (-260.349) -- 0:00:58
147000 -- [-271.549] (-262.582) (-261.168) (-261.133) * (-259.752) (-263.655) [-261.104] (-260.695) -- 0:00:58
147500 -- (-262.699) (-261.009) (-261.853) [-263.257] * (-261.450) [-261.241] (-260.497) (-262.380) -- 0:00:57
148000 -- [-260.693] (-262.595) (-260.292) (-260.674) * (-260.675) (-267.476) [-261.716] (-259.519) -- 0:00:57
148500 -- (-264.701) (-261.311) [-262.014] (-262.264) * [-260.169] (-260.185) (-260.323) (-259.547) -- 0:00:57
149000 -- (-259.312) (-260.606) (-260.699) [-261.595] * (-260.024) (-261.192) (-259.689) [-263.282] -- 0:00:57
149500 -- [-260.372] (-260.209) (-261.082) (-260.975) * [-259.307] (-262.651) (-260.504) (-260.322) -- 0:00:56
150000 -- (-261.202) (-260.429) (-260.968) [-262.579] * [-259.884] (-259.702) (-259.777) (-262.675) -- 0:00:56
Average standard deviation of split frequencies: 0.019868
150500 -- [-261.867] (-261.105) (-261.414) (-264.984) * (-261.800) [-260.714] (-260.966) (-261.907) -- 0:00:56
151000 -- (-260.574) (-260.054) [-266.663] (-261.667) * (-264.148) (-263.168) [-262.897] (-260.740) -- 0:00:56
151500 -- (-261.235) [-262.859] (-259.814) (-263.030) * (-260.933) (-261.111) [-261.108] (-262.152) -- 0:00:56
152000 -- (-260.432) (-260.506) (-265.015) [-259.836] * (-260.995) (-261.975) [-261.726] (-264.211) -- 0:00:55
152500 -- (-263.337) (-263.340) [-260.719] (-260.114) * [-261.829] (-262.945) (-263.785) (-262.000) -- 0:00:55
153000 -- (-263.774) (-262.838) (-260.725) [-260.773] * [-261.088] (-261.906) (-260.626) (-260.091) -- 0:00:55
153500 -- (-259.956) [-262.036] (-260.450) (-260.637) * (-262.909) [-262.744] (-259.466) (-264.926) -- 0:00:55
154000 -- (-261.846) (-259.033) [-262.365] (-260.956) * (-260.564) [-259.805] (-260.814) (-261.582) -- 0:00:54
154500 -- (-261.313) (-260.322) (-264.092) [-260.751] * (-261.772) [-263.321] (-259.984) (-263.972) -- 0:00:54
155000 -- (-260.044) (-263.526) (-260.101) [-260.140] * (-260.978) (-262.456) [-262.089] (-264.055) -- 0:00:54
Average standard deviation of split frequencies: 0.018608
155500 -- [-259.451] (-259.065) (-259.619) (-260.737) * [-260.825] (-261.411) (-261.887) (-260.551) -- 0:00:54
156000 -- (-262.678) [-259.682] (-259.095) (-264.121) * (-260.659) [-261.039] (-261.454) (-260.123) -- 0:00:54
156500 -- (-260.669) (-261.844) [-261.789] (-263.763) * (-261.517) (-261.116) (-262.181) [-260.463] -- 0:00:53
157000 -- (-261.090) (-260.072) (-259.534) [-260.025] * (-260.349) (-259.814) (-261.225) [-260.249] -- 0:00:59
157500 -- (-262.548) (-264.058) [-259.561] (-264.354) * (-261.437) [-261.239] (-259.324) (-262.364) -- 0:00:58
158000 -- (-261.036) [-262.564] (-260.837) (-261.778) * (-259.325) (-260.301) (-262.054) [-261.656] -- 0:00:58
158500 -- (-262.669) (-260.186) (-260.911) [-263.760] * [-262.351] (-264.357) (-260.466) (-260.421) -- 0:00:58
159000 -- (-260.548) [-261.326] (-260.269) (-260.756) * [-261.656] (-260.731) (-261.182) (-259.965) -- 0:00:58
159500 -- [-262.687] (-260.861) (-262.787) (-262.428) * (-260.890) (-260.479) [-259.739] (-264.038) -- 0:00:57
160000 -- (-259.443) (-260.545) (-262.726) [-260.317] * [-262.276] (-259.797) (-259.989) (-262.875) -- 0:00:57
Average standard deviation of split frequencies: 0.020538
160500 -- [-261.224] (-259.396) (-260.081) (-266.196) * (-265.222) [-260.116] (-260.750) (-260.999) -- 0:00:57
161000 -- (-260.615) (-260.324) [-259.651] (-264.982) * (-265.543) (-261.455) (-263.761) [-260.924] -- 0:00:57
161500 -- [-260.067] (-260.185) (-261.561) (-262.474) * [-261.149] (-260.459) (-260.509) (-259.675) -- 0:00:57
162000 -- (-263.705) [-259.227] (-262.084) (-262.203) * (-261.644) (-261.860) [-260.610] (-260.861) -- 0:00:56
162500 -- (-261.005) [-262.521] (-259.324) (-263.904) * [-260.812] (-261.776) (-264.075) (-259.953) -- 0:00:56
163000 -- (-260.679) (-260.001) [-262.175] (-262.457) * [-259.283] (-259.478) (-261.607) (-259.913) -- 0:00:56
163500 -- [-259.707] (-261.005) (-262.430) (-262.904) * [-263.718] (-264.523) (-260.419) (-263.514) -- 0:00:56
164000 -- (-260.517) [-263.000] (-262.905) (-268.442) * (-263.416) (-260.625) [-260.842] (-260.711) -- 0:00:56
164500 -- (-260.689) [-260.055] (-261.451) (-261.503) * (-264.306) (-259.192) (-262.364) [-259.988] -- 0:00:55
165000 -- (-260.404) (-262.706) [-260.270] (-265.840) * (-265.519) [-259.839] (-265.769) (-259.661) -- 0:00:55
Average standard deviation of split frequencies: 0.020626
165500 -- (-262.016) [-264.129] (-260.557) (-262.059) * [-261.331] (-262.850) (-261.545) (-261.651) -- 0:00:55
166000 -- (-259.703) (-264.413) [-259.904] (-260.562) * (-260.405) (-259.724) [-260.788] (-261.860) -- 0:00:55
166500 -- (-261.984) (-260.310) [-264.341] (-260.141) * [-261.635] (-261.343) (-260.943) (-261.056) -- 0:00:55
167000 -- [-261.078] (-266.904) (-264.029) (-259.134) * (-261.775) (-259.358) [-261.328] (-265.723) -- 0:00:54
167500 -- (-261.385) (-262.337) (-259.401) [-259.620] * (-260.390) (-259.788) (-265.779) [-262.099] -- 0:00:54
168000 -- (-260.170) (-261.157) [-260.032] (-264.090) * [-263.866] (-260.352) (-263.346) (-260.422) -- 0:00:54
168500 -- (-260.648) [-261.286] (-265.272) (-260.013) * (-259.947) (-259.814) (-258.898) [-262.536] -- 0:00:54
169000 -- (-262.395) [-259.031] (-262.689) (-261.323) * (-259.088) [-263.945] (-262.283) (-264.898) -- 0:00:54
169500 -- (-264.721) (-260.851) [-260.170] (-260.931) * (-262.543) (-264.123) (-259.665) [-260.979] -- 0:00:53
170000 -- (-262.620) (-260.672) [-264.642] (-260.012) * (-261.386) [-260.928] (-259.823) (-261.630) -- 0:00:53
Average standard deviation of split frequencies: 0.020062
170500 -- (-260.357) [-261.293] (-266.682) (-263.060) * (-262.004) (-260.334) [-260.857] (-260.369) -- 0:00:53
171000 -- [-261.815] (-261.622) (-261.388) (-262.031) * [-263.011] (-261.715) (-262.564) (-261.796) -- 0:00:53
171500 -- (-266.291) (-262.075) [-262.187] (-260.997) * (-259.871) [-260.616] (-260.045) (-260.738) -- 0:00:53
172000 -- [-263.579] (-261.948) (-261.762) (-264.904) * (-259.651) (-261.557) (-259.559) [-260.374] -- 0:00:57
172500 -- (-265.922) [-261.025] (-261.050) (-261.355) * [-259.894] (-264.280) (-261.149) (-264.064) -- 0:00:57
173000 -- (-261.902) (-262.735) (-261.344) [-262.951] * (-264.580) [-260.744] (-264.680) (-264.290) -- 0:00:57
173500 -- (-263.963) (-262.233) (-260.413) [-260.773] * (-263.149) (-260.742) [-262.244] (-261.047) -- 0:00:57
174000 -- (-265.755) (-262.637) (-261.941) [-259.661] * (-260.728) (-263.530) [-260.066] (-261.776) -- 0:00:56
174500 -- (-262.268) (-268.575) (-260.313) [-259.876] * (-259.610) [-263.396] (-262.159) (-263.456) -- 0:00:56
175000 -- (-260.569) [-260.137] (-260.602) (-264.148) * [-259.168] (-258.999) (-259.750) (-262.123) -- 0:00:56
Average standard deviation of split frequencies: 0.021991
175500 -- (-261.474) [-259.670] (-259.943) (-261.240) * (-266.709) [-261.827] (-261.575) (-260.723) -- 0:00:56
176000 -- [-260.306] (-262.080) (-262.330) (-260.120) * (-265.453) [-261.598] (-264.873) (-263.489) -- 0:00:56
176500 -- [-260.068] (-259.619) (-261.427) (-259.700) * (-259.847) (-261.293) [-260.979] (-262.829) -- 0:00:55
177000 -- (-261.982) (-264.949) [-261.365] (-263.403) * (-261.429) (-260.724) (-261.223) [-260.439] -- 0:00:55
177500 -- (-261.749) (-266.642) (-262.653) [-259.203] * (-261.266) (-261.167) (-264.712) [-261.139] -- 0:00:55
178000 -- [-264.139] (-262.003) (-260.069) (-259.341) * (-262.391) [-261.439] (-262.976) (-260.944) -- 0:00:55
178500 -- (-264.371) [-262.897] (-263.165) (-261.655) * (-260.520) (-262.106) (-260.399) [-262.448] -- 0:00:55
179000 -- [-261.302] (-260.149) (-262.100) (-261.087) * (-265.849) (-264.452) (-264.237) [-260.482] -- 0:00:55
179500 -- (-262.533) (-260.711) [-259.969] (-261.998) * (-264.004) (-262.460) (-262.244) [-260.607] -- 0:00:54
180000 -- (-260.941) (-263.420) [-261.242] (-264.997) * [-262.509] (-262.416) (-260.572) (-259.976) -- 0:00:54
Average standard deviation of split frequencies: 0.020462
180500 -- (-260.073) [-262.080] (-259.969) (-259.029) * (-260.197) (-260.305) [-261.021] (-261.183) -- 0:00:54
181000 -- [-261.910] (-258.946) (-261.349) (-260.427) * (-262.400) [-260.204] (-259.872) (-260.057) -- 0:00:54
181500 -- (-263.246) (-259.610) (-262.131) [-261.358] * (-266.976) (-261.326) [-260.758] (-260.199) -- 0:00:54
182000 -- (-259.758) (-260.104) [-261.896] (-260.126) * (-261.492) (-260.118) (-263.924) [-261.691] -- 0:00:53
182500 -- (-261.307) [-260.980] (-261.598) (-260.149) * [-259.172] (-266.882) (-265.361) (-263.234) -- 0:00:53
183000 -- (-260.123) (-261.495) [-260.941] (-260.229) * [-259.281] (-263.140) (-263.473) (-260.638) -- 0:00:53
183500 -- (-261.776) (-261.554) (-269.938) [-262.763] * [-262.679] (-261.271) (-260.059) (-260.804) -- 0:00:53
184000 -- (-260.089) (-270.139) (-262.727) [-262.309] * (-260.702) [-259.692] (-260.896) (-260.749) -- 0:00:53
184500 -- [-259.976] (-262.234) (-265.854) (-260.783) * (-260.873) (-267.217) [-262.155] (-261.717) -- 0:00:53
185000 -- [-260.161] (-264.154) (-260.000) (-259.448) * [-260.680] (-263.228) (-262.328) (-263.199) -- 0:00:52
Average standard deviation of split frequencies: 0.018755
185500 -- (-264.503) [-263.342] (-262.435) (-261.045) * (-263.168) [-261.837] (-261.108) (-262.518) -- 0:00:52
186000 -- (-263.185) [-261.194] (-266.609) (-261.855) * (-260.736) [-262.744] (-263.653) (-260.418) -- 0:00:56
186500 -- [-259.071] (-261.894) (-260.867) (-262.410) * (-259.654) [-264.132] (-259.102) (-262.542) -- 0:00:56
187000 -- [-262.628] (-262.307) (-260.723) (-261.791) * (-260.607) [-261.021] (-260.646) (-261.463) -- 0:00:56
187500 -- (-260.340) [-260.885] (-260.914) (-265.202) * (-261.237) [-260.940] (-259.851) (-260.855) -- 0:00:56
188000 -- (-262.212) [-260.575] (-260.737) (-262.373) * (-259.697) [-261.633] (-261.336) (-261.202) -- 0:00:56
188500 -- (-260.504) (-261.184) [-262.265] (-262.416) * (-266.037) [-260.211] (-263.563) (-261.731) -- 0:00:55
189000 -- [-260.366] (-261.362) (-261.025) (-260.312) * (-262.282) [-259.565] (-261.978) (-260.186) -- 0:00:55
189500 -- (-260.426) (-261.809) (-261.858) [-259.695] * (-261.723) (-260.575) (-261.857) [-261.377] -- 0:00:55
190000 -- (-268.747) [-261.607] (-261.598) (-262.482) * (-260.224) (-260.935) (-268.141) [-260.487] -- 0:00:55
Average standard deviation of split frequencies: 0.019532
190500 -- (-259.392) (-260.221) [-262.186] (-260.468) * (-262.181) (-260.746) [-266.872] (-264.050) -- 0:00:55
191000 -- [-261.432] (-263.010) (-261.079) (-260.283) * (-261.303) [-259.236] (-259.818) (-261.530) -- 0:00:55
191500 -- (-260.583) (-259.983) (-260.564) [-261.033] * [-261.322] (-259.892) (-260.625) (-261.528) -- 0:00:54
192000 -- [-260.396] (-264.724) (-263.189) (-264.042) * (-260.188) [-262.564] (-260.708) (-263.493) -- 0:00:54
192500 -- (-260.218) (-259.346) [-260.415] (-261.538) * (-261.497) [-260.265] (-263.369) (-263.698) -- 0:00:54
193000 -- (-262.557) [-261.900] (-260.446) (-260.494) * [-263.350] (-262.475) (-263.369) (-263.294) -- 0:00:54
193500 -- (-263.495) (-260.315) (-260.693) [-260.839] * (-268.635) (-262.914) (-261.063) [-261.768] -- 0:00:54
194000 -- (-261.513) (-262.460) (-260.822) [-261.121] * (-261.931) (-264.767) [-262.068] (-262.166) -- 0:00:54
194500 -- [-259.364] (-261.110) (-260.200) (-264.433) * (-265.336) [-259.840] (-260.671) (-262.355) -- 0:00:53
195000 -- [-259.825] (-262.480) (-260.395) (-261.292) * [-263.188] (-262.739) (-259.258) (-265.333) -- 0:00:53
Average standard deviation of split frequencies: 0.020380
195500 -- [-259.904] (-261.748) (-262.968) (-260.713) * (-261.645) (-261.612) (-259.758) [-262.627] -- 0:00:53
196000 -- (-262.016) (-263.876) [-263.444] (-261.517) * (-261.417) (-266.405) [-259.292] (-260.410) -- 0:00:53
196500 -- [-260.618] (-259.604) (-259.625) (-259.962) * (-259.352) (-260.308) [-260.836] (-262.699) -- 0:00:53
197000 -- (-259.823) (-260.098) (-260.389) [-262.622] * (-262.873) (-261.269) (-261.908) [-260.035] -- 0:00:52
197500 -- (-261.933) [-263.414] (-261.502) (-262.003) * (-261.171) (-261.120) [-261.896] (-266.082) -- 0:00:52
198000 -- [-262.936] (-260.173) (-260.573) (-261.083) * (-259.260) (-270.093) [-261.204] (-262.142) -- 0:00:52
198500 -- (-262.016) (-263.662) [-263.548] (-261.425) * (-260.277) [-259.471] (-261.783) (-261.770) -- 0:00:52
199000 -- (-259.590) [-262.132] (-264.142) (-265.351) * (-259.605) (-260.881) (-261.234) [-260.346] -- 0:00:52
199500 -- (-263.332) [-261.400] (-268.814) (-265.502) * [-260.280] (-260.002) (-266.850) (-260.851) -- 0:00:52
200000 -- (-263.806) (-260.028) (-265.810) [-260.260] * (-259.522) (-259.800) [-265.476] (-262.701) -- 0:00:51
Average standard deviation of split frequencies: 0.019288
200500 -- (-260.384) [-263.921] (-261.792) (-259.694) * [-261.788] (-261.433) (-259.110) (-259.698) -- 0:00:51
201000 -- (-259.911) (-261.316) [-260.295] (-260.510) * (-262.453) (-260.099) (-260.458) [-259.179] -- 0:00:51
201500 -- (-260.231) [-259.804] (-263.502) (-260.362) * (-261.088) (-259.782) (-260.020) [-260.998] -- 0:00:51
202000 -- (-260.394) [-259.894] (-259.802) (-261.385) * [-260.290] (-260.537) (-260.820) (-260.427) -- 0:00:55
202500 -- (-260.569) (-261.480) [-259.288] (-259.840) * (-259.942) [-259.872] (-260.401) (-261.269) -- 0:00:55
203000 -- [-259.668] (-262.578) (-261.781) (-259.749) * (-260.198) (-263.471) [-261.436] (-260.697) -- 0:00:54
203500 -- [-259.195] (-261.954) (-261.371) (-264.995) * (-262.741) (-262.313) (-264.944) [-259.529] -- 0:00:54
204000 -- (-261.631) (-262.730) [-261.050] (-263.744) * (-259.756) (-263.028) [-259.873] (-265.409) -- 0:00:54
204500 -- (-261.425) (-261.989) [-259.853] (-262.905) * (-262.461) (-261.933) (-261.255) [-261.663] -- 0:00:54
205000 -- [-259.704] (-260.441) (-260.603) (-261.204) * (-260.658) (-260.409) (-262.052) [-260.812] -- 0:00:54
Average standard deviation of split frequencies: 0.019150
205500 -- (-270.569) (-259.269) (-261.698) [-259.767] * (-260.253) (-261.098) (-260.545) [-261.646] -- 0:00:54
206000 -- (-265.784) (-260.152) (-261.250) [-263.298] * (-262.098) (-260.797) [-260.736] (-263.310) -- 0:00:53
206500 -- (-262.460) (-260.167) (-260.710) [-264.298] * (-263.124) (-262.982) (-260.497) [-266.990] -- 0:00:53
207000 -- (-266.479) [-261.567] (-260.784) (-262.875) * (-260.404) (-262.204) [-261.015] (-260.219) -- 0:00:53
207500 -- [-263.440] (-261.510) (-261.407) (-261.351) * (-261.461) [-260.541] (-260.916) (-267.473) -- 0:00:53
208000 -- (-263.395) (-259.957) (-261.987) [-259.235] * (-260.694) [-262.414] (-266.264) (-260.105) -- 0:00:53
208500 -- (-265.533) (-260.354) (-263.517) [-260.695] * [-261.406] (-265.039) (-265.005) (-263.104) -- 0:00:53
209000 -- (-267.237) (-264.651) [-260.774] (-262.264) * (-260.819) (-263.672) (-263.341) [-265.002] -- 0:00:52
209500 -- (-263.196) [-259.588] (-260.342) (-266.221) * (-259.609) (-263.577) (-263.807) [-260.721] -- 0:00:52
210000 -- (-266.430) (-261.921) [-261.917] (-268.902) * (-261.090) [-265.197] (-261.667) (-261.589) -- 0:00:52
Average standard deviation of split frequencies: 0.017784
210500 -- [-260.741] (-260.061) (-259.887) (-264.137) * (-260.544) (-263.760) (-261.595) [-266.545] -- 0:00:52
211000 -- (-260.730) [-262.405] (-262.716) (-262.790) * [-263.579] (-264.065) (-262.068) (-261.383) -- 0:00:52
211500 -- (-261.292) (-260.222) [-266.450] (-261.531) * (-263.021) [-264.465] (-260.332) (-261.875) -- 0:00:52
212000 -- (-259.407) (-260.552) [-260.032] (-261.428) * [-262.909] (-260.644) (-260.046) (-260.231) -- 0:00:52
212500 -- (-262.448) [-259.504] (-262.415) (-260.806) * (-260.726) (-260.545) [-261.839] (-263.744) -- 0:00:51
213000 -- (-260.462) (-259.966) [-264.764] (-260.571) * [-259.594] (-261.703) (-259.824) (-261.060) -- 0:00:51
213500 -- (-260.907) (-262.945) (-264.287) [-259.187] * (-261.245) (-261.877) (-262.003) [-263.543] -- 0:00:51
214000 -- (-259.806) (-263.512) (-261.463) [-262.852] * (-264.722) (-264.680) [-261.110] (-260.347) -- 0:00:51
214500 -- (-260.197) (-263.626) [-261.050] (-260.212) * (-261.163) (-259.312) (-263.232) [-262.731] -- 0:00:51
215000 -- (-264.841) (-263.868) [-261.776] (-263.491) * (-261.549) [-262.692] (-260.267) (-266.353) -- 0:00:51
Average standard deviation of split frequencies: 0.017459
215500 -- (-262.732) (-264.178) (-260.045) [-262.421] * (-264.046) [-267.813] (-260.317) (-267.385) -- 0:00:50
216000 -- (-259.554) [-261.519] (-261.517) (-263.808) * [-261.060] (-267.248) (-260.641) (-265.001) -- 0:00:50
216500 -- [-260.559] (-262.704) (-259.705) (-261.017) * (-264.400) (-264.154) [-260.652] (-265.299) -- 0:00:50
217000 -- (-261.112) [-261.654] (-259.939) (-264.953) * [-268.457] (-261.664) (-261.775) (-259.406) -- 0:00:50
217500 -- (-261.438) (-261.552) [-264.372] (-263.743) * (-262.813) (-261.622) [-260.838] (-265.246) -- 0:00:50
218000 -- (-264.452) (-261.407) [-260.476] (-261.080) * (-267.458) (-261.748) (-259.182) [-264.036] -- 0:00:53
218500 -- (-261.128) (-259.609) (-261.294) [-261.589] * (-261.492) (-264.728) (-261.134) [-263.276] -- 0:00:53
219000 -- (-259.251) (-261.240) [-260.766] (-261.579) * (-264.829) [-261.615] (-259.963) (-261.412) -- 0:00:53
219500 -- (-259.923) (-262.287) (-259.456) [-259.824] * (-261.281) [-260.742] (-259.693) (-261.305) -- 0:00:53
220000 -- (-261.142) (-261.418) [-259.223] (-261.164) * [-261.563] (-260.584) (-261.541) (-261.446) -- 0:00:53
Average standard deviation of split frequencies: 0.017921
220500 -- (-262.981) [-260.730] (-260.176) (-259.628) * [-259.419] (-260.091) (-269.438) (-260.839) -- 0:00:53
221000 -- (-260.426) [-260.026] (-261.314) (-262.364) * [-259.111] (-262.332) (-264.600) (-264.668) -- 0:00:52
221500 -- (-262.344) [-262.262] (-262.874) (-260.379) * (-260.938) [-263.214] (-262.439) (-261.025) -- 0:00:52
222000 -- [-259.655] (-262.653) (-259.870) (-260.487) * (-263.575) (-269.356) (-262.215) [-261.399] -- 0:00:52
222500 -- (-264.287) [-259.627] (-261.075) (-263.941) * [-262.756] (-264.187) (-261.234) (-260.074) -- 0:00:52
223000 -- [-261.214] (-261.688) (-261.377) (-263.278) * (-260.012) (-259.499) (-260.276) [-259.485] -- 0:00:52
223500 -- (-260.662) (-264.437) (-261.334) [-263.801] * (-261.562) (-261.289) [-260.575] (-263.107) -- 0:00:52
224000 -- [-266.776] (-263.949) (-261.987) (-260.533) * [-261.461] (-261.089) (-262.335) (-262.683) -- 0:00:51
224500 -- (-262.427) (-264.883) [-259.946] (-262.572) * (-259.897) [-259.817] (-260.073) (-267.686) -- 0:00:51
225000 -- (-262.776) (-262.530) [-261.644] (-260.309) * (-260.367) (-260.534) (-260.456) [-264.255] -- 0:00:51
Average standard deviation of split frequencies: 0.016478
225500 -- (-263.721) [-260.859] (-261.857) (-261.647) * [-261.564] (-262.952) (-264.790) (-262.757) -- 0:00:51
226000 -- (-264.545) (-265.695) (-260.096) [-262.950] * [-262.298] (-260.674) (-261.651) (-263.707) -- 0:00:51
226500 -- [-260.518] (-262.393) (-260.131) (-261.525) * (-263.387) [-263.030] (-261.280) (-265.422) -- 0:00:51
227000 -- (-261.796) (-260.203) (-260.158) [-261.305] * (-261.251) (-261.077) [-259.798] (-263.329) -- 0:00:51
227500 -- (-262.846) (-259.874) (-260.691) [-262.847] * (-260.278) (-262.061) (-262.727) [-259.112] -- 0:00:50
228000 -- (-261.580) [-261.506] (-263.544) (-263.146) * (-266.364) [-261.810] (-268.530) (-259.643) -- 0:00:50
228500 -- (-262.766) [-259.586] (-259.832) (-262.068) * (-262.600) (-260.878) [-261.028] (-261.807) -- 0:00:50
229000 -- (-260.467) [-259.929] (-262.280) (-259.893) * (-261.781) (-262.865) [-259.610] (-261.413) -- 0:00:50
229500 -- [-260.110] (-260.862) (-265.360) (-261.896) * (-262.762) (-260.936) [-260.274] (-260.947) -- 0:00:50
230000 -- (-263.745) (-260.530) [-259.746] (-261.568) * [-259.581] (-262.867) (-261.814) (-263.549) -- 0:00:50
Average standard deviation of split frequencies: 0.017102
230500 -- (-260.315) (-260.578) (-260.168) [-262.584] * (-260.010) (-260.857) (-263.626) [-264.565] -- 0:00:50
231000 -- [-259.648] (-262.405) (-262.589) (-261.715) * (-262.373) (-260.823) [-260.761] (-260.237) -- 0:00:49
231500 -- (-259.049) (-259.958) [-263.253] (-260.792) * [-260.315] (-261.881) (-261.584) (-261.222) -- 0:00:49
232000 -- [-260.883] (-260.749) (-261.684) (-262.665) * [-260.834] (-260.987) (-261.164) (-262.744) -- 0:00:49
232500 -- (-261.408) (-263.132) (-262.628) [-259.754] * (-262.819) [-260.449] (-259.967) (-259.556) -- 0:00:49
233000 -- (-262.064) (-262.225) (-262.529) [-259.733] * (-261.267) (-261.508) [-259.709] (-260.882) -- 0:00:49
233500 -- (-261.871) (-259.799) (-262.117) [-260.195] * (-260.167) (-266.429) (-260.288) [-260.234] -- 0:00:49
234000 -- [-262.348] (-259.805) (-263.557) (-261.402) * [-259.643] (-263.639) (-260.293) (-260.240) -- 0:00:49
234500 -- (-262.697) [-261.618] (-262.630) (-260.997) * (-259.928) (-260.139) (-260.617) [-259.920] -- 0:00:52
235000 -- [-261.097] (-261.719) (-261.221) (-261.325) * (-263.323) (-261.553) (-263.237) [-259.843] -- 0:00:52
Average standard deviation of split frequencies: 0.017977
235500 -- (-262.906) [-261.613] (-263.357) (-260.394) * (-259.384) (-260.744) [-262.625] (-261.631) -- 0:00:51
236000 -- (-261.802) [-261.172] (-262.076) (-264.379) * (-260.608) (-259.764) (-261.745) [-260.348] -- 0:00:51
236500 -- (-259.468) [-260.971] (-259.437) (-261.619) * (-260.406) (-260.205) [-260.406] (-260.103) -- 0:00:51
237000 -- [-265.280] (-259.396) (-260.902) (-263.725) * (-260.060) (-263.457) (-260.684) [-260.726] -- 0:00:51
237500 -- [-262.273] (-261.944) (-261.125) (-263.818) * (-261.141) (-262.979) [-261.659] (-260.419) -- 0:00:51
238000 -- (-259.717) (-262.031) (-260.414) [-259.603] * (-264.577) (-260.166) [-261.533] (-262.326) -- 0:00:51
238500 -- (-260.488) (-263.364) [-261.906] (-261.460) * (-263.482) [-261.965] (-260.551) (-262.659) -- 0:00:51
239000 -- (-259.678) (-261.300) (-261.144) [-262.161] * [-260.365] (-260.571) (-261.297) (-262.631) -- 0:00:50
239500 -- (-265.523) (-260.995) (-261.531) [-260.784] * (-260.609) [-260.564] (-260.513) (-270.190) -- 0:00:50
240000 -- [-263.451] (-259.402) (-263.021) (-259.855) * (-260.447) (-266.445) (-261.116) [-261.029] -- 0:00:50
Average standard deviation of split frequencies: 0.016804
240500 -- (-262.267) (-263.102) (-265.355) [-259.790] * (-263.567) (-260.300) [-261.692] (-260.515) -- 0:00:50
241000 -- (-262.866) (-267.953) (-261.316) [-259.930] * (-259.881) [-263.462] (-262.928) (-262.632) -- 0:00:50
241500 -- (-263.006) (-264.140) [-260.476] (-261.612) * (-259.563) [-263.099] (-261.721) (-259.544) -- 0:00:50
242000 -- (-260.711) [-264.742] (-265.937) (-260.131) * (-262.448) (-261.887) [-261.292] (-262.358) -- 0:00:50
242500 -- (-260.472) (-260.715) [-259.942] (-265.812) * (-262.158) (-262.179) [-263.082] (-261.686) -- 0:00:49
243000 -- (-262.648) (-261.711) (-261.330) [-263.692] * (-262.934) (-262.211) (-261.258) [-260.507] -- 0:00:49
243500 -- (-260.916) (-263.855) (-261.044) [-262.619] * [-265.913] (-261.966) (-262.100) (-260.587) -- 0:00:49
244000 -- (-262.124) [-260.430] (-261.402) (-261.101) * [-262.107] (-259.340) (-259.394) (-263.273) -- 0:00:49
244500 -- (-263.450) (-259.548) [-260.251] (-262.998) * [-262.661] (-260.115) (-266.759) (-261.427) -- 0:00:49
245000 -- (-262.377) [-259.165] (-262.212) (-263.521) * [-260.095] (-260.423) (-261.794) (-262.141) -- 0:00:49
Average standard deviation of split frequencies: 0.016137
245500 -- (-261.366) [-261.270] (-260.267) (-262.856) * (-259.241) (-260.128) [-260.473] (-260.338) -- 0:00:49
246000 -- (-260.300) (-259.800) [-259.463] (-265.720) * (-259.816) (-264.659) (-261.430) [-262.518] -- 0:00:49
246500 -- (-262.406) [-259.992] (-259.210) (-263.709) * [-259.881] (-266.393) (-261.577) (-260.904) -- 0:00:48
247000 -- (-263.344) [-259.338] (-265.449) (-259.550) * (-259.265) [-264.543] (-261.254) (-261.577) -- 0:00:48
247500 -- (-260.754) [-261.532] (-261.699) (-261.534) * [-261.236] (-262.093) (-261.166) (-260.014) -- 0:00:48
248000 -- (-263.248) (-259.275) [-260.336] (-260.860) * (-261.895) (-262.629) (-261.605) [-264.460] -- 0:00:48
248500 -- (-264.123) [-260.843] (-266.279) (-262.166) * (-263.572) (-265.499) [-260.456] (-262.023) -- 0:00:48
249000 -- (-263.511) (-261.979) (-260.833) [-264.002] * [-261.337] (-260.890) (-260.236) (-262.444) -- 0:00:48
249500 -- [-261.136] (-263.705) (-263.287) (-260.287) * (-262.355) [-261.806] (-260.570) (-263.663) -- 0:00:48
250000 -- (-266.490) (-260.051) (-260.622) [-263.464] * (-259.668) (-259.845) (-259.732) [-261.057] -- 0:00:51
Average standard deviation of split frequencies: 0.016628
250500 -- (-264.863) (-261.618) [-259.972] (-261.223) * [-260.882] (-262.121) (-261.423) (-259.764) -- 0:00:50
251000 -- (-262.875) (-260.146) [-261.673] (-260.754) * (-259.390) (-260.800) [-259.951] (-259.584) -- 0:00:50
251500 -- (-261.988) (-259.273) [-261.654] (-261.334) * (-261.641) (-259.914) (-262.570) [-260.616] -- 0:00:50
252000 -- [-261.264] (-262.301) (-261.071) (-259.483) * (-260.256) [-259.532] (-259.918) (-259.354) -- 0:00:50
252500 -- (-260.329) (-265.941) (-259.841) [-262.495] * (-265.687) (-261.408) (-261.583) [-263.841] -- 0:00:50
253000 -- (-260.585) (-261.726) (-262.091) [-262.379] * (-261.258) (-260.971) [-262.623] (-267.631) -- 0:00:50
253500 -- (-261.076) [-263.541] (-259.506) (-259.254) * (-262.688) [-264.261] (-262.448) (-261.472) -- 0:00:50
254000 -- (-262.161) [-261.261] (-266.951) (-260.994) * (-262.905) (-260.487) (-263.337) [-260.606] -- 0:00:49
254500 -- (-261.654) (-261.904) (-259.887) [-259.743] * (-260.879) [-259.878] (-261.189) (-270.142) -- 0:00:49
255000 -- (-260.196) (-259.174) (-261.993) [-260.773] * (-261.446) [-258.949] (-263.963) (-262.553) -- 0:00:49
Average standard deviation of split frequencies: 0.017656
255500 -- [-260.346] (-266.447) (-259.910) (-261.868) * (-260.122) [-259.600] (-269.228) (-262.859) -- 0:00:49
256000 -- (-260.541) (-263.951) [-260.215] (-264.799) * [-260.789] (-259.326) (-262.850) (-263.876) -- 0:00:49
256500 -- (-261.563) (-260.047) (-262.809) [-260.848] * [-260.015] (-259.322) (-260.756) (-268.167) -- 0:00:49
257000 -- (-262.939) (-261.082) [-260.853] (-260.327) * [-260.305] (-261.152) (-262.022) (-260.877) -- 0:00:49
257500 -- (-261.184) (-260.354) (-259.206) [-261.488] * (-260.223) (-260.043) [-263.500] (-261.125) -- 0:00:49
258000 -- (-260.354) (-260.483) (-261.669) [-261.971] * (-264.016) [-260.728] (-260.999) (-261.387) -- 0:00:48
258500 -- (-260.737) [-263.579] (-263.257) (-260.436) * (-261.858) (-260.131) [-262.299] (-260.369) -- 0:00:48
259000 -- (-261.073) (-261.316) [-262.921] (-260.292) * (-262.642) (-261.581) (-264.761) [-259.198] -- 0:00:48
259500 -- (-260.886) [-263.288] (-260.177) (-264.191) * (-264.269) [-261.632] (-262.969) (-260.766) -- 0:00:48
260000 -- (-261.188) [-261.382] (-259.799) (-265.928) * (-262.716) (-263.406) [-263.443] (-261.305) -- 0:00:48
Average standard deviation of split frequencies: 0.017446
260500 -- [-264.233] (-263.183) (-260.672) (-263.599) * (-260.936) (-261.473) [-261.761] (-259.335) -- 0:00:48
261000 -- (-261.331) [-259.780] (-260.595) (-263.159) * (-259.641) (-259.570) [-260.246] (-261.444) -- 0:00:48
261500 -- (-258.990) [-261.173] (-261.714) (-261.313) * (-262.191) (-260.281) [-260.333] (-262.098) -- 0:00:48
262000 -- [-259.428] (-262.568) (-261.345) (-264.335) * (-259.628) (-259.603) [-262.136] (-261.367) -- 0:00:47
262500 -- (-259.761) (-266.250) (-261.083) [-261.693] * [-261.025] (-259.796) (-260.222) (-263.474) -- 0:00:47
263000 -- (-260.709) (-261.749) [-260.062] (-259.724) * (-260.922) (-264.624) [-259.733] (-260.538) -- 0:00:47
263500 -- (-262.557) [-264.218] (-265.623) (-259.164) * (-262.257) (-260.167) [-261.355] (-268.568) -- 0:00:47
264000 -- (-261.609) (-261.339) (-261.376) [-259.036] * (-262.451) (-259.942) (-262.290) [-263.975] -- 0:00:47
264500 -- [-259.873] (-260.714) (-261.146) (-260.050) * (-260.744) (-263.047) [-260.271] (-262.500) -- 0:00:47
265000 -- [-261.129] (-261.731) (-260.952) (-263.003) * (-261.163) (-261.076) [-259.532] (-259.976) -- 0:00:47
Average standard deviation of split frequencies: 0.017230
265500 -- (-263.628) [-264.447] (-260.635) (-261.007) * [-262.037] (-261.392) (-259.629) (-260.568) -- 0:00:47
266000 -- (-262.231) (-263.970) [-260.323] (-260.533) * (-259.890) [-259.766] (-260.679) (-261.731) -- 0:00:49
266500 -- (-260.853) (-263.683) (-264.818) [-260.164] * [-260.588] (-262.173) (-260.908) (-264.367) -- 0:00:49
267000 -- (-262.038) [-261.160] (-265.223) (-258.951) * (-260.959) (-259.936) [-260.648] (-260.667) -- 0:00:49
267500 -- (-262.180) (-264.701) (-268.028) [-260.560] * (-264.813) (-259.994) (-260.574) [-262.084] -- 0:00:49
268000 -- [-260.201] (-260.946) (-269.533) (-264.259) * [-268.226] (-262.342) (-261.978) (-261.331) -- 0:00:49
268500 -- [-259.907] (-260.216) (-259.398) (-259.841) * (-262.891) [-261.594] (-259.357) (-262.425) -- 0:00:49
269000 -- (-259.041) [-263.013] (-262.345) (-259.182) * (-262.437) (-260.545) [-260.978] (-260.761) -- 0:00:48
269500 -- [-263.761] (-266.460) (-262.837) (-262.682) * (-260.873) [-263.651] (-260.018) (-259.855) -- 0:00:48
270000 -- (-261.957) (-261.095) (-261.917) [-262.030] * (-262.928) (-260.378) [-260.815] (-261.929) -- 0:00:48
Average standard deviation of split frequencies: 0.018094
270500 -- (-264.654) (-259.382) [-263.113] (-263.540) * [-262.172] (-263.271) (-260.344) (-260.884) -- 0:00:48
271000 -- (-259.687) (-262.961) [-260.311] (-261.572) * (-263.229) (-260.647) [-260.183] (-265.142) -- 0:00:48
271500 -- [-260.916] (-261.748) (-263.192) (-259.422) * (-261.456) (-260.311) [-260.708] (-260.031) -- 0:00:48
272000 -- (-266.720) (-260.533) [-259.928] (-259.820) * [-260.959] (-262.266) (-259.712) (-262.396) -- 0:00:48
272500 -- (-261.239) (-261.724) [-265.421] (-260.503) * [-265.013] (-261.171) (-262.174) (-262.772) -- 0:00:48
273000 -- (-260.564) [-260.867] (-264.092) (-262.288) * (-260.553) [-262.714] (-261.248) (-261.345) -- 0:00:47
273500 -- (-263.076) [-260.782] (-262.936) (-261.614) * (-259.851) (-265.040) [-261.724] (-260.771) -- 0:00:47
274000 -- (-262.115) (-267.042) [-261.151] (-259.512) * [-261.022] (-266.793) (-261.887) (-261.303) -- 0:00:47
274500 -- (-260.779) (-262.293) (-259.835) [-260.105] * (-260.835) (-259.498) [-259.904] (-261.339) -- 0:00:47
275000 -- (-260.820) (-262.117) [-260.998] (-259.164) * (-262.475) [-262.055] (-263.004) (-259.803) -- 0:00:47
Average standard deviation of split frequencies: 0.017170
275500 -- [-264.090] (-259.699) (-261.977) (-260.061) * [-261.059] (-264.029) (-261.618) (-259.518) -- 0:00:47
276000 -- (-261.438) (-261.382) [-260.708] (-259.914) * (-262.364) [-261.832] (-260.657) (-261.031) -- 0:00:47
276500 -- (-260.955) (-264.747) (-261.595) [-259.701] * [-261.531] (-262.432) (-260.093) (-260.054) -- 0:00:47
277000 -- (-260.485) [-261.496] (-261.263) (-264.354) * (-261.564) [-261.483] (-263.564) (-259.791) -- 0:00:46
277500 -- [-262.247] (-267.528) (-262.685) (-260.075) * (-260.579) [-262.454] (-259.712) (-260.357) -- 0:00:46
278000 -- (-260.543) [-261.463] (-262.218) (-260.985) * (-261.155) (-261.919) (-261.952) [-261.946] -- 0:00:46
278500 -- (-259.790) [-260.658] (-261.153) (-261.960) * (-262.019) [-260.376] (-259.884) (-263.670) -- 0:00:46
279000 -- (-259.856) (-262.548) (-264.205) [-262.375] * (-260.448) [-259.714] (-260.725) (-260.834) -- 0:00:46
279500 -- (-264.368) (-261.037) (-266.974) [-261.120] * (-260.854) (-261.241) (-260.358) [-260.193] -- 0:00:46
280000 -- (-260.396) [-260.887] (-262.914) (-261.107) * (-263.192) (-264.171) [-262.612] (-259.523) -- 0:00:46
Average standard deviation of split frequencies: 0.015396
280500 -- (-262.256) [-260.117] (-261.795) (-261.614) * [-260.794] (-261.149) (-262.041) (-261.266) -- 0:00:46
281000 -- [-259.917] (-263.230) (-262.841) (-262.911) * [-261.823] (-260.337) (-261.790) (-260.756) -- 0:00:46
281500 -- (-262.120) (-262.896) (-259.825) [-261.822] * [-260.800] (-260.250) (-259.776) (-262.460) -- 0:00:45
282000 -- (-260.374) (-261.097) (-259.371) [-263.333] * (-260.950) (-259.697) [-260.720] (-263.385) -- 0:00:45
282500 -- (-260.833) [-261.930] (-262.326) (-262.365) * [-263.397] (-260.951) (-261.618) (-264.701) -- 0:00:48
283000 -- (-262.923) (-261.024) (-259.674) [-260.535] * (-260.602) [-259.780] (-260.495) (-263.190) -- 0:00:48
283500 -- [-260.341] (-262.369) (-260.672) (-263.470) * [-262.723] (-262.691) (-263.014) (-263.768) -- 0:00:48
284000 -- (-263.307) [-264.832] (-262.915) (-265.503) * (-263.970) [-259.513] (-261.230) (-260.217) -- 0:00:47
284500 -- [-261.902] (-260.888) (-259.213) (-260.446) * (-260.237) (-260.365) (-261.760) [-259.934] -- 0:00:47
285000 -- (-260.659) [-260.386] (-260.915) (-261.155) * (-261.378) [-259.986] (-265.377) (-260.066) -- 0:00:47
Average standard deviation of split frequencies: 0.014921
285500 -- (-264.540) [-259.698] (-259.799) (-260.295) * (-261.470) [-262.168] (-261.438) (-260.957) -- 0:00:47
286000 -- (-259.452) (-260.345) (-260.330) [-261.396] * [-260.346] (-261.316) (-259.920) (-263.180) -- 0:00:47
286500 -- (-259.571) (-267.601) (-263.104) [-261.532] * (-264.854) (-259.244) (-263.619) [-261.525] -- 0:00:47
287000 -- (-260.271) (-263.119) [-264.204] (-262.843) * (-261.863) [-259.539] (-264.330) (-259.781) -- 0:00:47
287500 -- (-264.327) (-266.001) (-263.180) [-262.854] * (-260.439) (-260.215) (-264.540) [-261.721] -- 0:00:47
288000 -- (-265.771) [-259.973] (-261.317) (-259.228) * (-260.960) (-260.957) [-260.335] (-261.407) -- 0:00:46
288500 -- (-261.494) [-260.608] (-262.442) (-260.503) * [-259.915] (-263.097) (-264.079) (-261.607) -- 0:00:46
289000 -- (-262.155) (-261.836) (-265.131) [-261.715] * (-259.887) (-262.601) (-263.644) [-260.070] -- 0:00:46
289500 -- (-262.858) (-261.584) (-263.936) [-261.141] * [-261.850] (-263.266) (-269.877) (-263.290) -- 0:00:46
290000 -- (-262.355) (-264.559) (-260.622) [-262.361] * (-262.312) (-260.008) (-260.072) [-260.651] -- 0:00:46
Average standard deviation of split frequencies: 0.016600
290500 -- [-259.950] (-261.099) (-261.331) (-260.767) * (-260.869) (-260.048) [-259.680] (-262.217) -- 0:00:46
291000 -- (-261.662) (-261.627) [-259.714] (-264.682) * (-261.157) (-259.967) [-261.168] (-260.553) -- 0:00:46
291500 -- [-262.294] (-259.773) (-261.233) (-265.011) * (-263.808) (-261.273) (-260.342) [-260.183] -- 0:00:46
292000 -- (-263.581) [-261.612] (-265.140) (-263.885) * (-263.060) (-264.852) (-260.023) [-263.498] -- 0:00:46
292500 -- (-261.727) [-259.607] (-261.125) (-264.216) * (-261.896) (-260.666) [-263.222] (-263.923) -- 0:00:45
293000 -- (-264.043) (-261.459) (-261.360) [-260.079] * (-261.759) [-261.022] (-260.542) (-261.058) -- 0:00:45
293500 -- (-266.495) [-260.786] (-262.877) (-259.723) * [-261.454] (-260.341) (-260.771) (-263.260) -- 0:00:45
294000 -- (-263.054) (-261.531) [-260.096] (-260.322) * (-260.711) (-262.444) [-259.727] (-260.266) -- 0:00:45
294500 -- (-265.172) (-261.746) [-260.677] (-265.297) * (-261.594) (-260.819) (-261.149) [-260.226] -- 0:00:45
295000 -- (-261.072) (-261.322) [-260.502] (-261.165) * (-263.821) (-260.316) (-264.934) [-259.739] -- 0:00:45
Average standard deviation of split frequencies: 0.016545
295500 -- (-261.737) [-259.858] (-260.825) (-261.797) * [-262.163] (-260.458) (-260.328) (-261.260) -- 0:00:45
296000 -- (-263.066) (-261.790) [-263.588] (-265.100) * (-261.173) (-261.647) [-260.500] (-262.646) -- 0:00:45
296500 -- (-261.199) [-259.908] (-262.258) (-265.014) * [-263.207] (-260.963) (-261.269) (-261.254) -- 0:00:45
297000 -- (-261.506) (-261.030) [-260.661] (-261.698) * [-262.133] (-263.952) (-260.230) (-261.101) -- 0:00:44
297500 -- (-263.836) [-261.855] (-260.023) (-260.188) * [-268.652] (-268.731) (-260.056) (-265.115) -- 0:00:44
298000 -- (-265.289) (-262.082) (-259.777) [-259.900] * (-261.447) [-261.033] (-260.086) (-261.122) -- 0:00:47
298500 -- (-261.667) [-259.927] (-260.188) (-260.656) * (-260.220) (-260.191) [-260.700] (-263.441) -- 0:00:47
299000 -- (-259.056) (-260.325) (-262.155) [-260.303] * (-260.417) [-260.680] (-263.857) (-259.581) -- 0:00:46
299500 -- (-260.005) (-260.267) [-263.963] (-264.654) * (-262.282) (-259.747) (-260.914) [-260.018] -- 0:00:46
300000 -- [-261.543] (-262.871) (-262.061) (-264.503) * (-261.546) [-262.279] (-260.371) (-260.661) -- 0:00:46
Average standard deviation of split frequencies: 0.017339
300500 -- (-262.452) (-261.784) (-260.620) [-261.283] * (-260.508) (-261.825) (-259.986) [-262.294] -- 0:00:46
301000 -- (-264.552) (-260.885) [-266.177] (-263.676) * (-261.489) (-261.519) [-261.083] (-262.220) -- 0:00:46
301500 -- (-263.864) [-263.847] (-259.566) (-261.480) * (-261.296) (-260.839) [-262.362] (-260.583) -- 0:00:46
302000 -- (-259.360) (-263.108) [-260.584] (-260.971) * (-263.037) (-265.178) (-264.250) [-260.150] -- 0:00:46
302500 -- (-260.869) (-260.875) (-262.516) [-260.219] * (-260.543) [-261.769] (-265.613) (-259.647) -- 0:00:46
303000 -- (-261.423) [-262.898] (-259.799) (-261.255) * [-262.101] (-263.063) (-260.274) (-260.615) -- 0:00:46
303500 -- (-262.731) (-262.746) [-261.572] (-260.336) * (-262.634) [-261.121] (-261.299) (-259.330) -- 0:00:45
304000 -- (-263.975) (-267.694) [-263.687] (-264.614) * [-261.553] (-261.680) (-263.332) (-260.203) -- 0:00:45
304500 -- [-261.726] (-262.649) (-261.695) (-260.962) * (-262.757) (-260.276) [-260.534] (-265.812) -- 0:00:45
305000 -- (-263.096) (-267.326) [-262.967] (-261.148) * (-262.601) (-261.947) (-263.043) [-260.826] -- 0:00:45
Average standard deviation of split frequencies: 0.016860
305500 -- (-263.742) (-259.317) (-261.295) [-260.669] * (-259.940) (-261.267) [-259.932] (-263.242) -- 0:00:45
306000 -- (-260.597) (-262.804) (-263.765) [-259.877] * (-264.554) (-262.624) (-262.071) [-260.918] -- 0:00:45
306500 -- [-260.358] (-260.311) (-261.449) (-259.880) * (-262.269) (-262.524) [-261.873] (-264.201) -- 0:00:45
307000 -- [-261.731] (-263.872) (-260.871) (-260.111) * [-260.942] (-262.433) (-260.650) (-259.761) -- 0:00:45
307500 -- (-262.253) (-262.228) [-260.327] (-260.074) * (-259.523) [-261.982] (-259.802) (-260.453) -- 0:00:45
308000 -- (-259.992) [-259.628] (-261.513) (-262.797) * [-259.924] (-262.014) (-265.094) (-264.436) -- 0:00:44
308500 -- (-261.828) (-261.041) (-265.153) [-262.339] * (-261.658) (-264.915) [-264.640] (-266.807) -- 0:00:44
309000 -- (-261.125) (-264.874) (-263.568) [-260.481] * [-261.113] (-263.689) (-261.761) (-260.869) -- 0:00:44
309500 -- (-261.701) (-263.222) [-260.863] (-260.135) * (-264.409) (-260.688) (-263.227) [-261.876] -- 0:00:44
310000 -- (-260.992) (-260.671) [-264.288] (-260.191) * (-260.188) [-261.103] (-260.925) (-262.983) -- 0:00:44
Average standard deviation of split frequencies: 0.016691
310500 -- [-260.145] (-259.661) (-260.305) (-263.807) * (-262.680) (-260.239) [-260.338] (-262.124) -- 0:00:44
311000 -- (-261.902) (-260.371) (-259.307) [-261.099] * (-261.764) (-261.151) (-259.896) [-259.036] -- 0:00:44
311500 -- (-260.481) (-264.254) (-264.384) [-264.732] * (-265.946) [-259.479] (-264.227) (-260.843) -- 0:00:44
312000 -- (-261.124) [-261.755] (-264.499) (-260.780) * (-260.400) [-262.792] (-260.639) (-258.919) -- 0:00:44
312500 -- [-259.597] (-259.685) (-263.441) (-260.638) * (-260.313) (-259.549) (-261.363) [-262.674] -- 0:00:44
313000 -- (-259.783) [-260.663] (-260.395) (-260.710) * (-260.645) (-261.242) [-262.157] (-263.540) -- 0:00:43
313500 -- (-264.639) [-261.644] (-259.759) (-260.489) * (-260.668) [-259.893] (-263.558) (-260.232) -- 0:00:43
314000 -- (-263.043) (-259.349) [-263.709] (-266.617) * (-262.036) (-260.232) (-262.383) [-261.427] -- 0:00:45
314500 -- (-259.808) (-259.810) [-264.372] (-262.533) * (-261.350) (-261.108) [-261.121] (-261.674) -- 0:00:45
315000 -- (-259.858) (-260.164) (-261.782) [-260.498] * [-261.468] (-261.492) (-260.683) (-259.697) -- 0:00:45
Average standard deviation of split frequencies: 0.016645
315500 -- (-262.989) (-260.732) (-263.478) [-261.355] * (-261.245) (-264.219) (-260.376) [-259.518] -- 0:00:45
316000 -- (-266.392) [-260.515] (-267.297) (-262.069) * [-261.115] (-260.328) (-262.715) (-261.252) -- 0:00:45
316500 -- (-263.643) (-261.325) (-263.908) [-260.917] * (-262.078) [-261.910] (-262.395) (-262.273) -- 0:00:45
317000 -- [-260.976] (-262.417) (-265.350) (-259.761) * (-261.168) [-260.424] (-259.842) (-262.301) -- 0:00:45
317500 -- [-261.821] (-261.250) (-261.283) (-261.251) * (-261.852) [-263.454] (-261.779) (-261.834) -- 0:00:45
318000 -- [-263.537] (-261.669) (-260.699) (-261.731) * (-260.632) (-261.691) [-261.469] (-266.355) -- 0:00:45
318500 -- [-260.590] (-260.850) (-265.341) (-259.759) * (-260.578) (-266.680) (-262.188) [-261.682] -- 0:00:44
319000 -- (-261.382) (-261.945) (-260.989) [-260.646] * [-261.158] (-262.954) (-263.397) (-260.311) -- 0:00:44
319500 -- [-260.661] (-263.442) (-260.300) (-260.042) * (-261.058) (-260.398) (-260.869) [-262.751] -- 0:00:44
320000 -- (-259.694) [-260.477] (-262.938) (-263.444) * (-260.310) (-259.963) [-259.780] (-265.446) -- 0:00:44
Average standard deviation of split frequencies: 0.016016
320500 -- [-261.385] (-262.413) (-259.325) (-261.271) * (-260.735) (-265.578) (-261.301) [-260.942] -- 0:00:44
321000 -- (-261.429) (-264.789) (-261.938) [-264.568] * (-263.477) [-260.404] (-262.274) (-261.579) -- 0:00:44
321500 -- (-262.748) (-261.101) (-264.709) [-259.577] * (-259.803) [-260.002] (-260.223) (-262.188) -- 0:00:44
322000 -- (-265.665) (-260.451) [-260.614] (-259.530) * [-260.075] (-262.579) (-261.041) (-260.989) -- 0:00:44
322500 -- (-263.444) [-259.149] (-260.173) (-262.817) * [-261.325] (-259.593) (-261.770) (-259.921) -- 0:00:44
323000 -- (-262.259) (-261.645) [-259.622] (-259.779) * (-260.618) (-262.317) [-261.649] (-260.995) -- 0:00:44
323500 -- (-263.117) (-259.873) [-262.065] (-266.687) * (-261.757) (-261.529) [-261.788] (-264.558) -- 0:00:43
324000 -- [-266.229] (-260.331) (-261.104) (-261.467) * [-266.419] (-261.811) (-264.558) (-260.237) -- 0:00:43
324500 -- [-267.048] (-261.980) (-258.984) (-264.692) * (-263.201) (-259.478) (-263.728) [-262.300] -- 0:00:43
325000 -- (-260.489) (-262.872) (-260.550) [-264.184] * [-261.602] (-262.047) (-262.374) (-264.558) -- 0:00:43
Average standard deviation of split frequencies: 0.015678
325500 -- (-261.677) (-260.695) (-262.020) [-261.150] * (-267.815) (-261.486) (-262.558) [-262.610] -- 0:00:43
326000 -- (-261.454) (-261.794) (-260.345) [-260.102] * (-262.773) (-260.840) [-267.042] (-259.351) -- 0:00:43
326500 -- (-261.327) (-263.273) (-261.957) [-260.957] * (-260.017) (-261.490) [-260.602] (-264.318) -- 0:00:43
327000 -- (-263.153) (-261.162) [-260.664] (-260.797) * [-260.964] (-260.897) (-261.558) (-261.597) -- 0:00:43
327500 -- (-264.955) (-260.741) [-261.777] (-262.052) * (-260.932) (-263.004) (-261.058) [-262.478] -- 0:00:43
328000 -- (-260.886) [-259.622] (-260.837) (-265.273) * [-259.707] (-263.672) (-260.056) (-259.914) -- 0:00:43
328500 -- (-263.661) (-259.379) [-263.531] (-262.245) * (-260.629) (-262.305) [-260.517] (-264.117) -- 0:00:42
329000 -- (-265.178) [-259.740] (-262.463) (-260.027) * (-261.850) [-260.612] (-262.595) (-261.825) -- 0:00:42
329500 -- (-262.796) (-261.730) [-259.910] (-262.607) * (-261.536) (-260.565) [-260.688] (-262.761) -- 0:00:42
330000 -- (-260.636) [-264.493] (-260.295) (-261.492) * (-261.748) (-262.827) (-260.430) [-263.459] -- 0:00:44
Average standard deviation of split frequencies: 0.015682
330500 -- (-261.036) (-260.825) (-264.421) [-259.176] * [-261.048] (-260.853) (-261.079) (-260.866) -- 0:00:44
331000 -- (-259.460) [-261.612] (-260.883) (-265.590) * (-260.942) (-260.294) (-263.932) [-260.810] -- 0:00:44
331500 -- [-262.163] (-265.006) (-263.557) (-261.927) * (-261.065) (-263.478) (-261.858) [-261.054] -- 0:00:44
332000 -- (-262.315) (-260.137) [-263.603] (-260.050) * (-261.899) (-261.412) (-263.344) [-259.620] -- 0:00:44
332500 -- (-260.276) (-259.631) [-262.647] (-262.091) * (-260.706) (-263.923) [-263.884] (-262.990) -- 0:00:44
333000 -- (-262.260) [-260.183] (-263.444) (-262.240) * (-262.464) [-260.482] (-260.250) (-259.770) -- 0:00:44
333500 -- (-262.683) (-261.363) (-262.952) [-260.362] * (-259.711) (-262.463) [-266.157] (-260.980) -- 0:00:43
334000 -- (-260.948) [-261.001] (-262.223) (-259.463) * (-260.000) (-262.288) (-262.709) [-259.426] -- 0:00:43
334500 -- (-261.289) (-261.128) (-261.650) [-263.140] * (-259.413) [-261.605] (-261.139) (-264.948) -- 0:00:43
335000 -- (-261.602) (-263.469) [-261.932] (-260.684) * [-260.222] (-261.898) (-263.773) (-260.240) -- 0:00:43
Average standard deviation of split frequencies: 0.013952
335500 -- [-261.690] (-260.773) (-264.266) (-262.109) * (-262.282) [-259.820] (-263.672) (-259.741) -- 0:00:43
336000 -- (-262.091) (-261.959) [-262.748] (-260.612) * (-266.922) (-263.562) [-262.775] (-260.536) -- 0:00:43
336500 -- (-258.969) (-262.795) [-260.046] (-260.572) * [-265.537] (-259.894) (-261.269) (-264.298) -- 0:00:43
337000 -- (-260.599) [-260.598] (-261.611) (-261.053) * (-262.262) (-260.323) [-260.513] (-262.345) -- 0:00:43
337500 -- (-265.157) (-263.188) [-261.211] (-259.809) * (-261.257) (-260.829) [-259.745] (-267.755) -- 0:00:43
338000 -- [-262.143] (-262.816) (-261.124) (-261.887) * (-264.983) (-261.932) [-259.780] (-262.869) -- 0:00:43
338500 -- (-259.833) [-263.650] (-260.482) (-261.186) * (-261.625) [-262.353] (-260.581) (-260.678) -- 0:00:42
339000 -- (-259.983) (-260.604) [-260.850] (-261.845) * (-267.970) (-260.198) (-260.805) [-263.026] -- 0:00:42
339500 -- (-260.466) [-260.072] (-264.627) (-261.525) * (-265.030) (-260.929) (-263.483) [-262.139] -- 0:00:42
340000 -- (-261.165) (-260.703) (-261.269) [-266.093] * (-262.251) (-263.809) [-263.071] (-260.739) -- 0:00:42
Average standard deviation of split frequencies: 0.014407
340500 -- (-262.130) (-263.045) [-260.567] (-266.283) * (-261.619) (-266.095) [-261.623] (-262.445) -- 0:00:42
341000 -- [-260.547] (-260.719) (-259.799) (-264.495) * (-262.398) (-265.619) (-262.549) [-260.309] -- 0:00:42
341500 -- (-261.920) (-262.371) (-262.271) [-260.644] * [-263.606] (-264.262) (-259.329) (-260.303) -- 0:00:42
342000 -- [-261.596] (-263.251) (-261.993) (-262.835) * (-263.737) [-259.405] (-260.255) (-259.964) -- 0:00:42
342500 -- (-262.019) [-263.856] (-263.053) (-261.773) * (-260.566) (-260.918) (-261.080) [-260.781] -- 0:00:42
343000 -- (-261.235) [-261.843] (-260.370) (-261.646) * (-260.221) (-264.028) (-260.414) [-262.847] -- 0:00:42
343500 -- [-259.920] (-262.352) (-261.085) (-260.863) * [-259.601] (-260.267) (-261.064) (-264.584) -- 0:00:42
344000 -- (-260.185) [-259.820] (-261.511) (-263.134) * (-264.927) [-261.150] (-261.097) (-262.633) -- 0:00:41
344500 -- (-263.291) [-261.238] (-260.159) (-268.456) * [-262.450] (-259.251) (-263.553) (-265.371) -- 0:00:41
345000 -- (-264.794) [-261.817] (-262.871) (-269.818) * (-259.991) (-263.375) (-262.762) [-260.638] -- 0:00:41
Average standard deviation of split frequencies: 0.014987
345500 -- [-262.541] (-261.338) (-262.503) (-272.505) * (-259.337) [-259.234] (-261.115) (-259.881) -- 0:00:43
346000 -- (-260.798) [-259.863] (-261.098) (-260.742) * (-259.687) [-260.134] (-260.447) (-267.883) -- 0:00:43
346500 -- (-268.406) [-260.782] (-259.847) (-262.531) * (-264.095) (-259.695) (-261.576) [-264.888] -- 0:00:43
347000 -- (-262.393) [-259.689] (-259.652) (-259.808) * [-264.448] (-266.417) (-260.006) (-263.696) -- 0:00:43
347500 -- (-259.855) (-259.784) (-260.854) [-259.905] * (-260.746) (-267.081) (-259.353) [-261.553] -- 0:00:43
348000 -- (-262.953) (-260.243) [-261.757] (-263.260) * (-259.237) [-267.852] (-260.163) (-262.574) -- 0:00:43
348500 -- (-259.813) [-261.538] (-264.062) (-259.959) * (-260.389) (-259.480) [-262.130] (-265.214) -- 0:00:42
349000 -- (-261.934) (-262.082) [-263.859] (-262.590) * (-261.338) (-260.416) (-263.057) [-259.661] -- 0:00:42
349500 -- (-263.628) (-259.373) (-266.244) [-259.479] * (-261.473) (-261.382) (-262.679) [-261.092] -- 0:00:42
350000 -- (-262.236) (-259.670) (-266.583) [-264.090] * (-262.011) (-262.864) (-263.652) [-261.575] -- 0:00:42
Average standard deviation of split frequencies: 0.014946
350500 -- (-269.384) (-261.527) (-261.975) [-259.904] * (-261.492) (-262.411) [-259.222] (-261.743) -- 0:00:42
351000 -- [-260.075] (-262.870) (-262.584) (-264.159) * (-261.649) (-261.662) [-260.963] (-262.196) -- 0:00:42
351500 -- (-261.819) (-262.421) [-259.647] (-261.706) * (-259.932) (-260.853) (-261.586) [-261.415] -- 0:00:42
352000 -- (-263.382) (-259.902) [-261.680] (-265.909) * (-259.946) [-268.015] (-261.346) (-261.559) -- 0:00:42
352500 -- [-260.591] (-261.233) (-263.032) (-267.206) * (-262.280) (-260.930) (-259.712) [-260.265] -- 0:00:42
353000 -- (-259.911) (-259.625) (-263.094) [-263.663] * (-263.152) (-260.158) (-260.357) [-263.836] -- 0:00:42
353500 -- (-260.344) (-261.606) (-266.250) [-260.954] * (-261.700) [-260.876] (-261.666) (-262.356) -- 0:00:42
354000 -- (-263.228) (-262.029) (-264.301) [-262.305] * [-264.629] (-260.454) (-262.456) (-263.056) -- 0:00:41
354500 -- (-259.908) (-261.838) (-263.466) [-260.516] * (-261.389) (-261.912) [-262.492] (-263.961) -- 0:00:41
355000 -- (-260.172) (-261.222) (-262.044) [-264.217] * (-263.228) (-261.072) [-261.980] (-262.890) -- 0:00:41
Average standard deviation of split frequencies: 0.014198
355500 -- [-260.473] (-262.382) (-260.629) (-261.325) * [-261.863] (-260.091) (-263.866) (-262.045) -- 0:00:41
356000 -- (-260.248) [-259.710] (-260.784) (-260.023) * (-260.833) (-261.762) [-259.320] (-260.632) -- 0:00:41
356500 -- [-261.596] (-259.553) (-260.787) (-260.164) * (-263.024) (-259.986) (-261.196) [-262.054] -- 0:00:41
357000 -- (-260.532) (-260.625) (-263.275) [-261.641] * [-259.776] (-261.084) (-261.828) (-260.027) -- 0:00:41
357500 -- (-260.755) (-261.183) (-260.594) [-260.878] * (-260.764) [-260.693] (-263.924) (-262.050) -- 0:00:41
358000 -- (-260.781) (-259.176) [-260.286] (-259.712) * [-262.085] (-262.009) (-262.565) (-261.713) -- 0:00:41
358500 -- [-259.540] (-259.690) (-261.565) (-261.820) * (-262.179) (-260.582) (-260.333) [-260.317] -- 0:00:41
359000 -- (-260.750) [-260.208] (-263.379) (-262.618) * (-265.694) (-260.425) (-261.189) [-264.985] -- 0:00:41
359500 -- [-259.924] (-262.102) (-266.064) (-260.490) * [-262.424] (-260.143) (-263.672) (-260.064) -- 0:00:40
360000 -- (-260.905) (-259.793) (-265.097) [-261.160] * (-262.687) (-261.311) [-260.502] (-261.417) -- 0:00:40
Average standard deviation of split frequencies: 0.014087
360500 -- (-260.322) (-263.338) (-264.328) [-259.790] * (-260.863) (-261.883) [-261.943] (-260.745) -- 0:00:42
361000 -- (-260.349) (-259.671) [-261.463] (-260.233) * (-261.709) (-263.131) [-259.689] (-262.901) -- 0:00:42
361500 -- (-259.594) (-259.722) [-263.264] (-262.329) * (-260.469) (-261.803) [-260.418] (-260.334) -- 0:00:42
362000 -- (-263.090) (-260.563) [-266.282] (-261.367) * (-264.871) (-262.462) (-261.156) [-261.387] -- 0:00:42
362500 -- (-260.656) (-261.139) [-264.198] (-260.155) * [-259.739] (-262.292) (-262.591) (-260.139) -- 0:00:42
363000 -- (-262.497) (-259.502) [-261.777] (-260.694) * (-260.741) (-260.214) (-259.782) [-262.081] -- 0:00:42
363500 -- (-261.558) [-261.150] (-259.362) (-264.316) * (-261.332) (-262.235) (-260.765) [-259.592] -- 0:00:42
364000 -- (-263.345) (-260.497) (-261.211) [-263.672] * [-262.084] (-259.562) (-261.887) (-261.502) -- 0:00:41
364500 -- (-259.720) (-260.009) [-260.637] (-263.583) * [-259.209] (-261.549) (-260.377) (-263.288) -- 0:00:41
365000 -- (-261.592) (-261.628) [-261.069] (-259.935) * [-260.344] (-259.377) (-262.563) (-261.114) -- 0:00:41
Average standard deviation of split frequencies: 0.013309
365500 -- (-262.074) [-261.446] (-261.591) (-260.684) * (-260.599) (-260.485) (-263.202) [-262.069] -- 0:00:41
366000 -- (-261.455) (-262.977) [-260.065] (-261.025) * (-259.868) [-259.993] (-261.618) (-260.937) -- 0:00:41
366500 -- (-262.131) (-262.905) [-261.826] (-259.635) * (-260.235) [-259.382] (-260.000) (-262.934) -- 0:00:41
367000 -- (-262.782) [-260.164] (-264.452) (-259.739) * [-261.076] (-260.322) (-263.298) (-262.618) -- 0:00:41
367500 -- [-263.131] (-262.707) (-260.763) (-259.821) * [-259.818] (-263.445) (-261.877) (-262.302) -- 0:00:41
368000 -- (-262.763) (-259.521) (-259.865) [-261.882] * (-265.270) (-260.642) (-261.866) [-261.391] -- 0:00:41
368500 -- (-262.853) [-259.917] (-260.585) (-259.547) * (-265.620) (-260.552) (-261.177) [-260.115] -- 0:00:41
369000 -- (-261.312) (-267.831) [-259.816] (-261.702) * (-259.736) [-261.601] (-265.136) (-263.699) -- 0:00:41
369500 -- [-263.047] (-261.329) (-259.712) (-261.745) * (-265.129) (-260.698) (-261.407) [-262.804] -- 0:00:40
370000 -- (-260.518) (-261.521) (-262.019) [-260.817] * (-262.585) (-262.239) [-260.558] (-260.750) -- 0:00:40
Average standard deviation of split frequencies: 0.014272
370500 -- [-260.441] (-260.975) (-260.826) (-265.367) * (-265.131) [-260.112] (-260.780) (-264.263) -- 0:00:40
371000 -- (-259.593) [-261.938] (-260.688) (-262.295) * (-260.443) (-260.207) (-260.893) [-261.296] -- 0:00:40
371500 -- [-259.854] (-262.087) (-260.905) (-259.226) * (-260.502) (-260.958) [-261.245] (-266.222) -- 0:00:40
372000 -- (-259.272) (-263.181) [-262.047] (-260.007) * [-261.177] (-261.839) (-259.418) (-258.921) -- 0:00:40
372500 -- (-262.685) (-262.460) [-264.004] (-262.373) * [-263.202] (-260.146) (-260.079) (-259.702) -- 0:00:40
373000 -- (-265.214) (-265.776) (-262.211) [-261.236] * [-265.854] (-264.186) (-259.785) (-260.901) -- 0:00:40
373500 -- (-259.728) (-259.717) [-259.959] (-259.824) * (-260.362) (-264.205) [-261.647] (-261.326) -- 0:00:40
374000 -- (-262.127) [-264.764] (-262.822) (-261.626) * (-260.929) [-266.779] (-269.053) (-260.598) -- 0:00:40
374500 -- (-260.185) [-261.335] (-261.819) (-262.050) * (-261.144) (-261.378) (-261.263) [-262.072] -- 0:00:40
375000 -- [-259.812] (-263.436) (-261.940) (-260.298) * (-261.878) (-261.367) [-260.905] (-258.934) -- 0:00:40
Average standard deviation of split frequencies: 0.013652
375500 -- (-260.848) (-262.826) (-264.360) [-262.408] * [-260.439] (-261.552) (-260.874) (-259.682) -- 0:00:39
376000 -- (-261.216) (-261.404) [-261.351] (-262.194) * (-266.724) [-259.280] (-264.318) (-260.128) -- 0:00:39
376500 -- (-261.495) (-260.554) [-260.667] (-263.861) * (-265.731) (-260.216) [-262.765] (-263.399) -- 0:00:41
377000 -- (-259.556) (-262.003) [-264.610] (-265.414) * (-263.504) (-261.256) (-262.616) [-260.218] -- 0:00:41
377500 -- (-259.314) [-259.732] (-263.256) (-259.708) * (-264.157) (-259.979) [-264.579] (-264.060) -- 0:00:41
378000 -- (-260.750) (-261.406) [-260.333] (-264.686) * (-259.973) (-267.667) (-261.221) [-263.666] -- 0:00:41
378500 -- [-259.785] (-259.655) (-259.982) (-259.357) * [-261.241] (-260.994) (-260.745) (-259.752) -- 0:00:41
379000 -- [-261.697] (-259.362) (-262.339) (-261.150) * (-263.257) (-261.364) (-262.385) [-260.473] -- 0:00:40
379500 -- (-262.342) (-261.031) [-261.491] (-263.053) * (-266.444) (-261.272) (-264.015) [-264.358] -- 0:00:40
380000 -- (-261.986) (-262.184) (-261.985) [-260.733] * [-261.942] (-262.469) (-264.459) (-260.883) -- 0:00:40
Average standard deviation of split frequencies: 0.014991
380500 -- (-260.671) (-266.045) (-261.970) [-263.849] * (-262.983) (-263.346) [-259.583] (-260.456) -- 0:00:40
381000 -- [-261.157] (-266.460) (-262.197) (-266.649) * (-262.564) [-258.836] (-260.141) (-259.313) -- 0:00:40
381500 -- (-264.411) (-261.213) [-261.398] (-262.810) * (-264.686) (-259.847) [-260.943] (-260.393) -- 0:00:40
382000 -- (-261.091) (-259.411) [-259.488] (-265.652) * (-261.587) [-259.281] (-261.118) (-260.362) -- 0:00:40
382500 -- [-263.672] (-259.715) (-260.101) (-263.217) * (-261.033) [-260.357] (-261.378) (-261.245) -- 0:00:40
383000 -- (-260.432) [-260.170] (-262.197) (-263.747) * (-260.995) [-260.820] (-264.377) (-262.613) -- 0:00:40
383500 -- (-264.142) (-259.926) [-260.585] (-260.163) * (-262.654) (-267.000) (-259.905) [-260.210] -- 0:00:40
384000 -- (-264.007) (-260.882) [-263.179] (-260.116) * (-263.666) (-261.162) [-263.444] (-260.107) -- 0:00:40
384500 -- (-262.150) [-259.973] (-262.269) (-259.891) * [-262.514] (-261.355) (-262.496) (-260.659) -- 0:00:40
385000 -- (-259.418) [-261.861] (-259.956) (-263.170) * (-261.236) (-264.258) (-261.596) [-260.608] -- 0:00:39
Average standard deviation of split frequencies: 0.014180
385500 -- [-260.299] (-260.634) (-260.298) (-261.274) * [-259.925] (-262.600) (-259.987) (-263.753) -- 0:00:39
386000 -- (-259.955) (-262.294) [-260.499] (-261.199) * (-261.053) (-261.449) [-261.963] (-262.194) -- 0:00:39
386500 -- [-261.639] (-260.045) (-258.822) (-260.996) * (-263.578) [-262.559] (-262.611) (-259.818) -- 0:00:39
387000 -- [-259.897] (-259.643) (-259.354) (-263.626) * (-259.664) (-260.355) (-259.864) [-260.672] -- 0:00:39
387500 -- (-260.359) (-260.697) [-260.279] (-262.104) * [-259.940] (-259.966) (-259.353) (-260.580) -- 0:00:39
388000 -- (-259.269) (-260.027) [-260.557] (-261.673) * (-260.134) (-259.403) [-260.716] (-260.931) -- 0:00:39
388500 -- (-260.694) [-261.084] (-261.975) (-265.332) * (-259.818) (-260.568) (-265.824) [-263.985] -- 0:00:39
389000 -- [-260.547] (-260.791) (-259.840) (-264.066) * (-261.459) (-264.071) (-259.494) [-261.952] -- 0:00:39
389500 -- (-260.958) (-267.576) (-260.414) [-264.071] * [-261.520] (-262.524) (-262.108) (-267.951) -- 0:00:39
390000 -- (-260.916) (-267.909) (-260.017) [-260.678] * [-260.560] (-260.813) (-261.295) (-259.254) -- 0:00:39
Average standard deviation of split frequencies: 0.014413
390500 -- (-261.261) (-261.024) (-262.146) [-262.873] * (-259.306) (-263.203) (-262.243) [-260.411] -- 0:00:39
391000 -- (-263.026) [-259.645] (-261.871) (-260.117) * (-259.666) (-259.800) [-261.040] (-261.289) -- 0:00:38
391500 -- [-261.159] (-260.041) (-263.587) (-260.068) * (-263.193) (-259.588) (-267.008) [-259.060] -- 0:00:38
392000 -- (-259.948) [-260.285] (-261.508) (-259.989) * (-261.641) [-261.358] (-263.388) (-265.930) -- 0:00:40
392500 -- (-262.164) (-260.911) (-261.898) [-260.266] * (-259.330) [-261.273] (-259.203) (-259.671) -- 0:00:40
393000 -- (-264.411) (-261.449) (-260.345) [-259.096] * [-259.766] (-260.944) (-261.834) (-260.420) -- 0:00:40
393500 -- [-263.737] (-261.822) (-260.534) (-259.613) * (-260.464) [-260.581] (-260.865) (-260.057) -- 0:00:40
394000 -- (-265.557) (-259.307) (-261.337) [-260.381] * [-261.048] (-260.055) (-260.258) (-261.750) -- 0:00:39
394500 -- (-260.618) (-260.034) [-259.427] (-260.699) * (-261.504) [-260.229] (-260.206) (-260.214) -- 0:00:39
395000 -- (-261.881) [-259.972] (-259.083) (-260.388) * (-259.589) (-262.102) (-261.163) [-259.630] -- 0:00:39
Average standard deviation of split frequencies: 0.014087
395500 -- (-263.604) (-259.668) (-259.821) [-262.312] * (-259.997) (-260.011) [-261.337] (-261.258) -- 0:00:39
396000 -- (-263.025) [-260.414] (-267.288) (-261.804) * [-261.300] (-260.542) (-265.191) (-260.237) -- 0:00:39
396500 -- (-260.845) (-260.451) (-259.649) [-259.518] * (-260.687) [-263.313] (-259.959) (-263.052) -- 0:00:39
397000 -- (-266.864) (-262.978) (-263.581) [-259.466] * (-260.797) [-260.858] (-260.553) (-264.585) -- 0:00:39
397500 -- [-265.653] (-261.405) (-259.805) (-262.950) * (-259.074) (-267.998) (-263.207) [-259.679] -- 0:00:39
398000 -- (-259.480) (-260.514) [-259.867] (-262.459) * (-260.949) (-264.487) (-262.246) [-263.490] -- 0:00:39
398500 -- (-261.949) [-260.775] (-262.226) (-263.534) * [-259.880] (-262.286) (-264.209) (-259.880) -- 0:00:39
399000 -- (-261.610) [-260.981] (-259.438) (-261.633) * (-260.414) (-264.283) [-261.151] (-262.587) -- 0:00:39
399500 -- (-260.793) (-260.638) [-259.683] (-262.117) * (-262.240) (-262.416) [-260.109] (-263.081) -- 0:00:39
400000 -- (-260.632) [-259.673] (-260.757) (-265.786) * (-262.977) [-264.607] (-260.665) (-260.520) -- 0:00:39
Average standard deviation of split frequencies: 0.013773
400500 -- (-260.524) (-259.536) (-259.774) [-263.176] * (-259.145) [-259.488] (-264.687) (-260.610) -- 0:00:38
401000 -- (-259.955) [-265.107] (-259.385) (-261.231) * [-260.650] (-263.066) (-259.312) (-261.667) -- 0:00:38
401500 -- (-260.610) [-262.144] (-262.071) (-259.831) * [-259.864] (-261.267) (-259.964) (-261.956) -- 0:00:38
402000 -- [-261.067] (-260.945) (-261.501) (-260.300) * (-259.461) [-262.540] (-262.130) (-264.026) -- 0:00:38
402500 -- (-260.015) (-260.451) [-259.390] (-262.427) * (-260.313) (-261.173) [-260.606] (-261.071) -- 0:00:38
403000 -- (-264.686) [-263.361] (-262.190) (-260.228) * (-260.244) [-259.988] (-261.200) (-260.743) -- 0:00:38
403500 -- (-261.717) (-261.016) [-264.290] (-262.123) * (-263.988) (-261.271) (-265.080) [-260.621] -- 0:00:38
404000 -- (-263.319) [-260.625] (-261.571) (-264.291) * (-263.800) (-265.151) (-261.785) [-260.592] -- 0:00:38
404500 -- (-264.629) [-260.917] (-262.948) (-265.543) * (-264.862) (-263.121) [-260.979] (-263.016) -- 0:00:38
405000 -- (-263.151) [-259.784] (-262.091) (-262.419) * [-262.947] (-261.090) (-268.117) (-259.936) -- 0:00:38
Average standard deviation of split frequencies: 0.014548
405500 -- (-259.617) (-260.223) (-264.377) [-259.879] * (-262.312) [-263.165] (-261.036) (-260.443) -- 0:00:38
406000 -- (-260.014) (-261.858) (-262.327) [-260.603] * (-260.515) (-262.408) [-261.924] (-262.235) -- 0:00:38
406500 -- (-260.186) (-262.028) [-261.617] (-260.291) * (-259.007) (-263.800) (-264.116) [-260.521] -- 0:00:39
407000 -- (-259.730) [-260.871] (-260.801) (-263.358) * [-258.976] (-265.204) (-260.183) (-260.559) -- 0:00:39
407500 -- [-259.703] (-259.398) (-268.394) (-261.129) * [-259.749] (-265.024) (-260.309) (-262.217) -- 0:00:39
408000 -- (-259.412) [-260.406] (-267.622) (-263.361) * (-263.327) (-260.682) [-260.420] (-259.519) -- 0:00:39
408500 -- [-262.260] (-259.440) (-261.634) (-260.731) * (-260.978) [-259.907] (-263.248) (-262.434) -- 0:00:39
409000 -- [-264.576] (-264.447) (-261.143) (-259.959) * (-261.605) [-260.294] (-262.708) (-261.095) -- 0:00:39
409500 -- (-268.288) [-261.661] (-261.968) (-260.719) * (-261.805) (-261.989) [-262.024] (-262.294) -- 0:00:38
410000 -- (-265.755) (-265.124) (-261.202) [-259.325] * (-264.943) (-264.313) (-261.173) [-263.890] -- 0:00:38
Average standard deviation of split frequencies: 0.013990
410500 -- (-264.487) [-260.467] (-260.107) (-259.570) * [-262.462] (-261.050) (-262.817) (-261.989) -- 0:00:38
411000 -- (-263.110) (-260.685) [-259.031] (-261.618) * (-260.635) (-259.756) (-264.173) [-265.813] -- 0:00:38
411500 -- (-263.663) (-261.407) (-260.002) [-260.710] * [-259.734] (-259.959) (-262.503) (-267.079) -- 0:00:38
412000 -- (-267.203) (-261.727) [-260.315] (-262.576) * [-261.194] (-260.528) (-263.028) (-263.269) -- 0:00:38
412500 -- [-260.187] (-264.105) (-260.540) (-261.463) * (-259.280) (-260.475) (-261.013) [-262.538] -- 0:00:38
413000 -- (-264.227) (-261.949) [-259.702] (-261.916) * [-261.512] (-259.960) (-260.195) (-263.177) -- 0:00:38
413500 -- (-261.919) (-260.422) (-260.757) [-260.352] * [-264.942] (-262.695) (-260.614) (-261.258) -- 0:00:38
414000 -- (-260.637) (-263.234) (-260.405) [-262.537] * (-262.776) (-260.337) [-260.348] (-264.170) -- 0:00:38
414500 -- [-260.445] (-260.368) (-262.178) (-267.048) * [-263.048] (-263.558) (-262.217) (-260.634) -- 0:00:38
415000 -- (-267.175) [-261.726] (-262.818) (-265.245) * (-261.940) (-263.839) [-260.072] (-262.700) -- 0:00:38
Average standard deviation of split frequencies: 0.013457
415500 -- (-261.080) (-267.542) [-263.289] (-262.670) * [-263.558] (-261.129) (-261.424) (-260.818) -- 0:00:37
416000 -- (-260.768) (-262.541) [-259.632] (-260.487) * (-261.869) (-261.314) (-261.144) [-260.500] -- 0:00:37
416500 -- [-263.587] (-259.856) (-261.905) (-261.167) * [-261.110] (-260.582) (-261.453) (-260.406) -- 0:00:37
417000 -- (-264.361) (-260.923) [-262.791] (-264.514) * [-260.549] (-260.873) (-262.139) (-263.876) -- 0:00:37
417500 -- (-266.703) [-266.330] (-262.539) (-261.919) * (-261.150) (-263.255) [-260.893] (-264.981) -- 0:00:37
418000 -- (-261.826) (-263.062) [-261.657] (-262.092) * (-261.337) (-260.777) [-261.547] (-261.626) -- 0:00:37
418500 -- (-261.805) (-262.312) [-261.385] (-261.952) * (-264.348) (-260.854) (-262.814) [-263.291] -- 0:00:37
419000 -- (-262.242) (-262.908) (-259.777) [-261.772] * [-262.872] (-262.149) (-260.384) (-262.673) -- 0:00:37
419500 -- (-263.662) [-262.375] (-263.103) (-261.846) * (-265.340) [-259.174] (-259.850) (-265.393) -- 0:00:37
420000 -- (-263.579) [-261.962] (-261.271) (-267.274) * (-262.030) [-261.782] (-259.949) (-262.715) -- 0:00:37
Average standard deviation of split frequencies: 0.014120
420500 -- (-263.786) (-263.201) (-262.182) [-264.113] * (-260.360) (-259.345) (-259.535) [-261.751] -- 0:00:37
421000 -- (-263.007) [-260.593] (-259.180) (-267.317) * [-261.285] (-261.968) (-259.392) (-261.206) -- 0:00:37
421500 -- (-265.319) (-262.437) [-259.379] (-261.069) * (-268.225) [-261.708] (-262.464) (-260.679) -- 0:00:37
422000 -- (-261.798) [-260.892] (-261.114) (-259.598) * (-264.844) [-260.422] (-263.596) (-261.607) -- 0:00:38
422500 -- (-262.256) [-261.655] (-259.394) (-262.010) * [-261.606] (-260.770) (-259.596) (-261.405) -- 0:00:38
423000 -- [-259.459] (-260.185) (-262.518) (-268.550) * (-260.401) [-261.563] (-263.049) (-263.951) -- 0:00:38
423500 -- (-262.560) (-261.260) (-261.958) [-265.509] * (-259.591) (-261.038) [-260.247] (-262.983) -- 0:00:38
424000 -- (-261.155) (-262.721) [-261.899] (-261.177) * (-259.861) [-260.444] (-261.054) (-259.484) -- 0:00:38
424500 -- (-262.095) [-263.327] (-261.970) (-261.496) * (-259.023) [-260.028] (-266.483) (-260.993) -- 0:00:37
425000 -- (-260.395) (-262.078) [-260.844] (-259.649) * [-260.058] (-261.324) (-261.875) (-260.183) -- 0:00:37
Average standard deviation of split frequencies: 0.013971
425500 -- (-259.858) (-260.515) (-260.341) [-259.912] * [-260.835] (-264.977) (-261.718) (-261.102) -- 0:00:37
426000 -- (-262.414) (-264.625) (-262.708) [-260.052] * (-262.871) (-263.068) (-259.422) [-261.478] -- 0:00:37
426500 -- [-260.058] (-260.532) (-260.835) (-262.038) * [-265.082] (-264.077) (-259.889) (-261.264) -- 0:00:37
427000 -- (-259.506) [-260.276] (-264.828) (-259.419) * (-261.600) (-263.696) [-263.483] (-259.365) -- 0:00:37
427500 -- (-259.999) (-260.031) (-264.095) [-259.608] * [-260.432] (-260.182) (-263.610) (-258.975) -- 0:00:37
428000 -- (-259.789) (-259.400) (-259.848) [-261.210] * [-264.256] (-263.165) (-260.047) (-262.437) -- 0:00:37
428500 -- [-260.527] (-260.848) (-270.289) (-265.724) * (-261.742) [-259.615] (-262.881) (-260.139) -- 0:00:37
429000 -- (-261.505) (-262.256) (-262.682) [-260.673] * (-265.834) [-259.611] (-263.671) (-259.961) -- 0:00:37
429500 -- [-260.582] (-262.489) (-261.995) (-263.992) * [-260.494] (-259.131) (-262.114) (-261.449) -- 0:00:37
430000 -- (-262.741) (-262.503) [-260.266] (-262.081) * (-261.881) [-262.598] (-263.030) (-261.850) -- 0:00:37
Average standard deviation of split frequencies: 0.014093
430500 -- (-261.192) [-260.698] (-261.190) (-265.484) * (-266.163) (-259.625) (-259.622) [-261.355] -- 0:00:37
431000 -- (-268.367) (-261.586) [-259.925] (-270.901) * (-263.379) (-262.129) [-260.169] (-259.949) -- 0:00:36
431500 -- (-260.849) (-260.616) (-260.493) [-265.402] * (-264.624) [-260.108] (-265.085) (-259.469) -- 0:00:36
432000 -- (-261.169) [-260.842] (-264.717) (-263.244) * (-259.716) [-261.906] (-263.577) (-261.746) -- 0:00:36
432500 -- [-260.655] (-263.893) (-261.474) (-265.586) * [-261.316] (-263.451) (-262.933) (-261.992) -- 0:00:36
433000 -- (-262.067) (-261.919) (-261.026) [-265.950] * (-260.577) [-263.719] (-267.221) (-260.613) -- 0:00:36
433500 -- (-259.376) [-259.663] (-261.152) (-262.771) * (-264.342) (-259.542) [-259.656] (-264.679) -- 0:00:36
434000 -- (-260.347) (-261.181) [-259.841] (-260.942) * (-261.340) (-264.341) [-260.391] (-263.018) -- 0:00:36
434500 -- [-259.221] (-259.927) (-260.222) (-262.034) * [-260.138] (-259.117) (-261.079) (-263.258) -- 0:00:36
435000 -- (-261.023) (-261.975) [-262.223] (-262.069) * [-261.120] (-263.838) (-260.497) (-261.333) -- 0:00:36
Average standard deviation of split frequencies: 0.013650
435500 -- (-262.926) (-260.136) (-262.947) [-259.613] * (-261.555) [-259.945] (-259.677) (-261.383) -- 0:00:36
436000 -- (-264.520) [-260.457] (-264.832) (-261.758) * (-261.799) (-260.405) (-265.101) [-260.649] -- 0:00:36
436500 -- (-264.560) [-259.653] (-265.229) (-261.013) * (-259.881) [-259.641] (-261.130) (-263.237) -- 0:00:36
437000 -- [-259.571] (-262.184) (-260.152) (-259.474) * (-261.521) [-263.260] (-259.856) (-261.649) -- 0:00:36
437500 -- (-260.667) (-261.143) (-260.091) [-263.025] * (-260.330) (-260.288) [-259.959] (-259.926) -- 0:00:36
438000 -- (-262.470) (-260.352) (-261.845) [-260.930] * (-259.932) (-260.225) (-265.872) [-261.045] -- 0:00:37
438500 -- [-260.464] (-260.401) (-264.373) (-261.492) * [-262.436] (-261.011) (-261.214) (-259.836) -- 0:00:37
439000 -- (-260.305) (-261.890) (-259.490) [-266.545] * (-259.984) [-262.395] (-262.303) (-259.162) -- 0:00:37
439500 -- (-262.774) [-259.712] (-260.405) (-262.653) * (-261.147) (-260.722) (-260.654) [-264.177] -- 0:00:36
440000 -- (-262.877) (-260.515) [-259.592] (-261.388) * [-262.730] (-260.218) (-260.343) (-264.839) -- 0:00:36
Average standard deviation of split frequencies: 0.013907
440500 -- [-262.307] (-261.569) (-260.039) (-260.540) * [-260.057] (-260.392) (-260.787) (-259.728) -- 0:00:36
441000 -- (-262.552) (-261.356) [-261.875] (-261.339) * [-261.013] (-259.579) (-260.269) (-259.670) -- 0:00:36
441500 -- (-261.112) (-260.251) (-261.781) [-260.338] * (-259.842) (-259.497) (-259.704) [-260.624] -- 0:00:36
442000 -- (-260.631) (-262.512) (-259.775) [-262.259] * (-262.958) (-260.848) [-261.233] (-264.585) -- 0:00:36
442500 -- (-260.428) (-261.621) (-261.656) [-259.779] * [-269.071] (-260.052) (-261.455) (-263.882) -- 0:00:36
443000 -- (-261.451) [-262.066] (-260.333) (-260.498) * (-261.697) [-260.089] (-260.596) (-264.217) -- 0:00:36
443500 -- (-262.639) (-265.410) (-260.246) [-260.923] * [-260.119] (-264.898) (-262.079) (-264.755) -- 0:00:36
444000 -- (-261.627) (-262.696) (-260.866) [-262.030] * (-259.501) (-262.568) [-261.608] (-263.834) -- 0:00:36
444500 -- (-260.088) [-263.107] (-261.168) (-263.644) * (-261.193) [-261.358] (-259.067) (-259.888) -- 0:00:36
445000 -- (-261.485) [-260.873] (-259.402) (-260.903) * (-263.948) (-263.004) [-259.172] (-259.891) -- 0:00:36
Average standard deviation of split frequencies: 0.013807
445500 -- (-265.909) (-259.240) (-261.494) [-260.863] * (-260.308) (-259.718) (-259.668) [-260.596] -- 0:00:36
446000 -- (-260.013) (-259.285) (-261.422) [-261.328] * (-260.690) (-260.725) [-259.236] (-261.248) -- 0:00:36
446500 -- (-261.126) (-259.278) (-262.161) [-263.070] * (-261.488) [-260.242] (-266.937) (-264.339) -- 0:00:35
447000 -- (-259.888) (-261.382) (-259.826) [-262.033] * [-263.036] (-262.957) (-260.025) (-262.497) -- 0:00:35
447500 -- (-261.795) [-259.426] (-263.984) (-264.461) * [-261.878] (-260.972) (-262.195) (-266.243) -- 0:00:35
448000 -- (-263.802) [-260.406] (-261.846) (-260.373) * [-260.001] (-262.960) (-262.423) (-260.672) -- 0:00:35
448500 -- (-261.484) (-262.523) (-264.806) [-261.471] * [-260.045] (-262.210) (-261.408) (-264.891) -- 0:00:35
449000 -- (-260.104) (-264.442) [-261.522] (-262.912) * [-260.860] (-259.767) (-263.538) (-263.136) -- 0:00:35
449500 -- (-260.953) (-267.609) (-263.373) [-260.025] * (-259.937) [-260.020] (-261.597) (-260.197) -- 0:00:35
450000 -- [-261.710] (-265.476) (-259.342) (-260.402) * [-260.732] (-263.074) (-264.663) (-259.175) -- 0:00:35
Average standard deviation of split frequencies: 0.013075
450500 -- (-260.304) (-264.075) (-260.934) [-261.776] * (-263.873) (-261.972) [-263.209] (-259.289) -- 0:00:35
451000 -- (-262.783) (-262.480) (-259.944) [-262.272] * [-259.779] (-262.009) (-265.421) (-260.521) -- 0:00:35
451500 -- (-261.300) [-263.709] (-260.112) (-263.278) * (-260.153) (-264.614) [-259.129] (-262.834) -- 0:00:35
452000 -- (-260.958) (-261.147) (-262.304) [-259.836] * [-262.035] (-266.986) (-262.068) (-265.395) -- 0:00:35
452500 -- [-262.780] (-261.225) (-262.648) (-260.751) * (-261.537) (-261.345) [-260.551] (-262.888) -- 0:00:35
453000 -- (-260.979) (-265.085) (-260.864) [-260.168] * (-261.152) (-261.246) (-261.263) [-259.749] -- 0:00:35
453500 -- (-261.005) [-265.982] (-260.601) (-260.217) * [-260.317] (-260.362) (-260.122) (-261.048) -- 0:00:34
454000 -- (-263.124) [-260.628] (-264.785) (-260.826) * (-260.892) [-262.991] (-260.239) (-263.253) -- 0:00:36
454500 -- (-262.702) [-261.626] (-264.779) (-260.131) * (-259.738) (-260.397) (-261.410) [-260.916] -- 0:00:36
455000 -- (-262.875) (-263.852) (-265.044) [-260.243] * (-259.300) (-260.521) [-260.009] (-260.528) -- 0:00:35
Average standard deviation of split frequencies: 0.012599
455500 -- (-262.110) (-261.044) [-261.857] (-260.072) * [-259.798] (-261.999) (-260.504) (-261.684) -- 0:00:35
456000 -- (-259.571) (-261.004) (-262.254) [-263.140] * (-268.135) [-263.310] (-261.875) (-263.990) -- 0:00:35
456500 -- (-260.521) (-259.764) (-259.828) [-260.339] * (-265.068) (-261.558) (-259.590) [-259.344] -- 0:00:35
457000 -- [-259.842] (-260.412) (-260.596) (-259.662) * (-263.312) [-261.043] (-260.877) (-259.339) -- 0:00:35
457500 -- (-259.068) [-260.075] (-263.697) (-260.211) * (-258.971) (-260.916) (-261.438) [-259.224] -- 0:00:35
458000 -- (-259.251) (-261.278) [-260.801] (-260.127) * [-262.654] (-261.844) (-262.447) (-259.734) -- 0:00:35
458500 -- (-260.269) (-259.511) (-260.562) [-260.737] * [-261.004] (-261.166) (-263.412) (-262.496) -- 0:00:35
459000 -- (-260.875) (-265.792) [-261.912] (-260.112) * (-260.401) (-260.282) (-264.519) [-260.857] -- 0:00:35
459500 -- (-259.400) (-264.780) [-260.260] (-260.222) * (-266.508) (-261.875) [-260.838] (-265.328) -- 0:00:35
460000 -- [-259.025] (-260.796) (-264.065) (-266.699) * (-261.294) [-260.030] (-265.567) (-266.390) -- 0:00:35
Average standard deviation of split frequencies: 0.012919
460500 -- [-264.488] (-261.103) (-263.948) (-261.847) * (-259.368) [-261.683] (-260.751) (-266.453) -- 0:00:35
461000 -- (-265.179) (-264.324) [-265.542] (-262.503) * (-259.993) (-265.646) [-261.390] (-263.091) -- 0:00:35
461500 -- (-260.653) (-264.298) [-260.959] (-262.912) * [-261.473] (-263.861) (-262.299) (-263.341) -- 0:00:35
462000 -- (-262.445) [-263.108] (-262.667) (-266.778) * [-259.696] (-262.252) (-264.757) (-261.088) -- 0:00:34
462500 -- (-260.792) (-260.174) [-261.311] (-266.062) * [-265.494] (-259.940) (-261.689) (-263.832) -- 0:00:34
463000 -- (-259.938) (-260.846) (-261.727) [-260.606] * [-260.290] (-263.736) (-259.427) (-263.482) -- 0:00:34
463500 -- (-259.843) (-261.346) [-259.651] (-263.394) * [-260.165] (-259.916) (-260.849) (-264.195) -- 0:00:34
464000 -- (-260.633) (-261.891) (-264.129) [-261.158] * (-260.163) (-260.641) (-260.599) [-265.218] -- 0:00:34
464500 -- (-260.188) [-259.695] (-263.663) (-263.172) * (-261.020) (-262.627) (-259.848) [-261.915] -- 0:00:34
465000 -- (-261.900) [-260.971] (-259.570) (-261.648) * (-260.052) (-261.367) (-262.429) [-260.173] -- 0:00:34
Average standard deviation of split frequencies: 0.012708
465500 -- (-260.207) (-262.770) (-259.328) [-261.847] * (-259.279) (-263.599) [-261.464] (-261.394) -- 0:00:34
466000 -- (-261.101) [-260.702] (-260.164) (-261.529) * (-259.429) (-263.840) [-262.147] (-260.904) -- 0:00:34
466500 -- (-261.267) [-261.443] (-263.442) (-260.460) * (-260.271) (-259.156) [-260.147] (-262.574) -- 0:00:34
467000 -- [-260.415] (-260.916) (-264.645) (-260.092) * (-259.814) (-261.273) [-259.865] (-259.893) -- 0:00:34
467500 -- [-261.889] (-259.418) (-264.379) (-260.898) * (-260.081) (-261.053) [-260.319] (-260.835) -- 0:00:34
468000 -- (-261.177) (-259.488) (-263.201) [-260.001] * (-259.805) (-261.759) [-260.617] (-262.172) -- 0:00:34
468500 -- (-266.986) (-259.727) [-268.477] (-259.743) * (-261.238) (-266.296) [-259.814] (-265.129) -- 0:00:34
469000 -- [-264.267] (-260.576) (-264.691) (-260.916) * (-263.372) [-259.909] (-261.516) (-264.056) -- 0:00:33
469500 -- (-262.448) (-262.551) [-261.417] (-260.773) * (-267.878) (-260.775) [-261.227] (-262.585) -- 0:00:33
470000 -- [-262.111] (-260.236) (-260.406) (-262.476) * (-262.013) (-259.762) (-262.289) [-262.030] -- 0:00:34
Average standard deviation of split frequencies: 0.012707
470500 -- (-262.407) [-260.733] (-260.705) (-263.021) * [-260.474] (-262.253) (-262.219) (-264.389) -- 0:00:34
471000 -- (-261.083) [-259.980] (-262.765) (-262.952) * (-261.172) (-260.999) (-264.505) [-262.968] -- 0:00:34
471500 -- (-261.460) (-262.192) [-260.404] (-261.068) * (-261.542) [-261.800] (-260.411) (-261.036) -- 0:00:34
472000 -- (-264.968) [-260.431] (-261.385) (-260.451) * [-260.861] (-263.088) (-259.543) (-259.923) -- 0:00:34
472500 -- [-265.278] (-260.402) (-260.569) (-260.462) * (-261.400) [-262.959] (-261.510) (-259.594) -- 0:00:34
473000 -- (-261.373) (-259.891) [-261.562] (-261.964) * (-260.991) (-262.957) (-259.960) [-260.457] -- 0:00:34
473500 -- (-259.897) (-265.693) (-261.931) [-262.106] * (-260.807) (-265.917) [-259.253] (-260.537) -- 0:00:34
474000 -- (-260.860) (-262.153) [-263.741] (-260.222) * (-262.752) (-261.628) [-260.690] (-260.499) -- 0:00:34
474500 -- (-262.268) (-260.989) [-259.397] (-262.416) * (-261.485) (-260.493) (-262.083) [-260.931] -- 0:00:34
475000 -- [-262.292] (-261.108) (-259.912) (-260.606) * (-260.669) (-262.701) (-263.157) [-261.444] -- 0:00:34
Average standard deviation of split frequencies: 0.012936
475500 -- (-263.777) [-269.522] (-263.264) (-263.188) * (-260.466) (-261.511) [-262.559] (-260.377) -- 0:00:34
476000 -- (-261.689) [-263.703] (-263.974) (-259.890) * (-259.626) (-263.942) (-262.152) [-263.462] -- 0:00:34
476500 -- (-261.851) (-262.862) [-262.415] (-262.393) * (-261.784) [-264.026] (-260.809) (-262.557) -- 0:00:34
477000 -- (-264.574) (-261.221) [-261.797] (-261.967) * (-264.731) (-260.151) (-262.592) [-259.870] -- 0:00:33
477500 -- (-263.118) (-259.401) [-261.554] (-261.222) * (-261.251) (-259.456) [-259.686] (-259.385) -- 0:00:33
478000 -- (-260.288) (-258.982) (-259.157) [-259.937] * [-259.110] (-260.031) (-259.851) (-263.584) -- 0:00:33
478500 -- (-262.116) [-262.003] (-259.246) (-262.697) * [-264.182] (-263.761) (-262.833) (-260.501) -- 0:00:33
479000 -- (-262.408) [-262.233] (-260.660) (-260.747) * (-264.054) (-260.077) [-261.387] (-261.823) -- 0:00:33
479500 -- (-262.937) (-262.475) [-259.502] (-261.947) * (-261.469) [-259.917] (-259.676) (-267.044) -- 0:00:33
480000 -- (-264.261) [-262.435] (-263.245) (-262.857) * [-263.121] (-263.448) (-260.929) (-261.840) -- 0:00:33
Average standard deviation of split frequencies: 0.013669
480500 -- (-259.609) (-265.571) (-263.974) [-260.008] * [-263.687] (-263.641) (-263.215) (-260.328) -- 0:00:33
481000 -- (-267.421) (-261.967) (-259.378) [-260.621] * [-261.236] (-260.117) (-260.445) (-260.346) -- 0:00:33
481500 -- (-266.836) (-261.347) [-261.144] (-263.172) * [-260.395] (-263.951) (-262.865) (-261.743) -- 0:00:33
482000 -- (-262.301) (-260.414) (-260.821) [-262.758] * (-260.861) (-264.521) (-260.656) [-261.663] -- 0:00:33
482500 -- (-260.284) (-260.534) [-261.852] (-264.944) * (-260.102) (-260.694) [-260.334] (-260.396) -- 0:00:33
483000 -- [-259.229] (-261.318) (-263.721) (-264.606) * (-262.226) (-260.675) (-263.353) [-260.611] -- 0:00:33
483500 -- (-261.852) (-263.147) (-260.190) [-259.134] * (-261.885) [-260.211] (-260.127) (-259.822) -- 0:00:33
484000 -- [-260.688] (-265.137) (-265.950) (-262.959) * (-266.080) [-261.088] (-259.076) (-267.965) -- 0:00:33
484500 -- (-261.716) (-263.947) (-259.795) [-261.716] * (-266.035) [-262.577] (-260.197) (-263.024) -- 0:00:34
485000 -- [-259.502] (-262.349) (-261.058) (-259.984) * (-262.544) (-265.175) (-259.742) [-261.287] -- 0:00:33
Average standard deviation of split frequencies: 0.012913
485500 -- (-259.965) [-262.112] (-260.283) (-261.194) * (-261.044) [-260.497] (-262.662) (-260.599) -- 0:00:33
486000 -- (-263.191) [-259.313] (-264.415) (-259.618) * (-259.868) (-262.579) [-260.664] (-259.436) -- 0:00:33
486500 -- (-261.496) (-260.021) [-260.965] (-259.288) * (-259.666) (-263.548) [-260.601] (-263.382) -- 0:00:33
487000 -- (-259.949) [-262.592] (-263.482) (-262.907) * [-260.584] (-264.664) (-261.442) (-262.357) -- 0:00:33
487500 -- (-262.716) [-263.140] (-260.394) (-264.942) * (-263.876) [-263.176] (-261.579) (-260.733) -- 0:00:33
488000 -- (-261.221) (-262.114) [-260.928] (-260.432) * (-265.426) (-263.703) [-262.094] (-261.234) -- 0:00:33
488500 -- [-262.379] (-260.840) (-262.879) (-261.035) * (-264.071) (-262.765) [-259.352] (-260.324) -- 0:00:33
489000 -- (-259.062) [-260.386] (-264.160) (-261.755) * [-262.127] (-260.118) (-261.683) (-261.116) -- 0:00:33
489500 -- (-260.024) [-260.424] (-270.475) (-260.275) * (-261.003) (-260.720) (-260.933) [-261.081] -- 0:00:33
490000 -- [-259.626] (-262.251) (-259.574) (-261.276) * [-260.374] (-261.125) (-261.599) (-262.871) -- 0:00:33
Average standard deviation of split frequencies: 0.012550
490500 -- [-260.340] (-261.043) (-261.238) (-259.397) * (-261.856) [-262.213] (-261.225) (-264.213) -- 0:00:33
491000 -- (-259.262) [-259.809] (-263.537) (-260.215) * (-260.400) [-259.039] (-259.840) (-261.742) -- 0:00:33
491500 -- (-260.903) (-260.339) [-259.900] (-260.062) * (-263.088) (-260.022) [-259.166] (-262.860) -- 0:00:33
492000 -- (-260.291) (-261.769) [-259.926] (-259.870) * (-262.317) (-260.800) [-262.327] (-261.483) -- 0:00:33
492500 -- (-261.131) (-262.138) [-259.644] (-260.067) * [-261.951] (-261.782) (-259.855) (-259.955) -- 0:00:32
493000 -- (-262.725) [-264.657] (-259.801) (-268.237) * (-260.240) [-261.115] (-263.017) (-261.115) -- 0:00:32
493500 -- (-261.890) [-259.862] (-259.542) (-262.994) * (-261.255) [-261.922] (-267.523) (-261.467) -- 0:00:32
494000 -- [-259.758] (-260.457) (-259.727) (-261.530) * (-262.729) (-259.873) (-263.965) [-261.736] -- 0:00:32
494500 -- [-261.400] (-262.921) (-261.601) (-259.755) * (-260.747) (-265.977) [-264.031] (-260.544) -- 0:00:32
495000 -- [-259.113] (-262.306) (-260.431) (-262.385) * (-259.996) [-262.806] (-262.854) (-262.094) -- 0:00:32
Average standard deviation of split frequencies: 0.011761
495500 -- [-258.961] (-259.885) (-261.334) (-261.110) * (-262.475) (-262.910) [-260.691] (-261.495) -- 0:00:32
496000 -- (-263.350) [-259.642] (-261.688) (-261.233) * [-260.581] (-261.326) (-259.674) (-261.582) -- 0:00:32
496500 -- (-261.429) (-259.246) [-259.482] (-260.228) * (-264.988) [-261.218] (-262.300) (-263.219) -- 0:00:32
497000 -- (-262.422) (-261.350) (-260.352) [-261.579] * (-262.138) (-263.915) [-262.222] (-264.407) -- 0:00:32
497500 -- (-259.435) [-260.859] (-262.703) (-263.631) * (-259.146) (-262.680) (-261.014) [-262.001] -- 0:00:32
498000 -- (-260.608) [-261.716] (-261.450) (-263.259) * (-259.062) (-261.258) (-261.181) [-259.666] -- 0:00:32
498500 -- (-263.115) (-263.211) (-263.561) [-261.275] * [-265.962] (-262.178) (-269.671) (-261.948) -- 0:00:32
499000 -- (-261.793) [-260.871] (-261.367) (-260.065) * [-262.632] (-266.211) (-264.612) (-261.356) -- 0:00:32
499500 -- (-261.851) [-261.059] (-261.386) (-260.002) * (-261.102) [-265.433] (-259.555) (-260.240) -- 0:00:33
500000 -- [-263.125] (-261.799) (-261.787) (-259.485) * (-260.483) (-262.012) [-261.043] (-259.759) -- 0:00:33
Average standard deviation of split frequencies: 0.011769
500500 -- (-260.854) (-261.688) (-262.924) [-259.568] * [-259.608] (-261.516) (-268.505) (-260.446) -- 0:00:32
501000 -- (-262.083) [-259.350] (-260.335) (-260.962) * [-261.463] (-259.766) (-262.362) (-259.469) -- 0:00:32
501500 -- (-265.394) (-259.873) [-261.893] (-260.350) * (-262.009) (-266.590) (-265.812) [-259.548] -- 0:00:32
502000 -- [-260.348] (-261.341) (-262.092) (-263.271) * [-262.363] (-261.241) (-262.126) (-259.278) -- 0:00:32
502500 -- (-260.049) (-263.197) [-259.970] (-261.365) * (-270.148) (-259.599) (-259.229) [-259.987] -- 0:00:32
503000 -- (-260.556) (-261.071) (-262.116) [-260.156] * (-261.467) (-259.156) [-259.735] (-262.155) -- 0:00:32
503500 -- [-260.910] (-263.054) (-267.494) (-260.184) * (-260.157) [-262.010] (-262.066) (-261.620) -- 0:00:32
504000 -- [-262.177] (-260.512) (-262.519) (-261.965) * (-261.082) [-259.500] (-262.063) (-267.633) -- 0:00:32
504500 -- [-259.610] (-261.246) (-260.939) (-260.406) * (-262.709) (-260.321) (-261.787) [-262.257] -- 0:00:32
505000 -- (-260.668) (-262.371) (-263.385) [-260.582] * (-263.657) [-262.053] (-265.768) (-260.393) -- 0:00:32
Average standard deviation of split frequencies: 0.011529
505500 -- (-259.683) (-260.780) [-264.491] (-261.453) * (-259.343) (-263.548) [-260.678] (-263.460) -- 0:00:32
506000 -- [-262.608] (-262.356) (-260.322) (-264.779) * [-264.809] (-264.304) (-260.172) (-262.507) -- 0:00:32
506500 -- [-260.596] (-263.617) (-263.855) (-259.320) * (-262.833) (-266.807) [-261.686] (-261.377) -- 0:00:32
507000 -- [-261.492] (-262.790) (-260.519) (-260.641) * (-263.710) (-265.672) (-262.704) [-261.471] -- 0:00:32
507500 -- (-261.990) [-263.348] (-259.424) (-263.873) * [-259.975] (-261.608) (-261.216) (-267.041) -- 0:00:32
508000 -- (-263.087) (-265.669) [-262.260] (-262.340) * (-262.041) (-266.278) [-262.231] (-260.054) -- 0:00:31
508500 -- (-263.171) (-264.532) [-263.944] (-259.126) * (-260.049) (-262.318) [-260.695] (-261.634) -- 0:00:31
509000 -- (-260.550) (-261.076) [-260.350] (-259.618) * (-263.572) (-262.888) [-263.293] (-264.962) -- 0:00:31
509500 -- (-260.422) (-262.619) (-261.376) [-259.966] * (-263.092) (-262.801) [-260.376] (-260.998) -- 0:00:31
510000 -- (-260.525) [-260.468] (-262.299) (-262.842) * (-263.957) [-259.322] (-262.532) (-260.112) -- 0:00:31
Average standard deviation of split frequencies: 0.011308
510500 -- (-259.565) (-262.534) (-262.434) [-260.149] * [-259.641] (-261.713) (-263.673) (-262.181) -- 0:00:31
511000 -- (-259.818) (-268.159) (-259.464) [-261.249] * (-259.319) [-266.391] (-263.179) (-259.693) -- 0:00:31
511500 -- (-267.296) (-261.895) [-259.629] (-261.875) * (-258.994) (-263.038) (-262.240) [-260.532] -- 0:00:31
512000 -- (-259.205) (-265.341) (-259.906) [-261.657] * (-260.352) [-263.130] (-260.016) (-261.779) -- 0:00:31
512500 -- [-260.388] (-266.225) (-262.893) (-261.976) * (-262.973) (-259.723) [-260.303] (-260.873) -- 0:00:32
513000 -- (-265.957) [-262.117] (-260.435) (-259.155) * [-261.292] (-262.457) (-260.954) (-260.402) -- 0:00:32
513500 -- [-260.480] (-261.795) (-260.836) (-260.060) * (-260.185) (-261.908) (-260.102) [-264.675] -- 0:00:32
514000 -- (-259.860) (-260.504) (-261.238) [-260.308] * (-266.391) (-262.152) [-260.394] (-262.683) -- 0:00:32
514500 -- (-262.439) (-262.391) [-261.128] (-261.932) * [-264.222] (-261.133) (-264.053) (-259.738) -- 0:00:32
515000 -- [-262.012] (-262.811) (-261.215) (-262.415) * (-260.417) [-261.879] (-261.055) (-259.733) -- 0:00:32
Average standard deviation of split frequencies: 0.011420
515500 -- (-262.740) [-261.315] (-260.811) (-262.965) * (-261.904) (-261.698) [-261.196] (-259.983) -- 0:00:31
516000 -- (-261.339) (-261.575) [-259.869] (-261.646) * (-260.636) [-265.455] (-260.852) (-264.137) -- 0:00:31
516500 -- (-264.245) (-261.088) [-260.844] (-262.904) * (-262.772) [-259.472] (-262.690) (-264.850) -- 0:00:31
517000 -- (-261.693) (-260.345) [-261.304] (-261.363) * (-264.800) (-260.370) (-261.594) [-263.177] -- 0:00:31
517500 -- (-263.247) [-260.393] (-265.318) (-260.037) * [-263.861] (-265.541) (-262.733) (-262.626) -- 0:00:31
518000 -- (-261.743) (-261.567) (-261.000) [-259.874] * (-263.022) (-261.032) (-264.360) [-261.178] -- 0:00:31
518500 -- (-262.328) (-260.448) (-260.563) [-260.500] * (-259.086) [-262.575] (-259.642) (-260.274) -- 0:00:31
519000 -- (-261.594) (-262.099) [-260.650] (-259.691) * (-260.062) (-261.647) (-261.632) [-260.085] -- 0:00:31
519500 -- (-263.432) (-263.342) (-264.851) [-259.535] * [-261.514] (-262.726) (-259.638) (-268.201) -- 0:00:31
520000 -- (-263.999) [-260.363] (-265.317) (-260.409) * [-262.008] (-262.029) (-266.013) (-263.588) -- 0:00:31
Average standard deviation of split frequencies: 0.011827
520500 -- [-267.008] (-260.410) (-260.528) (-263.523) * (-261.915) (-263.290) (-263.833) [-260.877] -- 0:00:31
521000 -- (-262.519) [-260.706] (-259.532) (-259.919) * (-259.733) [-264.731] (-262.459) (-261.949) -- 0:00:31
521500 -- [-261.244] (-263.172) (-262.859) (-261.787) * (-259.542) (-260.421) (-264.214) [-262.993] -- 0:00:31
522000 -- (-262.498) (-260.080) (-261.714) [-260.837] * (-260.381) (-260.198) [-259.394] (-261.350) -- 0:00:31
522500 -- (-265.805) (-260.370) [-262.566] (-259.403) * [-260.211] (-262.491) (-261.546) (-261.187) -- 0:00:31
523000 -- [-264.500] (-260.436) (-259.772) (-263.272) * (-260.114) (-263.568) [-259.679] (-261.232) -- 0:00:31
523500 -- [-262.376] (-264.722) (-260.056) (-261.618) * (-259.804) (-261.330) (-259.675) [-259.213] -- 0:00:30
524000 -- (-261.016) [-261.555] (-262.119) (-263.379) * (-264.056) (-264.862) [-262.926] (-261.268) -- 0:00:30
524500 -- (-260.725) (-263.736) [-261.189] (-260.391) * (-263.873) (-261.697) [-259.657] (-260.201) -- 0:00:30
525000 -- (-262.399) (-264.233) [-261.863] (-260.275) * (-261.582) (-261.655) (-261.511) [-260.325] -- 0:00:30
Average standard deviation of split frequencies: 0.012072
525500 -- [-260.172] (-262.158) (-259.644) (-262.190) * (-260.443) [-264.725] (-260.325) (-260.715) -- 0:00:30
526000 -- [-262.668] (-259.268) (-260.435) (-261.041) * (-260.383) (-264.769) [-261.008] (-260.526) -- 0:00:30
526500 -- (-260.639) (-261.412) (-260.840) [-260.474] * (-261.221) (-261.224) [-259.844] (-260.341) -- 0:00:30
527000 -- [-260.535] (-259.793) (-262.972) (-259.296) * (-260.630) [-261.777] (-260.010) (-259.761) -- 0:00:30
527500 -- (-263.195) (-259.841) (-260.419) [-262.096] * (-260.901) (-263.502) [-259.676] (-266.891) -- 0:00:30
528000 -- (-260.204) (-260.407) (-264.674) [-262.640] * (-259.857) [-259.901] (-261.853) (-263.532) -- 0:00:30
528500 -- (-259.410) (-260.606) [-261.205] (-267.014) * (-260.157) [-259.038] (-261.429) (-261.873) -- 0:00:31
529000 -- (-259.908) [-262.553] (-262.750) (-259.402) * (-260.140) (-260.866) [-265.504] (-260.878) -- 0:00:31
529500 -- (-261.168) [-264.765] (-263.715) (-261.416) * (-264.802) (-262.335) [-265.183] (-261.104) -- 0:00:31
530000 -- (-260.347) (-265.320) [-262.210] (-263.655) * [-263.924] (-260.117) (-263.104) (-263.778) -- 0:00:31
Average standard deviation of split frequencies: 0.012140
530500 -- [-262.656] (-260.229) (-263.987) (-260.431) * (-268.476) (-260.575) [-260.593] (-259.682) -- 0:00:30
531000 -- (-261.173) (-261.075) [-261.798] (-262.205) * (-259.343) [-262.115] (-259.999) (-260.327) -- 0:00:30
531500 -- [-262.839] (-261.412) (-259.949) (-261.819) * (-259.365) [-261.806] (-262.354) (-260.632) -- 0:00:30
532000 -- (-261.417) (-262.009) (-263.030) [-262.196] * (-260.244) [-261.473] (-261.685) (-260.724) -- 0:00:30
532500 -- [-261.867] (-264.223) (-260.129) (-263.138) * (-262.895) (-261.850) (-265.339) [-260.202] -- 0:00:30
533000 -- (-261.777) (-260.715) [-263.544] (-262.478) * (-262.585) (-270.311) (-263.913) [-264.613] -- 0:00:30
533500 -- [-259.992] (-260.610) (-263.994) (-260.387) * [-260.792] (-264.270) (-264.773) (-264.996) -- 0:00:30
534000 -- (-262.131) [-259.681] (-261.461) (-262.143) * [-261.351] (-259.426) (-261.097) (-260.969) -- 0:00:30
534500 -- (-263.997) (-260.907) [-260.467] (-260.180) * [-264.031] (-260.828) (-259.370) (-260.477) -- 0:00:30
535000 -- [-259.427] (-262.001) (-260.178) (-261.261) * (-261.158) (-261.402) [-262.784] (-260.568) -- 0:00:30
Average standard deviation of split frequencies: 0.011382
535500 -- [-260.845] (-262.151) (-260.023) (-260.575) * (-265.793) (-261.454) (-259.808) [-259.439] -- 0:00:30
536000 -- [-260.205] (-266.342) (-260.965) (-262.435) * (-260.790) (-260.389) [-260.421] (-260.531) -- 0:00:30
536500 -- (-260.453) (-264.857) [-260.717] (-264.529) * (-261.100) (-259.572) (-261.155) [-259.606] -- 0:00:30
537000 -- (-262.638) (-261.128) (-259.831) [-260.770] * (-264.639) (-261.455) [-260.621] (-260.160) -- 0:00:30
537500 -- (-265.268) [-260.584] (-262.105) (-263.427) * (-259.127) (-261.148) (-259.754) [-261.467] -- 0:00:30
538000 -- [-263.875] (-259.355) (-262.026) (-262.339) * (-261.247) (-260.943) (-260.244) [-259.222] -- 0:00:30
538500 -- (-264.533) [-260.199] (-261.963) (-261.077) * [-259.542] (-259.133) (-262.666) (-259.892) -- 0:00:29
539000 -- [-260.438] (-260.990) (-262.425) (-262.348) * (-261.549) (-261.327) (-261.206) [-261.788] -- 0:00:29
539500 -- (-263.182) [-259.405] (-265.263) (-259.531) * [-260.259] (-261.248) (-263.122) (-260.170) -- 0:00:29
540000 -- [-262.837] (-263.187) (-268.523) (-265.700) * [-260.693] (-261.401) (-263.796) (-263.554) -- 0:00:29
Average standard deviation of split frequencies: 0.010899
540500 -- [-260.690] (-263.475) (-259.998) (-262.259) * (-260.069) (-260.711) [-261.127] (-262.900) -- 0:00:29
541000 -- (-260.696) (-261.620) (-264.789) [-261.571] * (-263.143) (-264.032) [-259.567] (-261.072) -- 0:00:29
541500 -- (-260.758) (-262.653) [-262.668] (-259.350) * (-259.619) (-259.532) (-260.295) [-260.767] -- 0:00:29
542000 -- (-262.245) (-262.619) [-265.167] (-262.195) * (-266.092) (-260.777) (-259.940) [-260.231] -- 0:00:29
542500 -- (-264.940) (-261.803) (-264.509) [-262.415] * (-260.271) (-261.999) [-262.938] (-259.496) -- 0:00:29
543000 -- (-260.417) (-262.353) (-264.282) [-265.253] * (-263.541) (-267.042) [-262.698] (-262.255) -- 0:00:29
543500 -- (-262.736) (-262.710) (-263.893) [-260.234] * (-261.791) (-260.797) (-262.221) [-261.859] -- 0:00:30
544000 -- (-264.365) [-260.707] (-259.471) (-260.764) * (-262.285) (-261.382) [-263.336] (-258.858) -- 0:00:30
544500 -- (-261.429) (-260.781) (-260.666) [-259.995] * (-261.747) (-261.296) [-261.664] (-259.224) -- 0:00:30
545000 -- [-259.769] (-260.800) (-261.415) (-260.170) * (-260.929) (-262.083) (-262.173) [-261.033] -- 0:00:30
Average standard deviation of split frequencies: 0.010738
545500 -- (-260.358) (-261.351) [-260.878] (-261.085) * (-260.399) (-260.567) [-260.302] (-262.375) -- 0:00:29
546000 -- [-259.994] (-260.067) (-260.642) (-261.857) * (-262.468) (-267.555) [-261.362] (-262.146) -- 0:00:29
546500 -- (-261.330) (-260.001) [-262.674] (-261.455) * (-260.497) [-260.542] (-261.068) (-261.442) -- 0:00:29
547000 -- [-259.397] (-261.410) (-259.906) (-262.949) * (-260.609) [-260.184] (-262.242) (-266.002) -- 0:00:29
547500 -- [-259.286] (-260.020) (-260.091) (-260.991) * [-263.327] (-260.176) (-260.455) (-263.718) -- 0:00:29
548000 -- (-259.733) [-260.570] (-259.963) (-261.621) * [-259.899] (-261.170) (-259.077) (-259.954) -- 0:00:29
548500 -- (-263.542) [-259.735] (-260.048) (-260.726) * (-259.159) [-261.669] (-262.468) (-260.003) -- 0:00:29
549000 -- (-261.678) (-262.208) (-260.975) [-260.025] * (-260.875) (-260.304) [-259.640] (-259.737) -- 0:00:29
549500 -- [-259.922] (-262.042) (-260.393) (-260.860) * (-263.018) (-260.985) (-260.221) [-259.624] -- 0:00:29
550000 -- (-261.940) [-261.752] (-260.676) (-260.714) * (-261.549) (-262.523) [-262.868] (-259.229) -- 0:00:29
Average standard deviation of split frequencies: 0.011503
550500 -- (-261.982) (-260.919) [-260.844] (-262.846) * (-263.625) (-265.783) (-259.961) [-259.136] -- 0:00:29
551000 -- (-261.422) (-260.051) (-262.463) [-259.627] * (-261.843) (-261.450) (-261.268) [-259.977] -- 0:00:29
551500 -- (-264.331) [-261.483] (-259.805) (-263.199) * (-264.159) [-259.122] (-259.471) (-263.115) -- 0:00:29
552000 -- (-260.683) (-262.094) (-261.483) [-261.652] * (-259.600) [-260.387] (-262.969) (-260.746) -- 0:00:29
552500 -- [-266.405] (-263.018) (-265.525) (-260.400) * (-263.069) (-260.712) (-263.137) [-262.497] -- 0:00:29
553000 -- [-261.386] (-262.248) (-260.772) (-261.507) * (-262.271) (-264.406) (-261.455) [-264.218] -- 0:00:29
553500 -- [-260.731] (-261.262) (-259.466) (-260.120) * (-262.996) (-262.784) (-262.287) [-262.138] -- 0:00:29
554000 -- [-260.855] (-264.925) (-259.511) (-262.694) * (-265.483) [-261.697] (-261.920) (-265.669) -- 0:00:28
554500 -- (-260.409) [-262.681] (-260.848) (-261.992) * (-260.939) [-262.451] (-263.476) (-261.844) -- 0:00:28
555000 -- (-262.757) (-261.394) [-259.977] (-263.168) * (-262.816) (-262.469) (-259.721) [-260.798] -- 0:00:28
Average standard deviation of split frequencies: 0.011499
555500 -- [-259.726] (-260.971) (-260.702) (-263.827) * (-264.110) (-259.860) (-259.104) [-273.178] -- 0:00:28
556000 -- [-259.954] (-264.778) (-261.177) (-265.408) * [-262.729] (-264.007) (-259.550) (-260.360) -- 0:00:28
556500 -- (-260.212) (-264.391) (-263.678) [-259.350] * (-261.714) (-262.096) (-260.386) [-261.822] -- 0:00:28
557000 -- (-262.561) (-266.194) [-262.198] (-260.194) * [-260.367] (-261.841) (-264.331) (-260.725) -- 0:00:28
557500 -- (-261.244) (-265.509) [-260.698] (-263.684) * (-264.155) [-259.810] (-260.635) (-260.925) -- 0:00:28
558000 -- (-261.737) [-263.314] (-259.500) (-265.639) * (-262.499) (-265.299) (-260.579) [-259.729] -- 0:00:28
558500 -- [-261.291] (-260.517) (-260.741) (-261.411) * (-260.492) (-259.927) (-260.392) [-260.272] -- 0:00:28
559000 -- (-260.500) (-261.063) [-259.411] (-259.667) * (-261.617) (-262.090) (-261.825) [-263.939] -- 0:00:28
559500 -- (-261.751) (-261.067) (-262.419) [-261.539] * (-263.244) (-263.446) [-260.982] (-261.645) -- 0:00:29
560000 -- (-260.181) (-266.946) (-261.066) [-260.659] * (-260.991) (-263.774) (-259.658) [-261.822] -- 0:00:29
Average standard deviation of split frequencies: 0.011456
560500 -- (-261.434) (-261.350) [-259.977] (-260.256) * (-262.565) [-261.586] (-260.750) (-259.528) -- 0:00:29
561000 -- (-261.961) (-262.216) [-262.287] (-261.001) * (-260.932) (-259.990) (-262.252) [-262.046] -- 0:00:28
561500 -- (-265.829) (-260.558) (-261.532) [-259.498] * (-261.166) [-260.729] (-260.131) (-261.217) -- 0:00:28
562000 -- [-262.408] (-262.226) (-262.558) (-262.409) * (-262.971) (-261.115) [-264.153] (-266.049) -- 0:00:28
562500 -- (-263.338) [-262.684] (-263.191) (-261.116) * [-259.652] (-260.641) (-262.332) (-260.276) -- 0:00:28
563000 -- [-263.901] (-264.379) (-259.977) (-261.609) * (-261.508) [-260.806] (-260.726) (-260.800) -- 0:00:28
563500 -- (-260.996) [-260.760] (-263.215) (-261.989) * (-260.992) (-262.627) [-259.703] (-261.505) -- 0:00:28
564000 -- (-267.426) (-259.440) (-266.332) [-260.228] * (-260.411) [-261.497] (-259.051) (-261.868) -- 0:00:28
564500 -- (-261.485) (-263.772) [-260.800] (-259.996) * (-263.663) [-260.114] (-261.858) (-261.814) -- 0:00:28
565000 -- (-260.493) (-262.332) [-261.635] (-261.274) * (-263.194) (-264.505) [-260.562] (-265.674) -- 0:00:28
Average standard deviation of split frequencies: 0.011400
565500 -- [-260.784] (-260.334) (-262.126) (-263.836) * (-266.094) (-262.272) [-260.154] (-262.543) -- 0:00:28
566000 -- [-259.726] (-262.696) (-260.418) (-259.645) * (-260.440) (-259.752) (-263.443) [-259.560] -- 0:00:28
566500 -- [-262.939] (-260.390) (-262.283) (-261.470) * (-263.391) (-261.662) [-262.535] (-260.128) -- 0:00:28
567000 -- (-263.810) [-260.286] (-260.959) (-261.023) * (-263.190) [-261.600] (-261.930) (-261.096) -- 0:00:28
567500 -- (-259.893) (-264.111) [-261.664] (-262.110) * (-262.646) (-261.337) (-259.899) [-260.547] -- 0:00:28
568000 -- (-260.282) (-261.920) (-261.328) [-266.263] * [-262.450] (-265.273) (-261.303) (-262.473) -- 0:00:28
568500 -- [-261.498] (-265.740) (-260.992) (-259.857) * (-261.811) [-260.964] (-261.226) (-261.251) -- 0:00:28
569000 -- (-260.314) (-263.700) (-263.231) [-263.866] * (-261.645) [-261.429] (-261.173) (-261.711) -- 0:00:28
569500 -- [-260.060] (-260.317) (-259.494) (-259.626) * [-265.659] (-261.868) (-261.725) (-261.358) -- 0:00:27
570000 -- (-263.334) (-260.436) [-260.362] (-259.937) * (-262.615) (-260.821) (-262.311) [-260.796] -- 0:00:27
Average standard deviation of split frequencies: 0.011152
570500 -- (-266.239) [-262.862] (-265.575) (-260.532) * [-264.857] (-260.295) (-261.796) (-260.538) -- 0:00:27
571000 -- (-263.271) (-265.011) (-259.508) [-260.555] * (-263.730) [-262.389] (-261.430) (-260.708) -- 0:00:27
571500 -- (-260.594) (-259.998) [-261.711] (-261.795) * (-261.671) (-261.108) (-259.935) [-259.829] -- 0:00:27
572000 -- (-260.158) [-262.067] (-259.458) (-263.680) * (-259.885) [-259.612] (-259.688) (-260.423) -- 0:00:27
572500 -- [-259.338] (-260.292) (-261.942) (-261.555) * (-259.186) [-259.522] (-264.529) (-260.533) -- 0:00:27
573000 -- (-260.344) (-264.393) [-259.785] (-260.407) * (-259.968) (-261.877) (-261.814) [-260.269] -- 0:00:27
573500 -- (-259.436) (-263.923) (-261.113) [-261.086] * [-259.788] (-263.180) (-260.296) (-262.721) -- 0:00:27
574000 -- (-264.160) (-262.903) [-259.832] (-261.208) * [-260.217] (-261.014) (-261.630) (-260.893) -- 0:00:27
574500 -- (-261.673) (-266.044) (-260.565) [-262.261] * (-260.527) [-261.884] (-260.787) (-261.029) -- 0:00:27
575000 -- (-260.169) (-262.573) (-260.700) [-259.870] * (-262.181) (-262.089) (-260.343) [-260.301] -- 0:00:27
Average standard deviation of split frequencies: 0.011304
575500 -- (-261.891) (-264.498) [-261.126] (-263.735) * (-261.020) (-260.238) (-262.382) [-259.766] -- 0:00:27
576000 -- (-261.835) (-261.750) (-261.238) [-260.162] * [-264.596] (-261.000) (-262.210) (-260.504) -- 0:00:27
576500 -- (-259.934) (-263.773) [-262.926] (-260.788) * (-263.381) [-259.629] (-261.083) (-261.829) -- 0:00:27
577000 -- (-263.718) (-259.895) (-262.169) [-259.545] * (-262.072) (-259.649) [-259.440] (-259.594) -- 0:00:27
577500 -- (-263.848) (-262.674) (-261.292) [-261.693] * (-264.735) [-259.868] (-259.940) (-260.692) -- 0:00:27
578000 -- (-264.986) (-261.349) [-261.963] (-260.767) * (-262.072) (-259.927) (-266.316) [-263.325] -- 0:00:27
578500 -- (-260.957) (-262.467) [-259.849] (-260.908) * (-259.076) (-266.686) (-262.770) [-261.314] -- 0:00:27
579000 -- (-261.229) [-261.190] (-261.635) (-262.453) * (-261.775) (-265.287) (-260.169) [-261.730] -- 0:00:27
579500 -- (-262.343) [-260.047] (-259.831) (-260.243) * (-262.117) (-259.400) (-261.066) [-262.487] -- 0:00:27
580000 -- [-263.476] (-259.885) (-264.495) (-261.385) * (-261.130) (-263.623) [-260.743] (-260.814) -- 0:00:27
Average standard deviation of split frequencies: 0.011416
580500 -- [-262.991] (-262.672) (-265.958) (-263.349) * (-261.545) (-261.529) [-260.215] (-263.021) -- 0:00:27
581000 -- (-265.184) [-262.006] (-267.650) (-262.988) * (-263.411) (-259.681) (-260.281) [-259.752] -- 0:00:27
581500 -- [-262.955] (-263.196) (-263.895) (-264.801) * (-264.763) (-260.910) [-259.911] (-261.268) -- 0:00:27
582000 -- (-264.136) [-262.595] (-259.567) (-261.983) * (-262.610) [-262.131] (-263.156) (-260.955) -- 0:00:27
582500 -- (-261.860) [-264.786] (-263.079) (-260.870) * [-264.931] (-261.220) (-260.569) (-259.933) -- 0:00:27
583000 -- (-263.267) (-264.932) [-261.531] (-261.463) * (-262.943) [-259.576] (-259.690) (-263.636) -- 0:00:27
583500 -- (-263.780) (-263.155) (-260.897) [-261.548] * [-262.360] (-259.854) (-261.504) (-267.395) -- 0:00:27
584000 -- (-260.089) (-261.189) (-260.094) [-261.306] * (-259.974) (-262.851) (-262.159) [-261.718] -- 0:00:27
584500 -- (-261.291) (-261.162) (-259.463) [-261.199] * (-264.334) (-261.319) (-261.095) [-261.873] -- 0:00:27
585000 -- (-261.169) (-262.664) [-263.007] (-264.613) * (-261.145) (-261.550) [-266.311] (-263.786) -- 0:00:26
Average standard deviation of split frequencies: 0.011499
585500 -- (-261.757) (-261.941) [-260.064] (-260.522) * (-261.609) (-260.662) (-262.181) [-263.524] -- 0:00:26
586000 -- [-260.280] (-259.457) (-259.718) (-261.569) * (-260.427) (-259.844) [-259.353] (-260.883) -- 0:00:26
586500 -- (-260.907) [-263.871] (-261.121) (-260.690) * (-264.008) [-261.429] (-261.482) (-260.035) -- 0:00:26
587000 -- (-261.024) [-259.491] (-265.388) (-261.035) * (-263.796) (-260.059) [-260.324] (-260.678) -- 0:00:26
587500 -- (-261.257) (-262.923) (-260.838) [-260.668] * (-259.832) (-260.946) [-259.669] (-260.546) -- 0:00:26
588000 -- [-260.988] (-262.690) (-262.112) (-263.679) * (-260.254) [-263.013] (-261.464) (-263.081) -- 0:00:26
588500 -- (-267.410) [-266.727] (-264.999) (-261.802) * [-260.868] (-259.930) (-260.754) (-261.358) -- 0:00:26
589000 -- (-260.052) (-262.305) [-262.359] (-261.368) * (-261.628) (-260.499) [-260.465] (-260.747) -- 0:00:26
589500 -- (-259.785) [-260.443] (-261.802) (-265.021) * [-261.020] (-260.457) (-260.173) (-262.743) -- 0:00:26
590000 -- [-259.376] (-261.769) (-260.012) (-260.180) * (-260.081) (-262.105) (-263.182) [-260.138] -- 0:00:26
Average standard deviation of split frequencies: 0.010610
590500 -- (-263.145) (-267.053) [-259.023] (-259.163) * [-261.561] (-262.530) (-260.943) (-262.204) -- 0:00:26
591000 -- (-260.680) (-264.033) [-260.073] (-262.214) * (-261.263) (-261.723) [-261.102] (-262.088) -- 0:00:26
591500 -- (-260.415) (-259.636) (-260.722) [-261.372] * (-263.455) (-259.086) (-260.783) [-263.453] -- 0:00:26
592000 -- [-259.349] (-260.317) (-265.471) (-263.004) * (-259.793) (-259.287) (-260.668) [-261.157] -- 0:00:26
592500 -- (-260.299) (-265.430) [-263.941] (-261.699) * (-260.473) [-260.006] (-260.799) (-262.250) -- 0:00:26
593000 -- (-262.940) [-260.165] (-263.759) (-263.942) * (-260.096) (-260.161) [-258.961] (-264.472) -- 0:00:26
593500 -- (-260.080) [-263.762] (-260.306) (-272.362) * (-259.948) (-266.071) [-262.368] (-266.557) -- 0:00:26
594000 -- [-262.806] (-263.754) (-259.989) (-264.691) * (-261.639) (-260.704) [-261.218] (-261.817) -- 0:00:26
594500 -- (-260.793) (-266.825) [-260.941] (-262.856) * (-263.966) (-259.528) [-262.150] (-261.344) -- 0:00:26
595000 -- (-259.608) (-261.391) (-263.784) [-259.067] * (-260.840) [-261.138] (-260.015) (-259.658) -- 0:00:26
Average standard deviation of split frequencies: 0.010980
595500 -- [-259.723] (-260.292) (-261.674) (-259.067) * (-260.343) (-265.368) [-261.029] (-260.554) -- 0:00:26
596000 -- [-259.072] (-260.998) (-265.048) (-264.176) * (-264.598) [-264.097] (-260.373) (-260.344) -- 0:00:26
596500 -- (-261.373) (-259.868) (-264.224) [-260.629] * (-263.611) (-264.198) [-260.382] (-261.003) -- 0:00:26
597000 -- (-260.948) [-260.122] (-260.685) (-261.417) * (-261.372) (-265.278) [-259.772] (-261.903) -- 0:00:26
597500 -- (-261.668) (-259.208) [-261.530] (-261.449) * (-260.799) (-263.006) (-261.529) [-261.338] -- 0:00:26
598000 -- [-261.017] (-260.306) (-263.126) (-263.634) * (-260.994) [-265.959] (-259.865) (-261.570) -- 0:00:26
598500 -- (-260.875) [-260.111] (-263.816) (-264.014) * (-264.544) (-268.574) (-260.949) [-261.312] -- 0:00:26
599000 -- [-262.378] (-260.280) (-261.381) (-261.796) * (-259.218) (-263.896) (-261.606) [-260.487] -- 0:00:26
599500 -- (-261.842) [-263.293] (-263.632) (-262.028) * (-262.003) [-261.294] (-260.883) (-260.110) -- 0:00:26
600000 -- (-259.928) (-261.709) (-265.256) [-261.123] * (-261.918) (-262.784) [-259.196] (-259.159) -- 0:00:25
Average standard deviation of split frequencies: 0.010938
600500 -- (-259.747) [-260.575] (-271.635) (-259.992) * (-261.246) (-261.621) [-260.296] (-261.585) -- 0:00:25
601000 -- (-259.058) (-260.353) [-261.481] (-261.594) * (-262.803) [-261.688] (-263.439) (-262.365) -- 0:00:25
601500 -- (-265.134) (-260.535) (-259.709) [-260.861] * (-262.944) (-260.184) [-264.302] (-260.610) -- 0:00:25
602000 -- (-262.469) (-259.951) [-260.818] (-259.685) * [-260.762] (-262.570) (-261.453) (-261.208) -- 0:00:25
602500 -- (-264.870) [-259.697] (-260.870) (-259.439) * [-263.637] (-260.649) (-259.368) (-259.830) -- 0:00:25
603000 -- (-263.339) [-262.078] (-262.621) (-264.386) * (-265.274) [-260.558] (-262.900) (-261.333) -- 0:00:25
603500 -- (-261.874) (-262.896) [-259.312] (-263.861) * [-262.234] (-259.097) (-262.868) (-262.243) -- 0:00:25
604000 -- (-260.827) (-261.759) [-260.355] (-264.652) * (-264.091) [-261.730] (-260.747) (-263.582) -- 0:00:25
604500 -- [-260.237] (-259.402) (-261.007) (-261.428) * (-259.244) (-261.113) (-261.220) [-261.126] -- 0:00:25
605000 -- [-261.653] (-260.527) (-259.746) (-262.239) * (-261.152) (-262.444) [-264.001] (-260.724) -- 0:00:25
Average standard deviation of split frequencies: 0.011571
605500 -- (-260.489) [-259.350] (-261.509) (-260.534) * [-265.771] (-262.637) (-262.337) (-262.582) -- 0:00:26
606000 -- [-260.200] (-263.060) (-259.788) (-261.806) * (-262.208) [-260.245] (-261.318) (-263.298) -- 0:00:26
606500 -- [-260.791] (-262.132) (-260.043) (-264.567) * (-271.253) (-260.046) [-259.630] (-259.342) -- 0:00:25
607000 -- (-259.272) (-260.192) [-259.518] (-259.695) * (-267.823) (-263.768) [-261.053] (-261.785) -- 0:00:25
607500 -- (-264.251) (-260.425) (-260.317) [-261.225] * (-265.849) (-261.735) (-262.813) [-259.878] -- 0:00:25
608000 -- [-260.518] (-260.508) (-265.834) (-262.294) * (-264.378) (-262.363) [-262.114] (-264.138) -- 0:00:25
608500 -- (-261.509) (-262.067) [-260.144] (-259.726) * [-260.567] (-260.318) (-261.555) (-260.464) -- 0:00:25
609000 -- (-260.368) (-261.378) (-261.511) [-259.881] * (-262.623) (-259.055) (-263.081) [-263.725] -- 0:00:25
609500 -- (-260.114) (-262.028) [-262.539] (-261.626) * (-261.512) (-259.697) [-260.733] (-266.121) -- 0:00:25
610000 -- (-263.366) [-260.316] (-261.765) (-260.524) * (-262.563) [-259.355] (-259.647) (-260.834) -- 0:00:25
Average standard deviation of split frequencies: 0.011917
610500 -- [-264.730] (-259.028) (-259.722) (-260.613) * (-260.715) [-260.342] (-261.692) (-262.596) -- 0:00:25
611000 -- (-265.095) (-260.575) (-259.811) [-260.244] * (-260.543) (-261.562) [-260.696] (-261.445) -- 0:00:25
611500 -- [-262.687] (-264.640) (-261.953) (-260.958) * (-259.496) [-260.177] (-260.927) (-262.304) -- 0:00:25
612000 -- [-264.513] (-263.288) (-260.403) (-261.360) * (-260.487) (-260.244) (-259.800) [-260.493] -- 0:00:25
612500 -- (-262.094) [-260.910] (-259.611) (-260.493) * (-265.185) [-260.802] (-261.078) (-260.672) -- 0:00:25
613000 -- (-263.888) [-260.341] (-261.906) (-261.836) * (-264.818) [-260.415] (-260.860) (-260.841) -- 0:00:25
613500 -- (-267.838) (-259.968) (-261.622) [-264.085] * (-259.658) (-263.168) [-261.336] (-261.206) -- 0:00:25
614000 -- (-263.236) [-260.728] (-259.743) (-261.469) * (-260.646) (-260.056) (-261.867) [-260.766] -- 0:00:25
614500 -- [-262.337] (-266.326) (-263.648) (-261.217) * [-265.540] (-263.157) (-259.834) (-262.921) -- 0:00:25
615000 -- [-261.980] (-260.961) (-261.091) (-261.360) * [-263.614] (-266.558) (-259.992) (-260.181) -- 0:00:25
Average standard deviation of split frequencies: 0.011839
615500 -- [-260.347] (-263.447) (-261.247) (-263.249) * (-262.202) (-263.159) (-259.782) [-261.600] -- 0:00:24
616000 -- (-263.238) [-264.681] (-260.535) (-260.209) * (-260.806) (-261.124) [-260.194] (-260.903) -- 0:00:24
616500 -- (-264.399) (-262.760) [-262.418] (-260.099) * [-261.934] (-260.839) (-259.746) (-259.684) -- 0:00:24
617000 -- (-263.060) (-262.016) (-262.119) [-260.813] * (-264.909) [-260.516] (-264.128) (-261.559) -- 0:00:24
617500 -- [-261.954] (-259.354) (-263.463) (-261.664) * (-262.732) [-259.798] (-259.888) (-262.502) -- 0:00:24
618000 -- [-264.375] (-261.119) (-264.006) (-259.656) * [-260.605] (-261.028) (-263.277) (-262.462) -- 0:00:24
618500 -- [-264.474] (-262.831) (-263.309) (-262.753) * (-259.391) (-262.053) [-263.742] (-264.376) -- 0:00:24
619000 -- (-267.106) (-260.766) (-264.190) [-263.214] * [-262.274] (-262.461) (-260.545) (-262.807) -- 0:00:24
619500 -- (-263.572) (-260.823) [-260.236] (-261.313) * (-262.415) (-259.418) [-262.735] (-261.542) -- 0:00:24
620000 -- [-260.074] (-260.157) (-260.357) (-259.987) * (-262.883) (-265.935) [-260.822] (-261.012) -- 0:00:24
Average standard deviation of split frequencies: 0.011437
620500 -- (-260.476) [-261.858] (-261.527) (-265.662) * [-261.442] (-260.155) (-263.754) (-259.999) -- 0:00:24
621000 -- (-260.040) [-261.893] (-263.308) (-260.820) * (-260.889) (-261.118) (-262.283) [-259.875] -- 0:00:24
621500 -- [-261.750] (-260.284) (-260.571) (-260.228) * [-266.533] (-260.178) (-260.360) (-259.249) -- 0:00:24
622000 -- (-262.032) (-261.490) [-260.247] (-261.825) * (-261.007) (-264.473) (-263.056) [-260.167] -- 0:00:24
622500 -- (-261.446) (-263.965) [-260.253] (-264.320) * [-261.500] (-264.123) (-261.052) (-259.866) -- 0:00:24
623000 -- (-262.550) (-267.823) (-262.468) [-263.124] * (-261.007) (-259.934) [-261.201] (-261.264) -- 0:00:24
623500 -- (-261.650) (-260.776) [-259.812] (-265.019) * (-260.765) (-260.580) [-260.501] (-260.885) -- 0:00:24
624000 -- [-259.366] (-263.155) (-262.152) (-262.442) * (-262.723) (-261.986) (-260.355) [-259.588] -- 0:00:24
624500 -- (-259.826) (-266.234) (-264.068) [-265.672] * (-266.414) [-261.813] (-260.271) (-260.512) -- 0:00:24
625000 -- (-260.054) (-264.013) [-264.157] (-260.167) * [-260.799] (-260.743) (-259.996) (-259.060) -- 0:00:24
Average standard deviation of split frequencies: 0.010720
625500 -- (-261.679) [-260.279] (-265.744) (-259.865) * (-264.958) [-265.465] (-263.900) (-259.959) -- 0:00:24
626000 -- (-262.460) [-260.527] (-263.631) (-264.020) * [-263.285] (-266.642) (-261.950) (-259.578) -- 0:00:24
626500 -- [-261.564] (-260.683) (-262.870) (-263.256) * [-261.022] (-263.470) (-260.081) (-265.476) -- 0:00:24
627000 -- (-267.821) (-260.971) (-260.628) [-261.494] * [-261.006] (-260.091) (-260.186) (-261.442) -- 0:00:24
627500 -- [-262.310] (-263.855) (-260.654) (-261.875) * (-264.656) [-260.929] (-259.307) (-264.190) -- 0:00:24
628000 -- [-265.852] (-261.363) (-261.223) (-260.925) * (-261.596) [-259.302] (-261.470) (-262.164) -- 0:00:24
628500 -- (-264.570) (-259.553) (-262.671) [-264.922] * [-260.982] (-261.136) (-262.392) (-263.555) -- 0:00:24
629000 -- (-262.715) (-261.395) (-261.210) [-260.443] * (-259.376) [-260.236] (-260.999) (-266.075) -- 0:00:24
629500 -- (-262.113) (-261.045) [-260.802] (-260.243) * (-261.850) (-263.486) (-261.154) [-260.960] -- 0:00:24
630000 -- (-260.460) [-260.979] (-261.198) (-262.799) * (-264.725) (-261.279) (-259.045) [-261.178] -- 0:00:24
Average standard deviation of split frequencies: 0.010728
630500 -- (-259.755) (-267.406) (-259.866) [-260.255] * (-261.989) (-262.715) [-259.618] (-260.324) -- 0:00:24
631000 -- (-260.967) [-263.372] (-262.613) (-261.708) * (-260.095) (-260.914) (-262.792) [-259.619] -- 0:00:23
631500 -- (-260.121) (-260.001) (-261.568) [-260.466] * (-260.990) [-260.136] (-262.604) (-260.211) -- 0:00:23
632000 -- (-260.334) [-261.463] (-266.014) (-259.942) * [-260.535] (-261.497) (-263.816) (-260.955) -- 0:00:23
632500 -- (-260.906) (-260.890) [-262.445] (-260.988) * (-259.925) [-259.983] (-260.139) (-260.076) -- 0:00:23
633000 -- (-260.885) (-261.249) [-260.632] (-262.467) * (-260.917) (-262.656) [-259.796] (-262.223) -- 0:00:23
633500 -- (-259.741) (-260.373) [-260.614] (-261.265) * [-259.940] (-262.903) (-261.660) (-262.291) -- 0:00:23
634000 -- (-260.903) (-264.065) (-259.482) [-264.830] * [-261.261] (-262.685) (-260.146) (-260.676) -- 0:00:23
634500 -- (-261.537) (-261.185) (-261.715) [-259.322] * [-260.310] (-266.737) (-259.345) (-263.330) -- 0:00:23
635000 -- [-260.168] (-260.826) (-260.629) (-259.797) * (-261.544) (-263.471) [-260.767] (-260.026) -- 0:00:23
Average standard deviation of split frequencies: 0.010726
635500 -- [-259.788] (-263.932) (-262.768) (-259.992) * [-261.717] (-261.989) (-260.120) (-261.219) -- 0:00:23
636000 -- (-261.378) (-263.352) [-265.307] (-259.811) * [-260.417] (-262.002) (-260.551) (-266.566) -- 0:00:23
636500 -- (-261.608) (-265.560) [-269.728] (-259.862) * (-259.081) (-261.707) [-263.411] (-261.222) -- 0:00:23
637000 -- (-260.814) [-261.861] (-263.324) (-259.729) * (-260.480) (-263.184) (-261.764) [-264.723] -- 0:00:23
637500 -- (-260.853) [-261.395] (-262.306) (-259.702) * (-265.789) [-269.102] (-262.045) (-263.505) -- 0:00:23
638000 -- (-260.501) (-261.032) (-262.659) [-260.650] * (-262.184) (-260.341) (-262.344) [-264.845] -- 0:00:23
638500 -- [-259.364] (-261.986) (-259.181) (-261.783) * (-263.023) [-260.792] (-260.145) (-260.248) -- 0:00:23
639000 -- [-261.139] (-263.351) (-261.667) (-259.954) * (-260.769) (-268.813) (-259.644) [-259.879] -- 0:00:23
639500 -- [-262.272] (-262.401) (-260.198) (-262.889) * (-260.097) [-261.740] (-261.954) (-261.017) -- 0:00:23
640000 -- (-259.429) (-261.724) [-260.431] (-262.681) * [-261.586] (-260.506) (-261.316) (-261.862) -- 0:00:23
Average standard deviation of split frequencies: 0.010518
640500 -- [-261.120] (-260.933) (-261.704) (-262.430) * [-262.588] (-259.661) (-262.861) (-259.399) -- 0:00:23
641000 -- [-264.791] (-260.203) (-264.099) (-262.427) * (-268.573) [-260.352] (-259.474) (-259.867) -- 0:00:23
641500 -- (-261.866) (-259.677) [-261.115] (-262.118) * (-269.304) [-259.530] (-263.483) (-259.510) -- 0:00:23
642000 -- (-260.909) (-260.574) (-262.019) [-259.534] * (-261.263) (-259.739) [-263.545] (-264.430) -- 0:00:23
642500 -- [-260.894] (-262.513) (-260.736) (-261.045) * [-266.946] (-262.710) (-261.661) (-260.736) -- 0:00:23
643000 -- [-260.521] (-261.010) (-259.877) (-260.785) * (-259.703) [-260.526] (-261.736) (-260.382) -- 0:00:23
643500 -- (-259.786) (-262.570) (-260.635) [-260.004] * (-262.203) (-261.925) [-265.482] (-266.665) -- 0:00:23
644000 -- [-261.397] (-264.386) (-262.631) (-261.910) * (-261.038) (-261.776) (-262.467) [-263.684] -- 0:00:23
644500 -- (-260.509) [-263.990] (-261.777) (-262.464) * (-259.768) [-266.221] (-260.272) (-263.010) -- 0:00:23
645000 -- [-259.340] (-262.897) (-261.328) (-260.048) * (-263.445) (-260.506) (-260.156) [-259.637] -- 0:00:23
Average standard deviation of split frequencies: 0.010603
645500 -- [-259.521] (-260.008) (-262.220) (-260.051) * (-260.861) (-260.317) [-260.768] (-264.421) -- 0:00:23
646000 -- [-261.175] (-263.149) (-260.050) (-259.816) * (-261.346) [-266.552] (-261.596) (-264.282) -- 0:00:23
646500 -- (-262.220) [-262.680] (-261.751) (-263.216) * [-259.589] (-264.279) (-261.369) (-268.561) -- 0:00:22
647000 -- [-263.635] (-265.657) (-260.756) (-260.989) * (-260.423) (-260.471) (-260.638) [-267.749] -- 0:00:22
647500 -- (-260.566) (-265.332) [-260.393] (-259.713) * [-263.533] (-259.789) (-262.457) (-261.278) -- 0:00:22
648000 -- [-260.275] (-260.208) (-265.204) (-261.051) * (-260.913) (-261.688) [-264.885] (-260.431) -- 0:00:22
648500 -- (-260.649) [-261.732] (-260.127) (-263.904) * (-260.005) (-262.527) [-260.802] (-261.592) -- 0:00:22
649000 -- [-260.403] (-262.015) (-260.620) (-260.417) * (-260.509) (-265.388) [-260.151] (-260.296) -- 0:00:22
649500 -- (-261.603) (-262.787) (-261.802) [-259.065] * (-259.106) (-261.504) (-263.011) [-261.284] -- 0:00:22
650000 -- (-259.687) [-259.909] (-261.693) (-259.332) * [-261.453] (-260.120) (-260.533) (-259.874) -- 0:00:22
Average standard deviation of split frequencies: 0.010654
650500 -- [-261.552] (-260.047) (-260.605) (-259.171) * [-262.608] (-262.569) (-260.433) (-260.496) -- 0:00:22
651000 -- (-262.145) [-262.354] (-261.862) (-260.375) * (-261.046) [-261.850] (-260.878) (-260.373) -- 0:00:23
651500 -- (-260.514) (-262.974) (-262.151) [-260.502] * (-260.716) [-261.693] (-260.436) (-261.188) -- 0:00:23
652000 -- [-262.508] (-262.743) (-262.056) (-262.632) * (-263.498) [-261.355] (-261.863) (-260.179) -- 0:00:22
652500 -- (-260.173) [-259.506] (-261.066) (-260.134) * (-259.202) (-260.930) (-261.286) [-260.500] -- 0:00:22
653000 -- [-261.801] (-259.248) (-261.901) (-262.763) * (-261.313) (-263.078) [-259.697] (-260.196) -- 0:00:22
653500 -- (-266.298) (-261.144) [-260.114] (-260.612) * (-261.959) (-264.777) (-260.102) [-259.810] -- 0:00:22
654000 -- (-265.254) [-260.460] (-260.406) (-260.446) * [-260.664] (-264.508) (-265.077) (-259.230) -- 0:00:22
654500 -- (-261.781) (-262.981) (-261.583) [-259.528] * (-261.570) (-264.618) (-261.849) [-261.765] -- 0:00:22
655000 -- (-259.820) (-265.654) [-262.421] (-259.545) * (-261.777) (-261.444) (-259.565) [-262.293] -- 0:00:22
Average standard deviation of split frequencies: 0.010990
655500 -- [-261.215] (-262.547) (-261.237) (-262.467) * [-261.800] (-267.511) (-262.610) (-261.366) -- 0:00:22
656000 -- [-261.569] (-260.121) (-259.630) (-261.579) * (-259.884) (-265.955) (-262.712) [-259.754] -- 0:00:22
656500 -- (-260.867) [-259.618] (-263.931) (-262.289) * (-259.682) (-261.844) [-260.035] (-263.384) -- 0:00:22
657000 -- (-259.961) (-260.223) (-260.370) [-262.880] * [-260.295] (-260.686) (-261.684) (-261.154) -- 0:00:22
657500 -- [-261.616] (-261.264) (-260.434) (-262.225) * (-262.036) (-260.637) [-259.580] (-261.950) -- 0:00:22
658000 -- (-262.843) (-263.643) [-260.336] (-263.687) * (-260.645) (-264.098) (-263.151) [-260.614] -- 0:00:22
658500 -- [-260.590] (-262.028) (-260.954) (-260.296) * (-262.413) (-263.432) (-260.353) [-262.160] -- 0:00:22
659000 -- (-261.147) [-263.161] (-260.181) (-263.031) * [-262.027] (-264.047) (-260.965) (-261.872) -- 0:00:22
659500 -- (-261.536) (-262.882) (-260.377) [-262.163] * (-260.381) (-259.665) [-262.206] (-260.146) -- 0:00:22
660000 -- [-261.167] (-260.354) (-260.708) (-261.725) * (-265.181) (-261.669) [-260.082] (-262.736) -- 0:00:22
Average standard deviation of split frequencies: 0.010829
660500 -- (-262.105) [-260.410] (-259.388) (-260.078) * (-265.528) [-263.910] (-260.497) (-267.461) -- 0:00:22
661000 -- (-260.053) (-262.151) (-259.309) [-260.852] * (-260.021) (-259.587) (-260.480) [-263.623] -- 0:00:22
661500 -- (-262.364) (-261.071) (-260.265) [-259.240] * (-259.075) (-261.836) [-260.222] (-259.709) -- 0:00:22
662000 -- (-262.281) (-260.681) (-263.187) [-259.212] * (-259.324) (-263.684) [-260.046] (-262.647) -- 0:00:21
662500 -- (-259.984) [-260.494] (-262.256) (-261.416) * (-260.497) [-262.899] (-260.621) (-261.506) -- 0:00:21
663000 -- (-260.534) (-261.331) [-260.237] (-260.934) * (-259.368) (-261.107) [-264.446] (-259.904) -- 0:00:21
663500 -- (-259.960) (-260.602) (-260.216) [-260.310] * [-259.746] (-259.380) (-266.382) (-262.448) -- 0:00:21
664000 -- (-260.985) (-260.080) [-262.328] (-264.388) * (-259.728) (-260.359) (-261.627) [-259.341] -- 0:00:21
664500 -- (-259.762) (-262.878) [-262.686] (-263.458) * [-259.242] (-265.985) (-260.395) (-263.460) -- 0:00:21
665000 -- [-260.123] (-260.888) (-264.806) (-259.700) * (-261.162) (-261.375) [-259.983] (-264.428) -- 0:00:22
Average standard deviation of split frequencies: 0.010492
665500 -- (-262.326) (-262.747) (-262.328) [-262.817] * [-262.343] (-266.169) (-261.704) (-262.405) -- 0:00:22
666000 -- (-264.519) [-260.510] (-262.781) (-260.443) * [-260.684] (-263.255) (-260.099) (-259.793) -- 0:00:22
666500 -- [-262.404] (-262.471) (-265.082) (-262.548) * [-259.865] (-259.989) (-265.629) (-261.260) -- 0:00:22
667000 -- [-260.694] (-260.392) (-263.245) (-260.436) * (-261.972) (-262.187) [-260.544] (-261.522) -- 0:00:21
667500 -- (-260.717) (-261.001) (-263.449) [-260.999] * (-260.219) (-262.868) [-259.985] (-263.394) -- 0:00:21
668000 -- (-259.184) [-260.142] (-260.752) (-265.743) * (-260.207) [-261.602] (-262.807) (-261.554) -- 0:00:21
668500 -- [-260.527] (-263.250) (-260.432) (-263.484) * (-261.263) (-260.490) (-262.673) [-260.689] -- 0:00:21
669000 -- [-260.570] (-262.200) (-259.832) (-262.277) * (-260.542) (-260.648) (-264.413) [-260.053] -- 0:00:21
669500 -- (-259.789) [-260.586] (-262.932) (-262.388) * (-263.771) (-262.879) [-261.489] (-264.239) -- 0:00:21
670000 -- (-264.735) (-265.639) [-264.007] (-260.006) * (-260.610) (-263.346) (-261.232) [-259.666] -- 0:00:21
Average standard deviation of split frequencies: 0.010419
670500 -- (-262.335) (-266.186) [-260.670] (-261.428) * (-261.019) (-261.605) (-264.635) [-260.531] -- 0:00:21
671000 -- (-262.866) [-259.454] (-261.030) (-262.608) * [-261.695] (-262.410) (-264.749) (-262.701) -- 0:00:21
671500 -- [-260.834] (-260.390) (-260.064) (-264.028) * (-262.685) (-259.913) (-260.430) [-262.325] -- 0:00:21
672000 -- [-260.663] (-259.564) (-260.106) (-260.591) * (-262.278) [-260.335] (-261.510) (-260.254) -- 0:00:21
672500 -- (-260.289) (-261.950) (-260.652) [-261.640] * (-261.044) [-261.929] (-261.553) (-259.232) -- 0:00:21
673000 -- (-259.517) (-262.204) [-261.884] (-262.644) * [-259.736] (-262.306) (-260.280) (-260.349) -- 0:00:21
673500 -- [-259.462] (-259.400) (-260.293) (-259.350) * (-263.862) (-261.867) (-259.621) [-260.862] -- 0:00:21
674000 -- (-261.534) [-260.172] (-260.453) (-260.740) * (-266.828) (-264.732) [-261.077] (-259.959) -- 0:00:21
674500 -- (-265.067) (-261.551) (-264.175) [-260.821] * (-260.861) [-261.996] (-260.669) (-261.222) -- 0:00:21
675000 -- (-261.607) (-263.396) (-263.647) [-259.201] * (-260.705) [-262.101] (-259.505) (-261.629) -- 0:00:21
Average standard deviation of split frequencies: 0.010542
675500 -- (-259.067) [-260.709] (-260.465) (-265.093) * (-262.251) [-260.447] (-261.192) (-262.777) -- 0:00:21
676000 -- [-259.114] (-260.611) (-259.747) (-261.924) * (-260.672) (-260.898) (-261.485) [-261.203] -- 0:00:21
676500 -- (-261.521) (-261.273) [-261.416] (-260.053) * (-261.686) [-259.584] (-261.310) (-260.306) -- 0:00:21
677000 -- (-259.884) (-261.171) [-259.897] (-260.756) * (-261.073) [-259.796] (-260.048) (-261.089) -- 0:00:20
677500 -- (-261.845) (-259.495) [-263.251] (-261.996) * (-260.447) [-260.435] (-259.489) (-262.369) -- 0:00:20
678000 -- [-261.232] (-260.370) (-261.385) (-260.633) * (-261.279) (-260.911) (-261.116) [-261.620] -- 0:00:20
678500 -- (-259.819) [-262.847] (-260.867) (-262.139) * [-260.300] (-264.885) (-260.174) (-261.466) -- 0:00:20
679000 -- (-262.686) (-260.363) [-263.912] (-262.402) * (-264.137) (-264.254) (-260.621) [-260.212] -- 0:00:20
679500 -- (-261.336) (-261.345) [-261.689] (-262.418) * (-261.492) (-263.639) (-261.136) [-263.379] -- 0:00:21
680000 -- [-259.215] (-260.082) (-260.695) (-263.756) * (-261.795) (-261.126) (-264.941) [-262.982] -- 0:00:21
Average standard deviation of split frequencies: 0.010307
680500 -- (-260.192) (-261.247) [-264.361] (-263.076) * (-260.578) [-260.306] (-259.983) (-259.465) -- 0:00:21
681000 -- (-263.139) (-260.169) (-260.691) [-264.126] * (-259.154) [-259.699] (-261.921) (-260.972) -- 0:00:21
681500 -- (-259.795) (-260.183) (-261.312) [-262.423] * [-260.681] (-261.026) (-261.419) (-260.800) -- 0:00:21
682000 -- (-260.063) (-259.603) (-263.175) [-261.311] * (-263.110) [-264.257] (-259.847) (-260.572) -- 0:00:20
682500 -- (-259.697) [-259.778] (-261.122) (-260.405) * (-264.326) (-260.626) (-260.480) [-259.253] -- 0:00:20
683000 -- [-261.019] (-266.285) (-262.836) (-260.463) * (-260.048) (-259.768) (-261.345) [-260.804] -- 0:00:20
683500 -- (-259.932) (-259.103) [-260.739] (-262.042) * (-266.538) [-261.699] (-262.956) (-260.824) -- 0:00:20
684000 -- (-262.767) [-261.376] (-264.536) (-261.516) * [-261.883] (-264.333) (-260.908) (-262.515) -- 0:00:20
684500 -- (-262.859) (-262.367) [-262.992] (-261.254) * (-260.285) (-260.491) (-262.021) [-263.901] -- 0:00:20
685000 -- (-265.148) (-259.633) (-266.595) [-260.066] * (-261.784) (-262.053) [-260.333] (-259.709) -- 0:00:20
Average standard deviation of split frequencies: 0.010146
685500 -- [-261.392] (-261.116) (-261.818) (-260.236) * (-261.527) [-259.436] (-264.409) (-261.080) -- 0:00:20
686000 -- [-261.269] (-260.544) (-262.288) (-260.532) * [-260.233] (-260.731) (-262.935) (-261.995) -- 0:00:20
686500 -- [-261.334] (-263.139) (-260.270) (-263.429) * [-261.542] (-262.321) (-263.511) (-263.924) -- 0:00:20
687000 -- (-260.651) (-263.740) [-260.610] (-261.501) * (-264.866) (-263.912) (-262.135) [-263.254] -- 0:00:20
687500 -- (-265.456) [-260.247] (-259.853) (-260.915) * [-261.618] (-262.066) (-262.123) (-263.635) -- 0:00:20
688000 -- (-265.919) [-267.260] (-260.563) (-260.372) * [-261.923] (-264.180) (-260.792) (-260.365) -- 0:00:20
688500 -- (-263.817) (-260.942) (-260.144) [-260.440] * (-260.439) (-263.366) [-261.291] (-262.014) -- 0:00:20
689000 -- (-260.929) [-260.162] (-261.403) (-263.980) * [-260.561] (-260.168) (-259.224) (-260.297) -- 0:00:20
689500 -- (-260.259) (-261.534) [-259.264] (-265.184) * (-262.968) [-259.752] (-260.958) (-259.965) -- 0:00:20
690000 -- (-265.112) (-264.494) (-260.447) [-260.005] * [-260.755] (-263.056) (-260.869) (-260.523) -- 0:00:20
Average standard deviation of split frequencies: 0.009997
690500 -- (-260.660) (-260.617) (-260.296) [-260.209] * [-260.974] (-264.769) (-268.260) (-259.338) -- 0:00:20
691000 -- (-263.073) (-260.245) (-260.729) [-260.778] * [-260.621] (-263.291) (-264.712) (-259.492) -- 0:00:20
691500 -- (-264.336) [-267.511] (-263.182) (-260.141) * (-260.292) (-259.876) [-260.076] (-262.950) -- 0:00:20
692000 -- [-263.935] (-264.748) (-261.852) (-261.422) * [-260.088] (-259.996) (-261.032) (-260.972) -- 0:00:20
692500 -- (-262.921) (-262.358) [-263.127] (-261.006) * (-263.260) [-259.236] (-260.542) (-262.924) -- 0:00:19
693000 -- (-260.181) [-260.575] (-262.017) (-262.598) * [-262.447] (-259.514) (-260.340) (-260.029) -- 0:00:19
693500 -- (-260.867) (-261.712) (-259.629) [-261.457] * (-260.821) [-260.851] (-261.304) (-260.887) -- 0:00:19
694000 -- (-259.792) (-262.402) [-259.058] (-262.612) * (-260.704) [-262.540] (-259.286) (-262.487) -- 0:00:19
694500 -- (-259.378) (-262.977) [-259.480] (-260.876) * (-263.529) (-262.944) [-260.335] (-260.404) -- 0:00:19
695000 -- [-263.638] (-262.152) (-260.466) (-260.254) * (-265.935) (-261.024) (-261.630) [-259.246] -- 0:00:20
Average standard deviation of split frequencies: 0.009960
695500 -- [-260.585] (-262.584) (-264.757) (-261.411) * [-261.058] (-263.270) (-259.882) (-261.235) -- 0:00:20
696000 -- (-260.687) (-263.221) [-260.596] (-259.913) * [-259.986] (-260.953) (-260.316) (-260.932) -- 0:00:20
696500 -- [-260.901] (-260.064) (-261.335) (-261.029) * [-260.609] (-264.254) (-261.169) (-262.887) -- 0:00:20
697000 -- (-260.410) (-262.714) (-259.732) [-262.678] * (-260.824) (-267.769) (-263.844) [-260.514] -- 0:00:19
697500 -- (-261.959) (-261.978) [-260.427] (-262.950) * (-262.781) (-265.502) (-261.263) [-260.330] -- 0:00:19
698000 -- (-260.238) [-259.901] (-261.914) (-263.133) * (-264.094) [-262.016] (-260.671) (-263.733) -- 0:00:19
698500 -- (-265.676) (-261.745) (-262.868) [-260.585] * (-262.821) (-263.017) [-259.692] (-261.391) -- 0:00:19
699000 -- (-261.943) (-261.035) [-260.142] (-260.548) * (-262.395) (-267.498) [-260.246] (-261.042) -- 0:00:19
699500 -- (-265.970) (-261.804) [-261.092] (-265.313) * (-262.095) [-260.551] (-260.377) (-259.945) -- 0:00:19
700000 -- (-261.841) [-261.570] (-263.622) (-260.497) * (-261.772) [-259.801] (-261.190) (-261.608) -- 0:00:19
Average standard deviation of split frequencies: 0.010092
700500 -- (-259.117) (-263.744) [-260.029] (-260.200) * (-261.550) [-263.355] (-260.690) (-259.488) -- 0:00:19
701000 -- (-261.678) (-262.793) (-260.313) [-263.074] * (-263.969) (-261.970) (-260.375) [-260.397] -- 0:00:19
701500 -- [-260.934] (-261.471) (-259.856) (-262.683) * (-265.485) [-263.174] (-262.725) (-261.308) -- 0:00:19
702000 -- (-262.710) (-261.228) (-261.062) [-262.965] * (-263.202) (-262.824) [-259.431] (-261.719) -- 0:00:19
702500 -- [-259.875] (-263.682) (-260.549) (-264.732) * (-262.507) (-261.109) (-261.123) [-260.982] -- 0:00:19
703000 -- (-260.085) [-259.837] (-260.656) (-260.667) * [-261.168] (-259.940) (-260.933) (-265.294) -- 0:00:19
703500 -- (-261.006) [-262.958] (-260.383) (-262.725) * (-261.242) [-260.952] (-262.251) (-259.495) -- 0:00:19
704000 -- (-259.304) (-262.186) (-263.265) [-261.273] * (-259.611) (-264.588) [-260.317] (-262.618) -- 0:00:19
704500 -- [-260.134] (-261.239) (-260.497) (-260.382) * (-263.607) (-259.287) (-260.932) [-261.197] -- 0:00:19
705000 -- [-260.333] (-261.346) (-262.424) (-261.200) * (-267.419) [-260.052] (-260.879) (-260.582) -- 0:00:19
Average standard deviation of split frequencies: 0.009584
705500 -- [-259.473] (-262.908) (-259.271) (-266.358) * (-262.045) (-260.409) [-260.472] (-262.235) -- 0:00:19
706000 -- (-260.546) (-259.974) [-260.214] (-262.639) * (-261.642) [-260.756] (-268.858) (-259.246) -- 0:00:19
706500 -- (-260.556) [-260.937] (-260.431) (-259.738) * (-262.261) (-260.001) [-259.712] (-261.053) -- 0:00:19
707000 -- (-260.444) [-259.701] (-260.294) (-259.482) * (-260.969) (-259.382) (-259.806) [-261.826] -- 0:00:19
707500 -- (-261.303) [-261.822] (-261.533) (-262.093) * (-260.654) (-259.955) (-260.569) [-261.901] -- 0:00:19
708000 -- (-263.211) (-262.376) (-263.567) [-261.917] * (-263.727) [-264.266] (-265.099) (-259.370) -- 0:00:18
708500 -- [-261.029] (-261.689) (-264.088) (-263.127) * [-262.256] (-261.894) (-261.575) (-259.596) -- 0:00:18
709000 -- (-261.946) (-261.942) [-265.076] (-260.725) * (-262.440) (-261.066) (-262.119) [-259.804] -- 0:00:18
709500 -- (-259.713) (-261.730) (-265.615) [-260.455] * (-262.075) [-261.830] (-265.159) (-265.480) -- 0:00:18
710000 -- [-264.127] (-263.433) (-268.770) (-262.750) * (-262.063) (-264.370) [-261.793] (-269.610) -- 0:00:19
Average standard deviation of split frequencies: 0.009833
710500 -- (-263.239) [-261.269] (-261.286) (-262.244) * [-259.639] (-259.458) (-263.080) (-260.197) -- 0:00:19
711000 -- (-263.183) (-260.300) [-260.498] (-259.937) * (-261.848) [-262.364] (-262.423) (-261.157) -- 0:00:19
711500 -- (-261.736) (-260.495) (-259.926) [-261.496] * (-260.303) (-259.521) (-262.410) [-262.017] -- 0:00:19
712000 -- [-263.181] (-263.491) (-260.757) (-261.680) * (-260.427) (-263.531) (-259.656) [-261.767] -- 0:00:19
712500 -- (-260.252) (-261.791) (-264.038) [-263.391] * (-262.691) (-263.967) [-263.512] (-266.559) -- 0:00:18
713000 -- (-260.379) (-260.152) (-263.647) [-260.826] * (-259.804) (-259.692) (-263.465) [-260.385] -- 0:00:18
713500 -- (-260.511) (-261.146) (-264.931) [-260.539] * (-261.970) (-261.943) (-262.860) [-261.782] -- 0:00:18
714000 -- (-261.866) (-262.417) (-263.128) [-262.025] * (-263.095) (-261.136) (-259.214) [-260.557] -- 0:00:18
714500 -- (-260.488) [-262.745] (-261.631) (-266.023) * (-263.033) [-263.031] (-262.163) (-263.210) -- 0:00:18
715000 -- [-260.463] (-266.743) (-260.728) (-263.981) * (-260.315) [-261.168] (-259.707) (-267.441) -- 0:00:18
Average standard deviation of split frequencies: 0.009798
715500 -- [-261.255] (-261.707) (-263.717) (-259.674) * (-262.045) (-263.764) [-261.667] (-262.741) -- 0:00:18
716000 -- (-261.203) (-260.385) (-263.450) [-261.790] * (-263.990) (-263.723) (-262.988) [-261.090] -- 0:00:18
716500 -- (-261.267) (-259.120) [-259.413] (-262.476) * (-261.121) (-261.037) [-260.991] (-262.114) -- 0:00:18
717000 -- [-261.076] (-260.968) (-260.003) (-264.158) * (-260.258) (-259.829) (-261.288) [-262.116] -- 0:00:18
717500 -- [-261.014] (-264.952) (-259.176) (-261.197) * (-260.874) (-260.603) [-259.928] (-263.131) -- 0:00:18
718000 -- [-260.520] (-265.597) (-260.201) (-261.051) * (-261.464) [-263.242] (-259.511) (-260.736) -- 0:00:18
718500 -- (-260.097) (-263.249) [-261.081] (-260.342) * (-261.174) (-261.458) [-261.107] (-261.852) -- 0:00:18
719000 -- (-260.065) [-263.983] (-261.066) (-262.668) * [-259.751] (-263.131) (-259.714) (-262.303) -- 0:00:18
719500 -- [-260.180] (-263.128) (-263.187) (-261.640) * (-264.449) (-261.246) [-259.663] (-263.345) -- 0:00:18
720000 -- (-263.111) [-262.639] (-261.118) (-260.212) * (-260.380) (-262.571) (-265.709) [-262.873] -- 0:00:18
Average standard deviation of split frequencies: 0.010343
720500 -- (-262.077) (-262.163) (-266.893) [-259.509] * [-259.667] (-261.560) (-261.218) (-259.312) -- 0:00:18
721000 -- (-263.512) [-260.707] (-263.897) (-262.243) * (-261.076) (-262.544) [-262.577] (-261.030) -- 0:00:18
721500 -- [-261.226] (-261.099) (-261.771) (-260.284) * (-259.731) [-261.232] (-263.230) (-261.733) -- 0:00:18
722000 -- [-261.064] (-259.799) (-259.450) (-260.806) * (-259.946) [-262.205] (-262.258) (-262.881) -- 0:00:18
722500 -- (-260.157) [-260.110] (-262.120) (-260.891) * [-261.020] (-264.876) (-263.204) (-262.974) -- 0:00:18
723000 -- (-259.826) (-262.080) (-260.275) [-259.780] * (-260.960) [-260.896] (-260.507) (-261.468) -- 0:00:18
723500 -- (-259.659) (-259.944) (-260.250) [-259.959] * [-264.361] (-260.987) (-260.828) (-259.848) -- 0:00:17
724000 -- (-265.171) [-260.003] (-261.938) (-259.374) * [-260.083] (-260.456) (-262.302) (-260.771) -- 0:00:18
724500 -- (-260.893) (-261.935) [-261.376] (-259.320) * [-260.428] (-259.605) (-266.642) (-261.187) -- 0:00:18
725000 -- [-263.296] (-259.239) (-262.711) (-259.420) * (-261.013) [-260.523] (-261.382) (-262.236) -- 0:00:18
Average standard deviation of split frequencies: 0.010957
725500 -- (-267.375) (-259.658) (-260.421) [-264.412] * (-259.784) (-260.070) [-261.115] (-260.771) -- 0:00:18
726000 -- (-263.423) [-259.970] (-261.324) (-261.272) * [-259.319] (-260.140) (-263.464) (-261.048) -- 0:00:18
726500 -- [-260.341] (-259.331) (-261.689) (-260.918) * [-259.828] (-263.562) (-262.045) (-261.150) -- 0:00:18
727000 -- (-264.853) [-259.728] (-261.740) (-263.518) * (-260.892) [-261.145] (-264.296) (-262.482) -- 0:00:18
727500 -- [-259.843] (-259.830) (-260.461) (-262.193) * (-263.114) (-260.622) (-259.340) [-261.561] -- 0:00:17
728000 -- (-267.212) (-261.895) [-260.824] (-260.041) * (-264.233) (-260.802) [-259.501] (-259.835) -- 0:00:17
728500 -- (-261.620) (-262.639) (-261.663) [-260.039] * (-262.910) (-260.684) (-259.500) [-260.954] -- 0:00:17
729000 -- (-262.024) [-260.745] (-263.020) (-259.728) * (-261.313) [-259.621] (-259.708) (-264.938) -- 0:00:17
729500 -- (-263.144) [-259.894] (-262.178) (-262.879) * (-262.257) (-259.749) (-259.552) [-264.849] -- 0:00:17
730000 -- [-262.582] (-262.469) (-261.302) (-260.491) * (-264.085) [-259.573] (-260.693) (-263.799) -- 0:00:17
Average standard deviation of split frequencies: 0.011250
730500 -- (-260.736) (-270.699) [-263.716] (-260.085) * (-261.686) (-262.665) [-263.941] (-264.423) -- 0:00:17
731000 -- [-261.296] (-264.344) (-260.745) (-261.870) * (-261.615) (-260.835) (-260.725) [-259.547] -- 0:00:17
731500 -- (-262.228) (-262.404) (-261.168) [-261.412] * (-259.126) [-263.056] (-261.073) (-260.052) -- 0:00:17
732000 -- [-259.290] (-262.193) (-261.520) (-261.999) * (-259.855) [-262.221] (-261.214) (-264.359) -- 0:00:17
732500 -- (-259.654) (-264.805) [-261.747] (-266.268) * (-261.165) [-261.991] (-261.476) (-260.978) -- 0:00:17
733000 -- (-260.106) (-263.450) (-263.128) [-265.195] * [-259.530] (-259.744) (-260.903) (-261.144) -- 0:00:17
733500 -- [-259.790] (-263.087) (-261.049) (-262.735) * (-262.063) (-261.577) [-262.107] (-264.581) -- 0:00:17
734000 -- (-260.400) (-262.026) [-260.220] (-262.231) * [-261.245] (-261.107) (-260.228) (-263.847) -- 0:00:17
734500 -- (-262.875) (-262.453) (-262.987) [-262.629] * (-262.078) [-260.660] (-261.600) (-261.403) -- 0:00:17
735000 -- (-260.232) (-260.957) (-260.389) [-261.922] * (-261.478) [-260.819] (-262.043) (-261.735) -- 0:00:17
Average standard deviation of split frequencies: 0.011249
735500 -- (-264.608) (-260.925) [-262.787] (-262.991) * (-262.894) [-262.826] (-263.314) (-261.327) -- 0:00:17
736000 -- (-261.212) (-260.364) [-260.077] (-261.183) * (-259.420) [-259.986] (-261.335) (-260.410) -- 0:00:17
736500 -- (-261.972) (-260.106) [-261.643] (-264.624) * (-262.012) (-259.709) [-261.763] (-262.561) -- 0:00:17
737000 -- (-264.208) [-259.856] (-259.734) (-262.808) * [-259.203] (-260.225) (-262.516) (-262.418) -- 0:00:17
737500 -- (-261.854) (-259.605) [-259.782] (-263.238) * [-260.805] (-262.429) (-262.510) (-259.831) -- 0:00:17
738000 -- (-260.736) (-263.349) [-262.157] (-261.060) * (-260.848) (-264.337) (-261.801) [-261.439] -- 0:00:17
738500 -- (-262.694) [-263.550] (-262.220) (-262.333) * (-260.201) (-262.194) (-260.328) [-259.777] -- 0:00:17
739000 -- (-260.269) (-260.285) (-261.223) [-260.405] * (-260.601) (-265.302) (-265.196) [-262.288] -- 0:00:17
739500 -- (-262.179) (-259.163) (-266.147) [-260.109] * [-260.380] (-264.266) (-262.536) (-260.510) -- 0:00:17
740000 -- (-262.196) (-260.602) [-264.344] (-262.786) * (-262.241) (-260.829) (-260.046) [-259.273] -- 0:00:17
Average standard deviation of split frequencies: 0.011058
740500 -- (-260.713) (-259.362) (-263.990) [-260.176] * (-262.732) (-260.169) [-261.714] (-264.689) -- 0:00:17
741000 -- [-260.997] (-263.572) (-259.649) (-260.010) * (-261.683) (-261.314) [-261.042] (-260.198) -- 0:00:17
741500 -- (-259.336) (-265.809) [-260.637] (-260.433) * (-261.731) (-260.209) [-259.953] (-259.965) -- 0:00:17
742000 -- (-262.660) [-264.434] (-260.897) (-263.609) * (-260.933) (-259.478) (-261.674) [-261.205] -- 0:00:17
742500 -- [-262.024] (-267.878) (-262.943) (-261.290) * [-259.434] (-264.110) (-259.564) (-261.600) -- 0:00:16
743000 -- (-263.334) (-265.013) [-259.981] (-262.356) * [-260.144] (-264.096) (-261.083) (-260.888) -- 0:00:16
743500 -- (-260.218) (-261.856) [-259.715] (-264.481) * (-259.789) (-260.726) [-262.049] (-260.588) -- 0:00:16
744000 -- [-260.624] (-260.380) (-264.458) (-265.064) * [-262.341] (-261.947) (-262.832) (-259.279) -- 0:00:16
744500 -- (-260.899) (-262.345) (-261.156) [-259.696] * (-262.903) (-262.899) (-267.839) [-259.784] -- 0:00:16
745000 -- [-259.391] (-259.549) (-261.505) (-260.550) * (-261.317) (-265.647) (-262.367) [-259.412] -- 0:00:16
Average standard deviation of split frequencies: 0.010703
745500 -- (-261.587) (-263.891) [-261.257] (-260.106) * [-259.699] (-264.142) (-263.842) (-261.420) -- 0:00:16
746000 -- [-261.096] (-261.506) (-259.979) (-261.068) * [-263.788] (-260.768) (-259.764) (-263.736) -- 0:00:16
746500 -- (-259.258) (-261.722) (-261.730) [-263.667] * (-262.789) [-264.698] (-259.865) (-259.492) -- 0:00:16
747000 -- [-259.545] (-260.879) (-259.464) (-262.073) * (-262.531) [-262.030] (-262.721) (-259.153) -- 0:00:16
747500 -- [-261.021] (-261.608) (-260.327) (-260.112) * (-266.244) (-261.885) [-261.510] (-260.970) -- 0:00:16
748000 -- (-261.233) (-262.823) (-261.153) [-260.458] * (-262.909) [-261.591] (-263.650) (-259.898) -- 0:00:16
748500 -- [-259.453] (-262.979) (-262.218) (-262.358) * [-262.115] (-265.741) (-259.955) (-260.476) -- 0:00:16
749000 -- (-259.527) (-261.233) (-260.281) [-259.732] * (-261.144) [-262.210] (-259.935) (-260.512) -- 0:00:16
749500 -- [-260.535] (-262.544) (-261.653) (-261.958) * [-260.842] (-267.549) (-261.639) (-262.228) -- 0:00:16
750000 -- (-261.911) [-259.978] (-264.199) (-261.364) * (-259.913) (-263.221) [-262.038] (-260.524) -- 0:00:16
Average standard deviation of split frequencies: 0.010676
750500 -- (-263.942) (-261.382) [-263.954] (-260.020) * (-259.398) (-263.660) (-265.828) [-263.202] -- 0:00:16
751000 -- [-262.976] (-261.726) (-268.231) (-259.828) * (-259.675) (-259.093) [-261.973] (-260.074) -- 0:00:16
751500 -- [-266.454] (-261.715) (-265.316) (-260.499) * (-261.000) [-259.859] (-260.219) (-260.705) -- 0:00:16
752000 -- (-260.877) [-263.278] (-259.645) (-260.854) * (-261.542) (-260.407) (-260.433) [-263.148] -- 0:00:16
752500 -- (-260.787) (-262.092) (-259.526) [-260.957] * (-262.184) (-259.910) [-259.882] (-263.296) -- 0:00:16
753000 -- (-260.806) (-262.596) [-261.932] (-260.900) * (-260.505) (-262.014) (-260.162) [-263.028] -- 0:00:16
753500 -- [-263.856] (-263.934) (-262.679) (-262.022) * (-261.080) (-259.532) (-263.261) [-260.621] -- 0:00:16
754000 -- [-260.739] (-270.299) (-260.347) (-259.720) * [-259.768] (-265.437) (-262.405) (-264.236) -- 0:00:16
754500 -- (-261.737) (-262.237) [-259.249] (-259.794) * (-262.200) [-269.754] (-262.462) (-267.288) -- 0:00:16
755000 -- (-259.359) [-261.855] (-260.112) (-262.532) * [-260.323] (-264.357) (-264.055) (-263.719) -- 0:00:16
Average standard deviation of split frequencies: 0.010522
755500 -- (-260.931) [-262.304] (-260.448) (-262.621) * (-260.936) [-261.293] (-263.393) (-261.005) -- 0:00:16
756000 -- (-263.280) [-262.539] (-266.920) (-259.525) * (-261.831) (-261.236) (-265.699) [-260.396] -- 0:00:16
756500 -- (-268.199) (-264.063) [-260.953] (-260.442) * [-260.975] (-261.164) (-261.884) (-260.422) -- 0:00:16
757000 -- (-265.375) (-259.584) [-261.320] (-263.152) * [-260.950] (-261.300) (-260.293) (-259.913) -- 0:00:16
757500 -- (-264.857) (-261.860) (-264.055) [-264.633] * (-261.758) [-260.749] (-261.817) (-261.522) -- 0:00:16
758000 -- (-264.771) (-260.221) (-264.594) [-260.520] * (-264.369) (-260.180) (-261.608) [-260.253] -- 0:00:15
758500 -- [-262.180] (-262.164) (-259.841) (-260.107) * (-261.684) (-265.593) [-259.837] (-261.618) -- 0:00:15
759000 -- [-260.444] (-262.974) (-260.978) (-259.684) * [-261.487] (-262.628) (-261.239) (-259.863) -- 0:00:15
759500 -- (-263.189) (-263.723) [-260.534] (-262.437) * (-260.299) (-260.376) (-259.840) [-260.030] -- 0:00:15
760000 -- (-263.651) (-261.842) [-260.487] (-264.589) * (-260.861) [-261.498] (-260.767) (-262.192) -- 0:00:15
Average standard deviation of split frequencies: 0.010419
760500 -- (-260.857) (-264.711) [-260.837] (-262.375) * [-262.345] (-264.202) (-262.310) (-261.661) -- 0:00:15
761000 -- [-262.979] (-266.735) (-264.595) (-261.156) * (-264.913) (-261.053) (-261.564) [-260.060] -- 0:00:15
761500 -- (-263.409) (-260.519) [-260.854] (-263.433) * (-262.720) (-261.681) (-260.831) [-261.703] -- 0:00:15
762000 -- [-263.321] (-262.495) (-261.058) (-262.148) * (-265.353) [-261.721] (-262.425) (-264.207) -- 0:00:15
762500 -- (-261.712) [-260.308] (-261.021) (-259.438) * (-261.206) (-261.061) [-265.074] (-264.648) -- 0:00:15
763000 -- (-260.875) (-262.963) [-262.212] (-260.244) * (-261.403) [-265.392] (-260.248) (-267.213) -- 0:00:15
763500 -- (-260.178) (-261.782) [-264.475] (-259.713) * (-260.190) [-259.205] (-260.192) (-261.304) -- 0:00:15
764000 -- (-264.066) (-260.882) [-261.793] (-260.208) * (-259.870) (-259.368) [-260.166] (-261.372) -- 0:00:15
764500 -- (-261.646) (-264.936) [-266.786] (-262.627) * [-261.060] (-261.264) (-262.624) (-261.581) -- 0:00:15
765000 -- [-262.491] (-263.264) (-261.341) (-265.040) * [-260.311] (-260.315) (-260.308) (-261.710) -- 0:00:15
Average standard deviation of split frequencies: 0.010500
765500 -- (-261.120) (-262.394) (-261.818) [-263.460] * [-260.843] (-264.345) (-260.749) (-260.911) -- 0:00:15
766000 -- [-260.636] (-265.364) (-262.635) (-260.818) * (-263.054) (-263.574) [-259.459] (-261.571) -- 0:00:15
766500 -- [-264.182] (-260.335) (-260.076) (-259.654) * [-263.993] (-264.540) (-259.648) (-263.853) -- 0:00:15
767000 -- [-261.607] (-259.511) (-261.890) (-261.575) * (-262.640) [-260.565] (-261.781) (-263.665) -- 0:00:15
767500 -- (-259.513) (-264.908) [-261.308] (-259.934) * (-263.894) (-260.420) [-259.477] (-259.816) -- 0:00:15
768000 -- (-261.188) [-262.672] (-261.651) (-261.685) * [-262.585] (-261.043) (-260.405) (-259.800) -- 0:00:15
768500 -- (-262.449) (-263.211) (-261.727) [-261.173] * [-259.917] (-260.842) (-262.332) (-265.837) -- 0:00:15
769000 -- [-259.389] (-260.930) (-261.506) (-266.545) * (-262.171) [-260.541] (-259.911) (-262.165) -- 0:00:15
769500 -- [-259.802] (-260.775) (-260.502) (-263.166) * [-261.029] (-261.257) (-259.535) (-262.830) -- 0:00:15
770000 -- (-259.717) (-260.138) [-261.083] (-261.443) * (-261.002) (-262.541) [-261.381] (-261.729) -- 0:00:15
Average standard deviation of split frequencies: 0.010437
770500 -- [-260.908] (-265.424) (-260.478) (-261.021) * (-263.165) (-261.522) (-263.014) [-259.077] -- 0:00:15
771000 -- (-259.674) (-260.277) (-262.530) [-260.925] * (-260.854) (-262.347) [-262.640] (-266.428) -- 0:00:15
771500 -- [-260.073] (-262.694) (-262.287) (-260.283) * (-265.575) [-261.538] (-260.505) (-261.979) -- 0:00:15
772000 -- (-261.733) (-260.241) (-261.097) [-262.403] * (-262.834) (-259.782) (-261.000) [-262.475] -- 0:00:15
772500 -- (-263.667) [-258.918] (-261.314) (-259.812) * [-259.880] (-260.921) (-260.427) (-260.164) -- 0:00:15
773000 -- (-264.618) (-260.123) [-261.372] (-260.458) * (-267.483) (-261.017) [-259.612] (-265.055) -- 0:00:14
773500 -- (-261.626) (-260.917) [-260.046] (-260.515) * (-271.243) (-262.165) (-260.862) [-260.554] -- 0:00:14
774000 -- (-259.754) (-260.762) (-260.737) [-261.378] * (-267.743) (-260.881) [-259.744] (-259.550) -- 0:00:14
774500 -- [-263.411] (-260.379) (-260.751) (-263.385) * [-263.489] (-260.206) (-263.629) (-266.939) -- 0:00:14
775000 -- [-260.522] (-261.830) (-262.563) (-261.599) * [-261.344] (-263.603) (-262.065) (-262.222) -- 0:00:15
Average standard deviation of split frequencies: 0.011006
775500 -- (-262.599) [-260.795] (-261.957) (-260.578) * (-260.453) (-262.911) [-260.743] (-264.207) -- 0:00:15
776000 -- [-261.581] (-260.524) (-260.209) (-260.387) * (-261.667) [-262.201] (-260.710) (-261.669) -- 0:00:15
776500 -- [-261.871] (-260.691) (-265.047) (-261.657) * (-266.822) (-259.743) [-261.945] (-261.075) -- 0:00:14
777000 -- (-263.063) [-262.353] (-263.750) (-261.236) * (-262.438) (-261.559) [-259.958] (-268.911) -- 0:00:14
777500 -- (-260.276) [-260.095] (-264.349) (-261.229) * [-260.024] (-261.949) (-261.758) (-267.915) -- 0:00:14
778000 -- [-260.541] (-262.822) (-262.821) (-260.080) * [-259.984] (-261.171) (-260.257) (-259.007) -- 0:00:14
778500 -- (-260.626) [-263.427] (-262.315) (-259.834) * (-260.226) (-265.168) (-262.420) [-259.938] -- 0:00:14
779000 -- (-258.939) (-262.810) (-262.001) [-261.233] * (-260.843) [-259.758] (-259.925) (-263.620) -- 0:00:14
779500 -- [-259.849] (-261.263) (-260.882) (-260.511) * (-263.266) (-260.448) [-261.027] (-262.408) -- 0:00:14
780000 -- (-260.464) (-261.480) [-261.381] (-259.599) * (-261.499) [-259.511] (-260.147) (-261.459) -- 0:00:14
Average standard deviation of split frequencies: 0.010379
780500 -- (-262.347) [-263.345] (-261.972) (-260.461) * [-264.916] (-263.040) (-260.649) (-261.601) -- 0:00:14
781000 -- (-262.248) [-261.927] (-267.229) (-261.869) * [-261.929] (-262.007) (-260.019) (-262.701) -- 0:00:14
781500 -- [-259.007] (-269.987) (-261.490) (-263.636) * (-260.236) [-260.295] (-265.344) (-261.428) -- 0:00:14
782000 -- [-259.441] (-265.945) (-261.360) (-262.711) * (-260.971) (-263.558) (-260.414) [-259.482] -- 0:00:14
782500 -- (-259.556) (-274.854) [-261.317] (-259.984) * [-260.299] (-262.150) (-263.608) (-260.617) -- 0:00:14
783000 -- (-260.037) (-264.256) (-260.425) [-259.981] * (-262.483) (-262.833) (-262.279) [-259.613] -- 0:00:14
783500 -- [-261.046] (-264.933) (-261.272) (-262.608) * (-263.102) [-260.815] (-262.563) (-261.967) -- 0:00:14
784000 -- [-260.685] (-268.115) (-261.427) (-263.067) * [-260.170] (-260.068) (-262.393) (-259.894) -- 0:00:14
784500 -- (-263.998) [-261.995] (-260.779) (-259.664) * (-259.211) (-264.571) (-262.876) [-260.538] -- 0:00:14
785000 -- [-261.634] (-266.492) (-259.697) (-261.496) * (-261.967) (-262.289) (-261.779) [-259.871] -- 0:00:14
Average standard deviation of split frequencies: 0.010478
785500 -- (-262.386) (-262.521) (-260.793) [-259.431] * (-260.864) (-261.451) [-260.790] (-260.129) -- 0:00:14
786000 -- [-261.293] (-261.664) (-265.592) (-259.800) * (-262.057) [-259.859] (-262.423) (-262.656) -- 0:00:14
786500 -- [-260.754] (-260.277) (-262.781) (-262.906) * (-262.673) (-259.210) (-261.240) [-264.402] -- 0:00:14
787000 -- (-262.549) (-261.085) [-259.158] (-260.350) * (-259.687) [-261.808] (-260.980) (-260.671) -- 0:00:14
787500 -- (-264.231) (-262.264) (-262.923) [-259.046] * [-260.410] (-261.464) (-260.189) (-260.561) -- 0:00:14
788000 -- [-259.935] (-260.917) (-262.597) (-260.285) * (-261.101) (-262.610) [-260.104] (-262.066) -- 0:00:13
788500 -- [-261.128] (-264.482) (-262.693) (-261.134) * (-260.127) (-265.564) [-259.249] (-261.353) -- 0:00:14
789000 -- (-261.636) [-260.239] (-264.956) (-261.380) * (-263.711) (-259.521) [-260.424] (-264.498) -- 0:00:14
789500 -- (-259.237) (-263.534) [-262.321] (-262.556) * (-259.608) (-263.041) (-260.582) [-259.037] -- 0:00:14
790000 -- [-259.186] (-259.880) (-261.903) (-262.689) * (-259.732) [-259.204] (-259.635) (-263.699) -- 0:00:14
Average standard deviation of split frequencies: 0.010247
790500 -- [-259.435] (-260.784) (-260.392) (-262.312) * (-264.165) (-264.810) [-258.946] (-264.624) -- 0:00:14
791000 -- (-261.007) (-260.043) (-260.885) [-264.900] * (-263.200) (-259.509) [-261.193] (-263.985) -- 0:00:14
791500 -- (-262.572) [-261.033] (-262.362) (-259.289) * (-261.459) [-258.922] (-260.741) (-263.681) -- 0:00:13
792000 -- (-262.420) (-261.783) [-261.324] (-259.992) * (-262.238) [-264.137] (-260.780) (-262.940) -- 0:00:13
792500 -- [-262.080] (-261.594) (-261.958) (-262.554) * (-262.715) [-259.642] (-260.977) (-265.515) -- 0:00:13
793000 -- [-262.024] (-259.572) (-264.901) (-260.751) * (-267.706) [-263.093] (-263.060) (-263.758) -- 0:00:13
793500 -- (-261.728) (-260.142) (-266.453) [-260.075] * (-261.611) (-263.597) (-271.768) [-261.040] -- 0:00:13
794000 -- (-260.765) (-260.065) (-263.293) [-259.531] * [-262.262] (-262.818) (-261.802) (-259.674) -- 0:00:13
794500 -- [-260.077] (-261.184) (-260.937) (-266.239) * (-260.199) [-259.154] (-261.387) (-259.924) -- 0:00:13
795000 -- (-264.275) [-260.931] (-260.083) (-262.834) * (-259.652) (-259.641) [-262.948] (-260.016) -- 0:00:13
Average standard deviation of split frequencies: 0.009957
795500 -- (-260.864) (-264.474) [-260.269] (-266.383) * (-261.867) [-261.339] (-264.164) (-260.770) -- 0:00:13
796000 -- [-259.649] (-261.744) (-259.310) (-267.363) * [-263.184] (-265.810) (-261.817) (-259.979) -- 0:00:13
796500 -- (-261.104) [-261.015] (-260.622) (-262.700) * [-260.859] (-263.480) (-261.997) (-259.721) -- 0:00:13
797000 -- [-264.672] (-259.971) (-260.536) (-260.350) * [-261.712] (-261.518) (-262.849) (-259.632) -- 0:00:13
797500 -- (-261.155) (-261.158) [-260.531] (-262.909) * (-262.674) [-260.261] (-261.378) (-262.546) -- 0:00:13
798000 -- (-263.250) (-265.666) (-259.972) [-260.543] * (-263.040) [-260.861] (-263.794) (-259.644) -- 0:00:13
798500 -- (-264.362) [-259.682] (-259.728) (-261.020) * (-260.739) [-260.576] (-264.684) (-260.811) -- 0:00:13
799000 -- (-261.737) [-260.496] (-262.102) (-260.763) * (-266.338) (-260.849) [-261.956] (-260.349) -- 0:00:13
799500 -- (-260.881) (-260.601) (-262.723) [-261.232] * (-267.908) (-261.919) (-260.909) [-259.466] -- 0:00:13
800000 -- (-267.014) (-262.394) [-260.905] (-260.283) * (-262.175) [-262.580] (-262.047) (-259.828) -- 0:00:13
Average standard deviation of split frequencies: 0.009899
800500 -- (-261.077) (-260.202) [-260.808] (-263.347) * [-262.610] (-260.920) (-263.866) (-259.859) -- 0:00:13
801000 -- (-261.384) [-259.799] (-264.002) (-259.052) * (-260.615) (-260.660) [-260.891] (-261.126) -- 0:00:13
801500 -- (-261.224) [-260.246] (-260.804) (-261.211) * (-261.708) [-261.560] (-264.721) (-261.246) -- 0:00:13
802000 -- (-265.247) (-261.254) (-262.462) [-260.423] * (-266.156) (-259.379) (-263.423) [-260.179] -- 0:00:13
802500 -- (-261.197) [-262.873] (-260.050) (-260.425) * (-268.151) [-262.813] (-260.404) (-262.036) -- 0:00:13
803000 -- (-264.858) (-264.557) (-260.159) [-261.141] * (-264.524) (-265.108) [-260.526] (-261.596) -- 0:00:13
803500 -- (-263.025) (-260.109) [-259.502] (-259.426) * (-260.853) (-261.662) (-261.360) [-261.943] -- 0:00:12
804000 -- (-261.537) [-261.742] (-259.970) (-261.793) * (-262.322) (-260.669) [-262.244] (-262.632) -- 0:00:13
804500 -- [-261.508] (-262.795) (-262.351) (-265.472) * [-262.789] (-259.537) (-260.210) (-261.533) -- 0:00:13
805000 -- [-260.611] (-261.695) (-260.872) (-261.326) * (-260.315) [-259.370] (-260.440) (-262.552) -- 0:00:13
Average standard deviation of split frequencies: 0.009870
805500 -- (-261.276) (-261.372) [-265.084] (-260.313) * (-259.930) [-261.241] (-262.215) (-260.891) -- 0:00:13
806000 -- (-270.001) (-264.060) (-260.101) [-263.812] * (-259.922) [-259.401] (-262.058) (-262.719) -- 0:00:12
806500 -- (-262.466) [-260.050] (-262.091) (-261.647) * [-259.520] (-260.476) (-261.062) (-263.285) -- 0:00:12
807000 -- (-262.648) (-259.101) (-260.939) [-263.130] * (-261.487) (-260.987) [-260.172] (-263.541) -- 0:00:12
807500 -- [-266.355] (-259.279) (-267.518) (-259.824) * (-260.724) (-264.017) (-263.839) [-261.874] -- 0:00:12
808000 -- (-262.924) [-259.069] (-264.428) (-261.523) * (-260.843) (-264.354) (-261.969) [-261.221] -- 0:00:12
808500 -- (-261.287) (-259.816) [-261.983] (-261.266) * [-260.124] (-261.490) (-259.830) (-263.197) -- 0:00:12
809000 -- (-261.665) (-260.696) [-262.981] (-263.570) * (-260.347) (-262.420) [-260.179] (-263.806) -- 0:00:12
809500 -- (-259.111) [-259.495] (-266.817) (-262.731) * (-259.232) (-262.175) [-260.574] (-259.189) -- 0:00:12
810000 -- [-259.216] (-260.435) (-264.964) (-266.533) * [-263.071] (-263.264) (-259.563) (-260.822) -- 0:00:12
Average standard deviation of split frequencies: 0.009631
810500 -- [-261.587] (-265.210) (-259.346) (-269.555) * (-261.918) (-259.134) [-260.971] (-260.532) -- 0:00:12
811000 -- (-263.815) (-263.378) [-261.759] (-260.309) * [-259.114] (-259.566) (-261.874) (-259.852) -- 0:00:12
811500 -- (-262.082) (-263.624) (-261.583) [-260.424] * [-260.260] (-260.970) (-259.955) (-261.159) -- 0:00:12
812000 -- [-261.804] (-260.209) (-261.058) (-261.265) * [-260.457] (-261.042) (-262.465) (-260.183) -- 0:00:12
812500 -- (-260.850) (-264.582) (-260.793) [-262.372] * (-268.932) [-261.587] (-261.863) (-259.631) -- 0:00:12
813000 -- (-262.863) [-260.929] (-260.502) (-266.834) * (-267.979) (-263.645) (-261.010) [-259.179] -- 0:00:12
813500 -- [-261.924] (-259.925) (-259.022) (-264.168) * (-260.109) (-262.191) (-259.568) [-259.353] -- 0:00:12
814000 -- (-262.678) (-260.067) (-259.184) [-260.613] * (-261.400) [-263.096] (-259.652) (-261.529) -- 0:00:12
814500 -- (-262.233) (-262.083) (-260.510) [-263.469] * (-261.360) (-261.380) [-259.561] (-261.749) -- 0:00:12
815000 -- (-259.286) [-259.840] (-262.208) (-260.322) * (-263.894) (-259.317) (-263.489) [-266.209] -- 0:00:12
Average standard deviation of split frequencies: 0.009677
815500 -- (-262.378) (-260.858) (-260.784) [-260.987] * (-261.077) (-260.677) (-262.722) [-259.924] -- 0:00:12
816000 -- (-261.250) (-260.055) [-262.796] (-261.740) * (-259.711) (-265.125) (-259.899) [-264.275] -- 0:00:12
816500 -- (-260.144) (-259.691) (-262.709) [-264.542] * (-263.859) (-259.455) (-263.239) [-262.203] -- 0:00:12
817000 -- [-264.090] (-261.884) (-260.980) (-261.523) * (-263.619) (-261.450) (-266.443) [-263.263] -- 0:00:12
817500 -- (-268.556) (-264.589) [-259.014] (-265.242) * (-262.348) (-266.199) [-261.675] (-262.208) -- 0:00:12
818000 -- [-261.925] (-259.665) (-261.420) (-260.743) * [-261.627] (-260.286) (-263.738) (-260.273) -- 0:00:12
818500 -- (-260.053) (-262.009) (-260.525) [-259.994] * (-261.903) (-260.310) [-259.398] (-262.001) -- 0:00:11
819000 -- [-260.562] (-259.839) (-261.274) (-259.919) * (-264.876) (-259.803) (-261.543) [-261.803] -- 0:00:12
819500 -- [-265.318] (-259.802) (-263.450) (-260.980) * [-259.930] (-264.429) (-261.347) (-262.927) -- 0:00:12
820000 -- (-262.463) [-259.380] (-262.236) (-260.914) * [-259.941] (-260.774) (-259.229) (-260.616) -- 0:00:12
Average standard deviation of split frequencies: 0.009693
820500 -- (-264.540) (-265.934) (-262.575) [-263.757] * (-259.842) [-261.987] (-261.177) (-259.657) -- 0:00:12
821000 -- [-261.722] (-262.255) (-259.596) (-261.148) * [-259.461] (-262.368) (-260.265) (-262.116) -- 0:00:11
821500 -- (-262.235) [-263.265] (-261.094) (-262.078) * (-261.785) (-261.601) [-260.448] (-264.716) -- 0:00:11
822000 -- (-260.641) (-268.318) [-263.219] (-259.174) * [-259.846] (-259.786) (-261.007) (-259.798) -- 0:00:11
822500 -- (-261.825) (-265.279) (-260.826) [-261.842] * (-261.773) (-259.740) [-259.869] (-260.432) -- 0:00:11
823000 -- (-261.105) (-262.277) (-262.681) [-263.018] * (-259.327) (-262.376) (-259.852) [-261.781] -- 0:00:11
823500 -- (-259.793) [-259.478] (-260.734) (-261.857) * (-260.430) [-259.734] (-260.363) (-260.541) -- 0:00:11
824000 -- (-261.140) (-261.902) [-259.837] (-264.831) * [-260.810] (-263.490) (-260.174) (-264.727) -- 0:00:11
824500 -- (-262.430) (-260.934) (-259.529) [-261.875] * (-265.829) [-261.709] (-265.076) (-262.934) -- 0:00:11
825000 -- [-259.007] (-260.221) (-260.764) (-259.975) * (-260.182) (-263.601) [-261.347] (-264.138) -- 0:00:11
Average standard deviation of split frequencies: 0.009836
825500 -- (-264.190) (-260.584) [-260.131] (-259.421) * [-260.568] (-260.509) (-261.593) (-262.380) -- 0:00:11
826000 -- (-263.750) [-260.017] (-259.269) (-259.418) * (-260.167) (-260.253) [-261.344] (-262.631) -- 0:00:11
826500 -- (-259.323) (-261.322) [-259.110] (-260.540) * [-260.291] (-261.756) (-261.166) (-263.627) -- 0:00:11
827000 -- (-265.336) [-259.201] (-262.405) (-259.998) * (-263.678) (-260.640) [-260.113] (-261.205) -- 0:00:11
827500 -- (-264.960) (-260.692) (-259.978) [-260.991] * [-260.618] (-260.672) (-263.125) (-261.374) -- 0:00:11
828000 -- (-260.366) (-260.354) (-261.271) [-259.117] * [-262.093] (-260.153) (-261.432) (-264.722) -- 0:00:11
828500 -- [-259.519] (-264.157) (-262.001) (-259.473) * [-260.104] (-261.044) (-261.854) (-259.638) -- 0:00:11
829000 -- (-262.131) (-261.954) [-261.040] (-259.855) * [-259.789] (-259.646) (-262.912) (-259.510) -- 0:00:11
829500 -- [-263.405] (-260.705) (-261.228) (-263.443) * (-262.053) (-260.275) (-260.806) [-260.890] -- 0:00:11
830000 -- (-267.003) [-259.419] (-259.920) (-261.841) * [-260.762] (-260.914) (-261.150) (-264.311) -- 0:00:11
Average standard deviation of split frequencies: 0.009948
830500 -- [-260.509] (-261.168) (-262.549) (-260.948) * [-259.461] (-260.398) (-266.157) (-262.235) -- 0:00:11
831000 -- [-261.095] (-263.066) (-263.284) (-262.139) * (-260.652) (-261.790) (-259.269) [-260.906] -- 0:00:11
831500 -- (-262.189) (-262.290) [-261.081] (-265.058) * (-264.211) [-259.860] (-260.174) (-259.755) -- 0:00:11
832000 -- (-264.580) (-261.085) (-261.180) [-263.150] * (-268.133) (-261.359) [-260.763] (-260.167) -- 0:00:11
832500 -- (-261.968) (-260.530) (-259.759) [-261.353] * (-259.582) (-264.115) [-260.650] (-262.777) -- 0:00:11
833000 -- (-260.592) (-259.990) [-261.203] (-263.757) * [-260.921] (-261.173) (-260.309) (-263.869) -- 0:00:11
833500 -- (-259.538) (-260.058) (-266.316) [-260.352] * (-259.535) (-260.448) [-259.865] (-261.877) -- 0:00:11
834000 -- (-262.288) (-260.026) [-261.146] (-261.287) * [-259.954] (-260.086) (-260.068) (-260.324) -- 0:00:11
834500 -- (-263.378) (-260.979) [-260.088] (-259.875) * [-260.892] (-261.375) (-260.861) (-262.163) -- 0:00:11
835000 -- (-260.942) [-262.724] (-260.878) (-259.415) * [-262.665] (-260.131) (-265.861) (-263.242) -- 0:00:11
Average standard deviation of split frequencies: 0.009586
835500 -- [-264.018] (-262.732) (-260.564) (-267.245) * (-259.893) (-260.859) (-263.537) [-260.206] -- 0:00:11
836000 -- (-264.214) [-262.920] (-264.793) (-263.364) * [-261.429] (-260.300) (-264.051) (-260.858) -- 0:00:10
836500 -- (-260.848) [-259.565] (-259.827) (-261.590) * (-259.530) (-265.477) (-260.118) [-261.404] -- 0:00:10
837000 -- (-260.340) (-259.512) (-260.867) [-264.883] * (-259.915) [-262.808] (-260.331) (-260.358) -- 0:00:10
837500 -- (-262.139) [-261.363] (-259.292) (-264.281) * [-263.746] (-267.921) (-260.006) (-263.049) -- 0:00:10
838000 -- (-261.937) (-264.163) (-259.397) [-262.569] * (-260.707) [-260.239] (-260.409) (-263.349) -- 0:00:10
838500 -- (-260.329) [-261.749] (-260.038) (-261.742) * (-263.473) [-259.754] (-260.946) (-262.573) -- 0:00:10
839000 -- (-262.870) [-262.150] (-260.335) (-262.150) * [-260.677] (-260.955) (-260.115) (-259.886) -- 0:00:10
839500 -- [-264.572] (-261.050) (-259.729) (-259.728) * (-261.810) (-260.562) [-260.492] (-259.457) -- 0:00:10
840000 -- (-264.030) (-259.639) (-260.053) [-259.558] * (-260.783) (-262.477) (-261.696) [-259.823] -- 0:00:10
Average standard deviation of split frequencies: 0.009463
840500 -- (-260.806) (-261.127) (-263.135) [-259.909] * (-262.499) [-260.517] (-259.391) (-259.916) -- 0:00:10
841000 -- (-265.057) (-259.907) [-260.401] (-262.613) * (-260.100) (-260.528) (-263.313) [-268.528] -- 0:00:10
841500 -- (-261.096) (-261.715) (-262.441) [-260.931] * (-259.994) (-260.988) (-262.737) [-259.745] -- 0:00:10
842000 -- [-260.820] (-261.996) (-263.057) (-260.591) * (-260.956) (-260.501) [-265.953] (-259.644) -- 0:00:10
842500 -- (-263.050) (-259.845) (-263.995) [-260.750] * (-266.807) (-259.631) (-266.062) [-259.732] -- 0:00:10
843000 -- (-262.646) (-262.497) [-261.471] (-259.625) * (-263.748) [-263.360] (-261.078) (-262.036) -- 0:00:10
843500 -- (-262.030) [-260.756] (-263.811) (-260.913) * (-269.273) (-262.521) (-260.471) [-263.894] -- 0:00:10
844000 -- (-261.116) (-260.943) (-265.341) [-260.746] * [-266.788] (-261.514) (-260.334) (-262.142) -- 0:00:10
844500 -- (-261.837) (-259.908) (-262.514) [-261.103] * (-264.240) [-262.715] (-265.088) (-261.132) -- 0:00:10
845000 -- (-261.238) [-259.384] (-260.504) (-260.343) * (-259.677) (-261.948) [-260.331] (-260.602) -- 0:00:10
Average standard deviation of split frequencies: 0.009856
845500 -- (-259.957) (-260.225) [-259.582] (-259.958) * [-260.879] (-260.783) (-261.515) (-259.819) -- 0:00:10
846000 -- (-264.773) (-260.525) [-258.956] (-259.281) * (-261.006) (-262.965) [-261.376] (-258.880) -- 0:00:10
846500 -- (-267.434) (-264.542) [-260.231] (-260.543) * [-259.590] (-263.988) (-259.381) (-261.123) -- 0:00:10
847000 -- [-261.824] (-261.915) (-263.110) (-261.906) * (-264.186) (-260.844) [-260.010] (-262.595) -- 0:00:10
847500 -- (-264.243) [-260.493] (-263.729) (-260.705) * (-261.690) (-261.093) (-261.354) [-259.843] -- 0:00:10
848000 -- [-260.851] (-261.830) (-262.243) (-260.431) * [-264.686] (-261.822) (-262.253) (-259.440) -- 0:00:10
848500 -- (-260.451) [-261.072] (-260.365) (-261.932) * (-264.944) [-265.797] (-260.549) (-259.823) -- 0:00:10
849000 -- (-260.013) (-265.771) [-264.761] (-260.557) * (-264.636) [-266.933] (-263.152) (-264.579) -- 0:00:10
849500 -- [-261.641] (-265.864) (-262.455) (-260.190) * (-261.453) (-266.511) [-260.896] (-262.816) -- 0:00:10
850000 -- (-260.407) [-262.038] (-260.992) (-260.299) * [-260.560] (-264.120) (-262.917) (-261.478) -- 0:00:10
Average standard deviation of split frequencies: 0.009940
850500 -- (-260.093) (-262.991) (-263.543) [-261.680] * (-266.201) (-263.142) (-262.542) [-260.088] -- 0:00:10
851000 -- (-260.898) (-260.782) [-264.205] (-261.606) * (-263.128) (-265.495) (-261.029) [-261.587] -- 0:00:09
851500 -- [-261.066] (-260.139) (-263.792) (-259.013) * (-262.535) (-262.995) (-259.929) [-263.019] -- 0:00:09
852000 -- [-262.964] (-265.437) (-262.424) (-261.064) * (-259.170) [-265.301] (-260.859) (-260.550) -- 0:00:09
852500 -- (-259.598) (-262.318) (-262.505) [-259.728] * (-260.599) (-260.297) (-260.575) [-260.164] -- 0:00:09
853000 -- [-260.323] (-260.641) (-260.736) (-261.507) * [-262.336] (-267.720) (-260.654) (-261.340) -- 0:00:09
853500 -- (-261.070) (-262.813) [-259.943] (-261.513) * (-264.121) (-263.736) (-260.777) [-262.795] -- 0:00:09
854000 -- (-260.420) [-259.745] (-261.738) (-261.943) * (-259.595) (-259.588) [-262.276] (-259.366) -- 0:00:09
854500 -- (-264.283) (-259.744) (-265.346) [-260.335] * [-260.648] (-263.532) (-260.850) (-260.836) -- 0:00:09
855000 -- (-264.489) (-260.120) [-263.156] (-259.721) * (-262.401) (-262.292) (-262.611) [-259.567] -- 0:00:09
Average standard deviation of split frequencies: 0.009569
855500 -- (-262.224) (-261.087) [-260.226] (-265.173) * [-259.961] (-262.703) (-259.906) (-259.834) -- 0:00:09
856000 -- (-261.813) (-260.576) [-261.668] (-265.066) * (-259.808) (-266.569) (-262.230) [-262.105] -- 0:00:09
856500 -- [-261.347] (-260.506) (-265.267) (-264.743) * (-264.151) [-265.484] (-260.644) (-260.304) -- 0:00:09
857000 -- (-261.379) [-265.670] (-260.926) (-261.222) * (-261.344) [-264.058] (-259.625) (-259.966) -- 0:00:09
857500 -- (-259.799) (-262.398) [-260.154] (-261.784) * (-262.588) [-263.514] (-261.928) (-264.265) -- 0:00:09
858000 -- [-259.504] (-264.623) (-263.385) (-262.767) * (-259.989) (-267.348) [-262.304] (-263.510) -- 0:00:09
858500 -- (-261.321) [-259.748] (-260.130) (-261.397) * [-260.721] (-263.134) (-261.900) (-264.922) -- 0:00:09
859000 -- (-263.094) (-260.943) [-260.193] (-263.982) * (-261.996) [-261.786] (-261.971) (-259.972) -- 0:00:09
859500 -- [-263.286] (-260.977) (-263.919) (-266.510) * [-261.116] (-262.329) (-260.971) (-263.279) -- 0:00:09
860000 -- (-260.844) (-261.200) (-261.562) [-262.050] * (-261.301) [-259.945] (-261.761) (-261.420) -- 0:00:09
Average standard deviation of split frequencies: 0.009688
860500 -- (-260.851) (-259.819) (-267.847) [-262.845] * [-263.656] (-260.574) (-261.649) (-262.286) -- 0:00:09
861000 -- [-260.510] (-259.711) (-260.726) (-267.978) * (-261.682) (-264.122) [-260.090] (-262.136) -- 0:00:09
861500 -- (-264.620) (-260.476) [-260.265] (-260.175) * (-264.077) (-259.655) (-260.105) [-260.195] -- 0:00:09
862000 -- (-265.777) [-261.912] (-260.428) (-259.927) * (-259.781) (-259.740) [-260.301] (-263.389) -- 0:00:09
862500 -- (-260.401) (-262.372) [-259.005] (-259.904) * (-262.073) [-259.543] (-260.066) (-259.942) -- 0:00:09
863000 -- (-261.126) [-260.700] (-259.726) (-261.096) * (-261.509) (-265.342) [-260.445] (-260.208) -- 0:00:09
863500 -- (-261.588) (-260.148) [-260.945] (-262.838) * (-259.682) [-260.433] (-260.055) (-260.922) -- 0:00:09
864000 -- (-260.474) (-261.816) [-259.081] (-263.215) * (-259.652) (-259.933) [-261.191] (-261.467) -- 0:00:09
864500 -- (-261.944) (-260.750) [-259.343] (-259.503) * (-259.968) (-260.725) [-263.351] (-264.749) -- 0:00:09
865000 -- (-260.673) [-261.287] (-259.569) (-260.562) * [-260.683] (-261.730) (-270.773) (-261.176) -- 0:00:09
Average standard deviation of split frequencies: 0.009126
865500 -- (-259.979) (-260.976) [-264.628] (-263.829) * (-260.803) (-259.444) [-265.191] (-260.230) -- 0:00:09
866000 -- (-262.135) (-261.848) (-264.409) [-264.754] * [-259.624] (-261.787) (-262.533) (-263.485) -- 0:00:08
866500 -- (-263.696) (-260.308) (-262.116) [-259.784] * (-260.888) (-259.876) (-267.746) [-261.546] -- 0:00:08
867000 -- (-260.847) (-260.084) [-260.231] (-259.967) * (-262.016) [-260.238] (-260.481) (-260.396) -- 0:00:08
867500 -- (-263.459) (-262.735) (-260.286) [-260.067] * [-259.758] (-260.641) (-259.994) (-260.647) -- 0:00:08
868000 -- (-260.344) [-264.100] (-261.293) (-259.742) * (-260.302) (-261.280) [-261.907] (-260.047) -- 0:00:08
868500 -- [-261.591] (-259.616) (-263.086) (-263.200) * (-260.999) [-261.191] (-260.932) (-263.057) -- 0:00:08
869000 -- (-259.477) (-260.794) (-262.619) [-260.167] * (-261.855) (-262.085) (-262.322) [-259.941] -- 0:00:08
869500 -- (-260.779) (-262.705) [-259.550] (-260.284) * (-260.300) (-265.224) (-260.141) [-265.631] -- 0:00:08
870000 -- [-261.409] (-261.614) (-263.035) (-259.823) * (-262.418) (-263.210) [-259.694] (-260.805) -- 0:00:08
Average standard deviation of split frequencies: 0.009141
870500 -- [-262.623] (-260.479) (-259.554) (-258.997) * (-260.010) [-262.771] (-262.073) (-261.836) -- 0:00:08
871000 -- (-262.029) [-262.268] (-260.677) (-260.125) * (-260.152) (-259.705) (-262.606) [-259.483] -- 0:00:08
871500 -- (-260.645) [-259.834] (-260.122) (-260.215) * (-259.811) [-260.643] (-261.675) (-259.494) -- 0:00:08
872000 -- (-260.778) [-264.081] (-259.920) (-259.335) * [-260.316] (-264.523) (-260.191) (-261.373) -- 0:00:08
872500 -- (-263.450) (-260.501) (-260.622) [-261.464] * (-260.482) [-263.975] (-260.882) (-261.428) -- 0:00:08
873000 -- (-263.542) [-260.041] (-265.626) (-264.289) * (-264.685) (-263.030) (-263.072) [-267.522] -- 0:00:08
873500 -- (-259.456) (-261.368) (-262.098) [-261.891] * (-261.149) [-262.754] (-262.579) (-263.248) -- 0:00:08
874000 -- (-258.994) (-260.068) (-264.849) [-260.314] * [-261.326] (-261.052) (-260.236) (-260.040) -- 0:00:08
874500 -- (-261.460) (-259.830) (-267.756) [-259.377] * (-259.443) (-264.942) (-261.782) [-262.125] -- 0:00:08
875000 -- (-261.499) (-265.146) [-261.040] (-262.990) * (-261.305) (-262.629) (-263.370) [-263.339] -- 0:00:08
Average standard deviation of split frequencies: 0.008895
875500 -- (-259.470) (-261.010) [-261.484] (-261.805) * (-260.456) (-264.335) [-261.478] (-262.792) -- 0:00:08
876000 -- (-263.835) (-261.549) (-260.813) [-261.806] * (-262.116) (-261.335) [-260.766] (-261.404) -- 0:00:08
876500 -- (-259.970) [-259.534] (-263.695) (-263.619) * (-260.338) [-263.557] (-260.531) (-262.325) -- 0:00:08
877000 -- [-259.999] (-259.457) (-262.057) (-261.987) * (-259.605) [-262.335] (-260.923) (-261.032) -- 0:00:08
877500 -- (-263.993) (-263.248) [-260.438] (-263.788) * [-260.336] (-261.483) (-259.280) (-262.318) -- 0:00:08
878000 -- [-260.584] (-261.766) (-260.975) (-260.494) * [-261.214] (-261.941) (-262.432) (-261.204) -- 0:00:08
878500 -- (-261.584) (-259.488) (-260.678) [-259.535] * (-259.946) [-260.544] (-263.056) (-262.433) -- 0:00:08
879000 -- (-260.244) (-262.265) (-263.017) [-259.841] * (-260.569) (-260.784) [-260.816] (-260.355) -- 0:00:08
879500 -- [-261.863] (-263.932) (-262.710) (-261.283) * (-260.589) [-261.504] (-260.019) (-262.324) -- 0:00:08
880000 -- [-260.589] (-266.877) (-263.654) (-262.005) * (-262.036) (-259.414) [-263.904] (-261.117) -- 0:00:08
Average standard deviation of split frequencies: 0.008533
880500 -- (-261.387) (-262.170) (-263.489) [-259.518] * (-263.732) [-260.211] (-265.975) (-260.337) -- 0:00:08
881000 -- (-263.204) [-260.270] (-260.915) (-260.528) * (-260.241) (-261.689) [-262.268] (-259.816) -- 0:00:07
881500 -- (-264.067) [-261.348] (-261.281) (-261.855) * [-259.888] (-259.945) (-262.716) (-266.962) -- 0:00:07
882000 -- [-259.285] (-265.219) (-262.039) (-260.396) * (-259.005) (-260.772) (-260.616) [-259.736] -- 0:00:07
882500 -- (-263.860) (-264.931) (-262.834) [-261.342] * (-263.275) (-259.749) (-261.434) [-261.415] -- 0:00:07
883000 -- [-259.687] (-266.377) (-260.891) (-264.475) * (-263.024) (-260.592) (-259.941) [-260.498] -- 0:00:07
883500 -- (-260.549) (-262.076) (-263.164) [-262.451] * (-260.255) (-261.628) (-261.226) [-264.900] -- 0:00:07
884000 -- (-260.569) (-262.088) [-260.641] (-262.104) * [-263.380] (-260.095) (-261.828) (-268.629) -- 0:00:07
884500 -- (-260.553) (-260.875) (-261.536) [-265.526] * [-265.548] (-260.372) (-260.966) (-262.549) -- 0:00:07
885000 -- (-260.705) [-262.111] (-261.926) (-261.217) * (-262.882) (-261.158) (-260.576) [-260.299] -- 0:00:07
Average standard deviation of split frequencies: 0.008294
885500 -- [-262.558] (-260.435) (-260.258) (-260.316) * [-262.966] (-265.038) (-261.794) (-259.509) -- 0:00:07
886000 -- (-265.344) (-260.698) (-261.891) [-260.322] * (-262.947) (-261.725) [-262.768] (-259.902) -- 0:00:07
886500 -- (-260.910) (-261.287) [-259.611] (-262.058) * (-263.632) [-259.947] (-262.951) (-258.997) -- 0:00:07
887000 -- [-262.440] (-261.674) (-259.520) (-260.029) * (-259.554) (-259.789) [-260.713] (-260.354) -- 0:00:07
887500 -- (-261.304) [-262.529] (-260.603) (-260.309) * (-260.089) (-260.824) [-261.653] (-260.999) -- 0:00:07
888000 -- (-265.525) (-260.843) [-260.599] (-261.165) * (-264.436) (-264.002) (-259.785) [-260.396] -- 0:00:07
888500 -- (-261.889) (-261.520) (-261.387) [-261.971] * (-261.194) (-265.894) (-260.080) [-261.082] -- 0:00:07
889000 -- [-260.707] (-263.582) (-261.475) (-261.845) * (-263.588) [-268.952] (-264.425) (-261.723) -- 0:00:07
889500 -- (-262.012) (-262.723) [-263.842] (-260.143) * (-261.568) (-259.356) [-262.664] (-261.175) -- 0:00:07
890000 -- [-263.314] (-261.998) (-260.670) (-267.360) * (-260.367) (-265.448) [-260.751] (-264.768) -- 0:00:07
Average standard deviation of split frequencies: 0.008634
890500 -- (-259.848) (-260.008) [-259.635] (-259.807) * (-262.937) (-260.069) [-260.275] (-261.665) -- 0:00:07
891000 -- (-260.301) (-264.139) [-259.712] (-261.895) * (-263.198) (-260.232) (-259.723) [-262.298] -- 0:00:07
891500 -- (-263.636) [-262.638] (-259.739) (-259.951) * (-261.237) (-260.211) (-260.670) [-265.106] -- 0:00:07
892000 -- [-263.502] (-263.187) (-259.848) (-265.356) * [-260.585] (-260.793) (-260.208) (-263.426) -- 0:00:07
892500 -- (-260.288) [-261.472] (-261.813) (-260.347) * [-259.223] (-260.855) (-259.699) (-261.100) -- 0:00:07
893000 -- (-265.106) (-262.359) [-261.599] (-260.582) * [-259.762] (-261.392) (-259.807) (-260.101) -- 0:00:07
893500 -- (-262.353) [-260.576] (-259.996) (-260.377) * (-260.828) [-260.582] (-262.137) (-261.583) -- 0:00:07
894000 -- [-261.226] (-262.762) (-260.697) (-264.418) * (-261.157) (-259.041) [-261.996] (-261.984) -- 0:00:07
894500 -- [-260.376] (-261.992) (-265.053) (-259.542) * (-263.613) (-263.368) (-264.211) [-262.103] -- 0:00:07
895000 -- (-259.712) (-261.823) [-265.000] (-261.226) * (-261.237) (-262.395) (-261.585) [-260.171] -- 0:00:07
Average standard deviation of split frequencies: 0.008517
895500 -- [-259.324] (-260.418) (-261.658) (-260.832) * (-259.502) [-259.716] (-260.855) (-262.626) -- 0:00:07
896000 -- [-259.339] (-260.286) (-264.309) (-260.582) * (-260.494) (-260.997) (-260.976) [-259.375] -- 0:00:06
896500 -- (-259.728) (-259.276) [-261.382] (-260.329) * (-266.509) (-262.441) [-260.776] (-260.249) -- 0:00:06
897000 -- (-261.155) [-261.042] (-260.968) (-262.368) * (-259.282) [-260.638] (-262.970) (-260.256) -- 0:00:06
897500 -- (-261.449) (-261.044) (-262.614) [-261.230] * (-262.359) (-261.601) [-259.977] (-259.252) -- 0:00:06
898000 -- (-267.105) (-259.158) [-262.907] (-259.359) * (-266.803) [-261.017] (-261.197) (-260.913) -- 0:00:06
898500 -- (-260.887) (-259.282) (-262.576) [-260.199] * (-260.081) (-265.312) [-260.127] (-262.626) -- 0:00:06
899000 -- (-264.173) (-261.072) [-261.750] (-266.279) * (-260.659) (-264.322) (-259.532) [-261.344] -- 0:00:06
899500 -- (-262.924) (-260.039) [-264.188] (-261.484) * (-261.630) (-260.963) [-260.779] (-259.783) -- 0:00:06
900000 -- (-262.797) (-259.949) (-260.393) [-262.315] * [-260.788] (-259.966) (-259.780) (-259.892) -- 0:00:06
Average standard deviation of split frequencies: 0.008538
900500 -- (-260.912) [-263.808] (-261.392) (-262.926) * (-260.082) (-263.870) (-260.813) [-261.624] -- 0:00:06
901000 -- [-263.855] (-262.026) (-260.610) (-261.374) * (-259.857) (-261.425) (-262.197) [-260.522] -- 0:00:06
901500 -- (-263.761) (-263.156) [-259.922] (-261.457) * (-261.122) (-260.690) [-260.837] (-260.498) -- 0:00:06
902000 -- [-262.129] (-260.516) (-260.377) (-261.701) * (-263.272) (-261.251) [-262.035] (-264.095) -- 0:00:06
902500 -- [-261.007] (-262.940) (-263.749) (-260.957) * [-260.106] (-263.771) (-263.793) (-260.331) -- 0:00:06
903000 -- (-260.452) [-263.456] (-260.391) (-264.331) * (-260.586) (-259.538) [-263.151] (-263.132) -- 0:00:06
903500 -- (-262.344) [-260.767] (-260.457) (-261.868) * (-263.392) (-261.831) [-260.542] (-261.891) -- 0:00:06
904000 -- (-261.232) (-260.257) [-262.401] (-262.055) * (-262.001) (-262.239) [-261.650] (-266.855) -- 0:00:06
904500 -- (-261.529) (-259.198) (-261.134) [-261.857] * (-260.546) [-262.707] (-262.247) (-261.887) -- 0:00:06
905000 -- (-260.522) [-260.807] (-266.630) (-264.698) * (-260.701) (-262.919) [-262.671] (-261.540) -- 0:00:06
Average standard deviation of split frequencies: 0.008618
905500 -- (-262.071) (-260.146) [-263.144] (-261.241) * (-262.238) (-263.582) (-264.579) [-262.409] -- 0:00:06
906000 -- [-268.313] (-262.346) (-263.004) (-260.963) * (-262.859) [-264.011] (-262.724) (-261.473) -- 0:00:06
906500 -- (-262.621) (-263.815) (-263.686) [-265.142] * (-263.514) (-260.850) (-261.576) [-261.986] -- 0:00:06
907000 -- (-266.739) (-261.893) [-260.009] (-260.949) * [-260.845] (-259.705) (-259.391) (-259.830) -- 0:00:06
907500 -- (-260.048) (-262.314) [-262.367] (-259.347) * (-260.606) [-259.244] (-261.898) (-259.474) -- 0:00:06
908000 -- (-259.421) (-264.899) (-261.665) [-264.536] * [-261.226] (-259.353) (-261.244) (-261.767) -- 0:00:06
908500 -- (-260.328) [-259.652] (-260.610) (-260.071) * (-259.529) [-260.410] (-260.679) (-264.308) -- 0:00:06
909000 -- (-259.956) (-260.567) (-260.133) [-261.141] * (-261.538) [-262.686] (-266.711) (-268.592) -- 0:00:06
909500 -- (-265.757) (-260.500) [-260.229] (-260.493) * (-261.463) (-260.257) [-263.040] (-260.616) -- 0:00:06
910000 -- (-261.226) (-260.042) (-260.750) [-268.065] * (-262.278) [-261.353] (-260.550) (-264.532) -- 0:00:06
Average standard deviation of split frequencies: 0.008476
910500 -- (-263.508) (-264.359) [-264.186] (-264.099) * (-259.884) (-260.942) [-261.089] (-263.703) -- 0:00:05
911000 -- (-263.094) [-261.360] (-263.595) (-259.704) * [-259.646] (-260.553) (-263.022) (-261.918) -- 0:00:05
911500 -- [-268.516] (-260.610) (-262.147) (-259.273) * [-259.435] (-259.097) (-265.967) (-262.797) -- 0:00:05
912000 -- (-265.825) [-261.256] (-263.020) (-260.152) * (-260.950) (-261.679) (-259.456) [-261.698] -- 0:00:05
912500 -- [-260.963] (-262.056) (-263.624) (-260.792) * [-262.884] (-265.522) (-259.723) (-265.269) -- 0:00:05
913000 -- [-260.952] (-264.989) (-263.629) (-261.010) * (-260.464) (-262.999) (-263.646) [-261.715] -- 0:00:05
913500 -- (-261.807) (-262.077) (-261.199) [-261.229] * (-259.458) (-262.602) (-261.062) [-259.797] -- 0:00:05
914000 -- [-259.919] (-260.669) (-260.658) (-262.007) * (-261.842) (-260.744) (-260.010) [-261.615] -- 0:00:05
914500 -- (-264.585) (-261.103) (-262.203) [-260.635] * (-260.477) (-260.164) (-260.445) [-261.897] -- 0:00:05
915000 -- (-259.107) [-262.928] (-261.030) (-264.463) * [-262.046] (-263.724) (-259.813) (-260.764) -- 0:00:05
Average standard deviation of split frequencies: 0.008620
915500 -- [-260.502] (-260.318) (-264.472) (-259.814) * [-265.670] (-261.132) (-268.712) (-260.050) -- 0:00:05
916000 -- (-262.114) (-263.313) [-263.267] (-259.669) * (-260.705) (-263.239) (-261.860) [-260.686] -- 0:00:05
916500 -- (-265.084) (-262.350) [-259.821] (-259.243) * (-262.292) (-260.004) [-266.912] (-261.160) -- 0:00:05
917000 -- [-262.262] (-266.324) (-259.169) (-263.702) * (-262.936) (-262.347) [-262.617] (-260.130) -- 0:00:05
917500 -- (-261.354) [-261.384] (-259.286) (-259.862) * (-272.228) (-261.947) (-260.379) [-259.314] -- 0:00:05
918000 -- [-264.526] (-261.318) (-261.618) (-262.032) * (-261.022) (-263.483) (-259.545) [-259.872] -- 0:00:05
918500 -- [-260.006] (-259.233) (-261.158) (-260.736) * (-259.643) [-262.252] (-262.507) (-259.723) -- 0:00:05
919000 -- [-260.229] (-259.594) (-262.892) (-260.213) * [-259.723] (-259.853) (-263.215) (-260.391) -- 0:00:05
919500 -- (-260.966) [-259.374] (-267.173) (-260.065) * (-262.164) (-263.438) (-259.205) [-260.459] -- 0:00:05
920000 -- [-259.422] (-259.431) (-265.874) (-260.783) * (-262.850) [-261.897] (-261.972) (-260.059) -- 0:00:05
Average standard deviation of split frequencies: 0.008512
920500 -- (-259.499) (-260.132) (-263.671) [-262.071] * (-269.208) (-263.089) (-260.291) [-260.737] -- 0:00:05
921000 -- (-260.540) (-261.298) [-267.699] (-260.651) * (-261.971) (-260.077) (-259.393) [-260.894] -- 0:00:05
921500 -- [-260.691] (-262.266) (-259.475) (-262.828) * (-262.113) (-262.409) (-266.049) [-260.756] -- 0:00:05
922000 -- (-259.831) [-259.916] (-260.119) (-261.143) * [-261.042] (-263.263) (-261.707) (-261.748) -- 0:00:05
922500 -- [-260.093] (-262.173) (-264.078) (-262.046) * (-260.495) (-261.563) (-262.112) [-262.961] -- 0:00:05
923000 -- (-260.954) (-262.109) [-264.072] (-260.405) * (-261.069) [-260.117] (-262.131) (-259.765) -- 0:00:05
923500 -- [-259.928] (-261.838) (-260.693) (-262.524) * (-261.028) (-261.000) [-260.933] (-262.021) -- 0:00:05
924000 -- (-264.487) [-264.164] (-261.431) (-261.476) * (-264.074) (-262.944) (-261.124) [-260.073] -- 0:00:05
924500 -- (-262.546) (-261.722) [-260.992] (-260.567) * (-259.544) (-266.727) [-261.485] (-260.528) -- 0:00:05
925000 -- (-262.166) (-260.407) [-260.766] (-261.258) * (-263.324) (-264.525) (-261.174) [-262.117] -- 0:00:05
Average standard deviation of split frequencies: 0.008622
925500 -- [-259.866] (-266.772) (-259.820) (-265.257) * (-262.490) [-260.268] (-259.897) (-263.342) -- 0:00:04
926000 -- (-261.316) (-264.264) (-259.284) [-261.934] * [-260.450] (-264.004) (-263.397) (-260.913) -- 0:00:04
926500 -- (-260.155) [-259.418] (-265.466) (-259.881) * [-259.044] (-261.709) (-261.377) (-260.904) -- 0:00:04
927000 -- (-262.061) (-259.440) [-264.085] (-260.481) * (-260.219) (-261.497) [-261.461] (-259.808) -- 0:00:04
927500 -- [-262.778] (-260.967) (-261.554) (-261.272) * (-260.369) (-262.098) [-259.161] (-261.604) -- 0:00:04
928000 -- (-263.362) (-262.629) (-261.361) [-260.148] * (-264.321) (-259.112) [-262.235] (-261.180) -- 0:00:04
928500 -- [-260.223] (-261.903) (-267.517) (-261.272) * [-261.730] (-259.867) (-260.522) (-261.708) -- 0:00:04
929000 -- (-266.458) (-260.276) (-261.791) [-261.201] * [-259.507] (-260.618) (-260.642) (-261.348) -- 0:00:04
929500 -- (-265.394) (-259.166) [-259.280] (-262.816) * (-264.498) (-260.906) [-263.893] (-262.976) -- 0:00:04
930000 -- (-260.637) (-261.265) [-261.877] (-262.438) * [-260.108] (-259.249) (-261.692) (-263.419) -- 0:00:04
Average standard deviation of split frequencies: 0.008611
930500 -- [-259.835] (-263.581) (-259.947) (-260.804) * (-259.976) (-263.706) [-262.103] (-261.764) -- 0:00:04
931000 -- (-259.637) [-262.124] (-263.206) (-261.792) * (-261.466) (-265.583) (-260.179) [-262.559] -- 0:00:04
931500 -- (-260.121) (-260.534) (-261.854) [-261.895] * (-259.927) (-264.269) [-260.772] (-261.096) -- 0:00:04
932000 -- [-262.928] (-263.150) (-262.596) (-260.427) * (-260.484) (-260.446) (-259.988) [-260.857] -- 0:00:04
932500 -- [-260.663] (-261.503) (-264.944) (-261.569) * (-261.976) (-260.741) [-259.589] (-264.280) -- 0:00:04
933000 -- (-261.515) [-259.558] (-263.719) (-261.317) * (-260.580) (-259.997) (-259.430) [-262.143] -- 0:00:04
933500 -- [-261.109] (-259.835) (-264.914) (-261.197) * (-260.678) [-260.523] (-259.658) (-260.552) -- 0:00:04
934000 -- (-261.038) (-259.306) (-262.993) [-259.298] * (-265.008) [-260.525] (-261.174) (-264.468) -- 0:00:04
934500 -- (-259.131) (-265.091) (-259.277) [-260.560] * (-260.274) (-263.160) (-259.915) [-260.854] -- 0:00:04
935000 -- [-262.931] (-269.627) (-261.152) (-261.000) * (-260.739) (-262.066) [-259.601] (-260.492) -- 0:00:04
Average standard deviation of split frequencies: 0.008153
935500 -- (-261.701) [-260.035] (-264.316) (-262.341) * (-260.530) (-259.052) [-259.809] (-260.095) -- 0:00:04
936000 -- [-260.308] (-261.924) (-262.953) (-261.999) * [-260.284] (-264.438) (-260.079) (-262.653) -- 0:00:04
936500 -- [-261.364] (-259.983) (-261.718) (-260.386) * [-262.639] (-262.581) (-263.304) (-261.535) -- 0:00:04
937000 -- (-262.059) (-265.788) [-264.039] (-261.087) * [-261.261] (-260.761) (-262.510) (-262.158) -- 0:00:04
937500 -- (-261.381) (-265.583) (-261.555) [-261.274] * [-262.535] (-260.877) (-261.325) (-263.295) -- 0:00:04
938000 -- (-262.743) (-262.008) (-261.568) [-261.024] * (-263.072) [-260.525] (-262.001) (-261.420) -- 0:00:04
938500 -- (-260.240) (-260.771) [-260.359] (-261.903) * [-265.876] (-263.713) (-261.734) (-261.242) -- 0:00:04
939000 -- (-261.022) (-260.963) [-260.046] (-263.020) * (-266.290) (-263.272) (-259.672) [-259.592] -- 0:00:04
939500 -- (-261.017) (-259.631) (-260.163) [-261.416] * (-263.414) [-259.584] (-261.491) (-259.457) -- 0:00:04
940000 -- (-259.899) (-259.262) [-262.449] (-260.181) * (-261.842) (-262.614) (-262.825) [-259.549] -- 0:00:04
Average standard deviation of split frequencies: 0.008052
940500 -- (-260.645) [-260.518] (-260.328) (-261.460) * (-263.354) (-262.669) [-259.944] (-263.650) -- 0:00:03
941000 -- (-261.059) (-260.694) [-263.014] (-261.398) * (-262.569) [-267.687] (-260.998) (-261.439) -- 0:00:03
941500 -- (-265.751) (-261.487) (-262.850) [-260.239] * (-260.209) (-262.717) (-261.209) [-262.489] -- 0:00:03
942000 -- (-261.774) (-260.132) (-261.112) [-260.254] * (-260.102) [-263.578] (-261.715) (-259.598) -- 0:00:03
942500 -- (-262.410) (-261.001) (-261.189) [-259.368] * (-260.156) (-259.404) (-262.254) [-262.736] -- 0:00:03
943000 -- (-264.008) [-259.816] (-260.253) (-260.520) * (-262.776) (-259.536) [-262.759] (-263.786) -- 0:00:03
943500 -- (-268.685) [-260.318] (-260.897) (-261.943) * (-265.849) (-265.092) [-262.097] (-261.917) -- 0:00:03
944000 -- (-265.507) [-260.379] (-261.111) (-262.009) * (-262.241) (-262.606) (-259.797) [-262.668] -- 0:00:03
944500 -- (-259.900) (-265.704) [-260.247] (-262.785) * [-260.932] (-264.037) (-263.074) (-262.720) -- 0:00:03
945000 -- (-259.680) (-262.650) (-260.350) [-263.270] * (-260.274) (-261.235) (-262.895) [-262.094] -- 0:00:03
Average standard deviation of split frequencies: 0.008035
945500 -- (-261.480) [-260.607] (-259.900) (-259.126) * (-261.889) [-260.057] (-259.788) (-263.098) -- 0:00:03
946000 -- [-262.492] (-259.575) (-259.227) (-259.913) * [-262.685] (-261.839) (-264.558) (-267.569) -- 0:00:03
946500 -- (-263.157) (-264.477) [-261.797] (-260.071) * (-262.054) (-260.724) (-263.444) [-262.114] -- 0:00:03
947000 -- [-259.610] (-260.047) (-261.167) (-262.263) * [-260.228] (-260.304) (-260.808) (-262.915) -- 0:00:03
947500 -- [-259.960] (-261.273) (-258.981) (-262.770) * [-261.001] (-260.407) (-267.485) (-261.601) -- 0:00:03
948000 -- [-261.231] (-259.974) (-261.262) (-262.693) * (-262.846) (-259.810) (-261.643) [-259.804] -- 0:00:03
948500 -- (-261.475) [-259.657] (-264.832) (-261.149) * (-260.418) (-261.075) (-260.169) [-260.347] -- 0:00:03
949000 -- (-263.541) [-260.923] (-261.013) (-263.422) * (-259.600) [-260.197] (-262.278) (-260.688) -- 0:00:03
949500 -- (-261.072) (-261.750) (-264.176) [-261.191] * (-264.175) (-265.450) [-263.529] (-260.586) -- 0:00:03
950000 -- [-260.325] (-262.886) (-260.065) (-263.153) * (-260.205) [-265.277] (-262.594) (-266.531) -- 0:00:03
Average standard deviation of split frequencies: 0.007769
950500 -- (-261.007) (-260.318) (-262.923) [-260.728] * (-263.533) (-260.730) [-263.907] (-260.487) -- 0:00:03
951000 -- (-263.594) [-261.317] (-264.297) (-260.612) * (-261.582) [-259.432] (-261.422) (-260.770) -- 0:00:03
951500 -- (-261.841) [-260.702] (-261.700) (-261.826) * (-262.235) (-260.357) [-261.943] (-263.813) -- 0:00:03
952000 -- [-261.071] (-260.469) (-261.681) (-261.686) * (-259.430) [-260.045] (-265.442) (-265.883) -- 0:00:03
952500 -- (-262.796) [-259.548] (-262.636) (-261.124) * (-262.316) (-264.720) [-260.957] (-259.531) -- 0:00:03
953000 -- (-260.161) [-259.211] (-265.653) (-259.315) * (-259.855) (-262.104) (-260.237) [-259.807] -- 0:00:03
953500 -- (-259.672) (-260.044) (-262.324) [-260.869] * [-260.737] (-262.228) (-262.177) (-260.370) -- 0:00:03
954000 -- (-260.675) (-260.680) (-265.756) [-260.403] * (-260.818) (-261.014) (-259.923) [-260.678] -- 0:00:03
954500 -- (-262.739) [-262.899] (-260.356) (-260.901) * (-260.341) (-261.030) [-259.967] (-259.622) -- 0:00:03
955000 -- (-261.120) [-263.646] (-262.072) (-259.661) * (-262.648) (-259.935) (-260.806) [-260.479] -- 0:00:03
Average standard deviation of split frequencies: 0.007890
955500 -- [-260.491] (-260.188) (-260.059) (-260.271) * (-261.988) (-260.171) (-261.985) [-265.424] -- 0:00:02
956000 -- [-264.097] (-261.930) (-259.657) (-261.612) * (-261.590) (-260.056) (-263.601) [-263.211] -- 0:00:02
956500 -- [-260.796] (-267.915) (-261.605) (-261.447) * (-263.620) (-261.667) (-260.888) [-260.949] -- 0:00:02
957000 -- [-262.548] (-263.579) (-261.405) (-261.024) * (-263.737) (-263.383) (-260.555) [-260.475] -- 0:00:02
957500 -- (-263.444) (-262.785) [-262.691] (-261.805) * (-263.899) (-263.164) (-263.396) [-260.360] -- 0:00:02
958000 -- (-265.085) [-259.871] (-261.498) (-260.953) * (-266.737) (-259.937) (-264.857) [-260.977] -- 0:00:02
958500 -- [-261.118] (-260.206) (-265.911) (-262.984) * [-260.072] (-261.341) (-263.753) (-263.781) -- 0:00:02
959000 -- [-262.136] (-260.721) (-263.846) (-262.505) * (-262.339) [-266.274] (-261.875) (-262.235) -- 0:00:02
959500 -- (-260.054) (-259.666) [-260.375] (-263.580) * (-263.207) (-263.273) [-260.629] (-260.677) -- 0:00:02
960000 -- (-259.643) [-260.609] (-263.404) (-263.309) * [-260.009] (-263.643) (-261.280) (-259.802) -- 0:00:02
Average standard deviation of split frequencies: 0.007982
960500 -- (-260.007) [-260.768] (-260.476) (-261.252) * (-259.633) [-262.551] (-261.786) (-259.492) -- 0:00:02
961000 -- (-261.363) (-260.804) (-260.631) [-262.694] * (-259.931) [-263.615] (-261.901) (-260.169) -- 0:00:02
961500 -- (-261.727) (-259.459) (-261.875) [-262.260] * (-261.275) (-262.778) (-259.573) [-260.665] -- 0:00:02
962000 -- (-263.346) (-260.436) (-260.145) [-260.134] * (-261.796) (-261.990) (-261.016) [-261.170] -- 0:00:02
962500 -- [-260.023] (-260.921) (-261.246) (-260.951) * (-260.332) (-260.385) [-259.365] (-265.443) -- 0:00:02
963000 -- (-262.822) (-262.900) (-260.568) [-259.818] * [-259.120] (-267.024) (-259.632) (-259.756) -- 0:00:02
963500 -- (-259.858) (-260.099) [-262.244] (-260.593) * [-261.765] (-260.351) (-262.561) (-260.099) -- 0:00:02
964000 -- (-260.365) (-260.342) (-266.415) [-261.431] * (-261.262) (-260.796) [-263.057] (-259.491) -- 0:00:02
964500 -- (-261.214) (-260.352) [-259.695] (-262.188) * (-262.412) (-261.443) (-261.248) [-260.496] -- 0:00:02
965000 -- [-260.095] (-262.624) (-259.548) (-265.368) * (-261.809) [-260.553] (-262.882) (-260.907) -- 0:00:02
Average standard deviation of split frequencies: 0.007678
965500 -- (-259.630) (-262.312) [-262.589] (-260.885) * (-264.462) (-263.381) (-262.353) [-260.368] -- 0:00:02
966000 -- (-260.369) (-265.707) [-261.205] (-261.877) * (-263.507) (-264.261) (-263.318) [-261.150] -- 0:00:02
966500 -- (-260.232) (-261.189) [-260.119] (-261.288) * (-261.409) (-262.592) (-262.244) [-260.916] -- 0:00:02
967000 -- [-261.208] (-260.721) (-260.508) (-262.019) * [-259.944] (-263.237) (-263.697) (-259.709) -- 0:00:02
967500 -- (-260.993) [-262.429] (-262.034) (-267.072) * (-261.659) (-267.694) [-259.340] (-261.333) -- 0:00:02
968000 -- [-260.342] (-261.297) (-260.118) (-261.505) * (-263.668) [-261.775] (-261.952) (-260.918) -- 0:00:02
968500 -- [-261.701] (-261.515) (-264.102) (-261.317) * (-263.474) (-261.469) (-262.693) [-259.697] -- 0:00:02
969000 -- (-259.528) (-261.485) (-261.814) [-261.656] * (-262.717) (-263.988) (-263.904) [-261.833] -- 0:00:02
969500 -- (-261.023) (-261.465) [-259.392] (-261.750) * (-260.687) (-259.574) (-263.976) [-260.107] -- 0:00:02
970000 -- (-262.067) (-260.939) [-259.975] (-262.208) * (-263.234) [-260.170] (-261.429) (-261.497) -- 0:00:02
Average standard deviation of split frequencies: 0.007679
970500 -- [-261.516] (-261.329) (-260.822) (-263.936) * [-261.518] (-261.210) (-263.512) (-264.395) -- 0:00:01
971000 -- [-261.721] (-261.589) (-262.075) (-266.010) * [-260.940] (-264.032) (-262.968) (-260.924) -- 0:00:01
971500 -- (-261.428) (-260.779) (-265.809) [-260.824] * (-260.316) (-259.753) [-266.037] (-259.890) -- 0:00:01
972000 -- (-260.941) [-259.296] (-261.357) (-263.355) * (-262.040) (-260.756) (-264.077) [-259.709] -- 0:00:01
972500 -- [-260.448] (-263.205) (-264.060) (-260.617) * [-265.478] (-264.117) (-272.858) (-261.182) -- 0:00:01
973000 -- (-260.793) (-260.135) (-264.648) [-259.256] * (-259.822) (-262.971) [-260.217] (-265.495) -- 0:00:01
973500 -- (-264.199) (-260.821) (-260.641) [-260.804] * (-262.501) (-265.005) [-261.826] (-262.354) -- 0:00:01
974000 -- (-261.823) (-263.480) (-259.629) [-264.988] * (-261.962) (-260.989) (-261.886) [-260.301] -- 0:00:01
974500 -- [-260.287] (-261.482) (-260.500) (-264.163) * (-260.395) (-261.328) [-261.429] (-265.124) -- 0:00:01
975000 -- (-266.685) [-261.907] (-262.063) (-262.179) * (-262.584) [-262.699] (-260.432) (-269.781) -- 0:00:01
Average standard deviation of split frequencies: 0.007637
975500 -- (-266.139) [-265.444] (-259.255) (-261.756) * (-259.050) (-261.228) [-260.008] (-263.201) -- 0:00:01
976000 -- [-263.462] (-260.701) (-260.223) (-259.934) * (-262.708) (-261.148) [-262.277] (-259.715) -- 0:00:01
976500 -- (-259.949) [-260.612] (-260.557) (-267.049) * [-260.777] (-261.779) (-262.969) (-261.883) -- 0:00:01
977000 -- (-259.954) [-260.271] (-259.111) (-266.778) * (-260.044) [-260.381] (-260.097) (-260.393) -- 0:00:01
977500 -- (-262.131) [-259.873] (-260.119) (-260.907) * [-262.531] (-263.346) (-260.075) (-261.927) -- 0:00:01
978000 -- (-266.940) (-260.450) [-260.368] (-260.278) * (-262.328) (-263.662) (-261.397) [-263.122] -- 0:00:01
978500 -- [-261.534] (-260.337) (-260.517) (-261.457) * (-264.077) (-262.835) (-262.624) [-262.159] -- 0:00:01
979000 -- (-261.736) (-259.852) [-261.004] (-259.509) * (-261.784) (-261.613) [-260.146] (-261.762) -- 0:00:01
979500 -- (-263.575) (-261.588) (-263.238) [-261.059] * (-260.603) [-266.319] (-261.768) (-263.678) -- 0:00:01
980000 -- [-262.487] (-260.821) (-259.761) (-260.292) * (-260.854) [-260.036] (-261.980) (-261.143) -- 0:00:01
Average standard deviation of split frequencies: 0.007915
980500 -- (-262.730) (-260.483) (-266.236) [-262.153] * [-259.752] (-261.956) (-260.475) (-262.167) -- 0:00:01
981000 -- (-264.766) (-262.222) [-263.253] (-261.284) * (-260.595) [-261.480] (-265.545) (-261.679) -- 0:00:01
981500 -- (-265.569) (-261.134) [-262.261] (-261.037) * (-264.198) [-261.410] (-261.704) (-261.674) -- 0:00:01
982000 -- (-265.218) (-266.554) (-262.598) [-260.884] * (-261.197) [-264.343] (-260.313) (-259.897) -- 0:00:01
982500 -- (-267.583) [-261.889] (-261.382) (-261.821) * (-261.562) (-264.563) (-261.654) [-259.433] -- 0:00:01
983000 -- [-261.269] (-263.254) (-267.798) (-260.771) * [-263.648] (-260.276) (-260.213) (-265.014) -- 0:00:01
983500 -- (-261.229) [-260.126] (-262.224) (-259.331) * (-264.316) (-260.376) [-260.639] (-260.054) -- 0:00:01
984000 -- [-261.648] (-260.519) (-259.419) (-261.392) * (-261.610) (-261.105) (-264.649) [-260.615] -- 0:00:01
984500 -- (-259.692) (-260.992) (-261.263) [-260.910] * (-259.649) (-259.398) [-260.684] (-259.953) -- 0:00:01
985000 -- [-259.878] (-262.298) (-259.349) (-260.704) * (-260.886) [-261.255] (-259.951) (-261.087) -- 0:00:01
Average standard deviation of split frequencies: 0.007650
985500 -- (-259.141) (-268.597) (-259.145) [-262.349] * (-262.489) [-260.464] (-260.072) (-263.370) -- 0:00:00
986000 -- (-262.383) (-261.582) [-262.630] (-261.564) * [-262.295] (-261.590) (-260.584) (-261.336) -- 0:00:00
986500 -- (-265.070) (-259.262) [-263.907] (-260.398) * (-261.706) (-264.094) [-261.183] (-262.280) -- 0:00:00
987000 -- (-263.494) (-259.626) (-261.878) [-261.537] * (-264.569) (-261.422) (-265.886) [-260.706] -- 0:00:00
987500 -- (-262.297) (-263.234) (-262.334) [-262.486] * (-260.279) (-263.050) [-260.974] (-263.999) -- 0:00:00
988000 -- (-266.083) (-260.162) [-259.636] (-263.784) * [-263.407] (-260.037) (-260.851) (-262.785) -- 0:00:00
988500 -- (-262.221) (-261.973) [-261.897] (-260.856) * (-260.162) (-262.152) [-259.591] (-261.703) -- 0:00:00
989000 -- (-260.828) [-262.616] (-262.059) (-262.981) * (-260.101) (-261.288) [-261.128] (-260.887) -- 0:00:00
989500 -- (-259.740) (-262.516) (-261.106) [-259.234] * (-262.814) (-263.125) (-266.749) [-264.877] -- 0:00:00
990000 -- [-259.102] (-260.825) (-264.175) (-266.348) * (-260.858) [-262.384] (-264.656) (-264.120) -- 0:00:00
Average standard deviation of split frequencies: 0.007550
990500 -- (-261.590) (-261.258) (-259.688) [-259.377] * (-262.096) (-259.657) (-262.884) [-260.809] -- 0:00:00
991000 -- (-265.398) (-265.489) (-262.587) [-261.675] * [-259.902] (-261.241) (-262.449) (-261.180) -- 0:00:00
991500 -- (-261.974) (-261.322) (-262.147) [-260.488] * (-260.996) [-263.126] (-261.738) (-264.208) -- 0:00:00
992000 -- (-263.628) (-262.103) (-259.273) [-260.232] * (-259.541) (-261.608) [-259.515] (-264.196) -- 0:00:00
992500 -- (-261.486) [-263.859] (-262.553) (-262.360) * (-264.421) (-264.132) (-259.257) [-259.334] -- 0:00:00
993000 -- [-261.678] (-260.601) (-259.622) (-263.777) * (-262.614) [-261.317] (-261.146) (-260.185) -- 0:00:00
993500 -- (-260.761) (-261.157) (-260.432) [-262.400] * [-261.086] (-262.601) (-261.674) (-260.178) -- 0:00:00
994000 -- (-262.911) (-262.497) [-259.039] (-263.877) * (-262.726) (-264.732) (-261.087) [-260.216] -- 0:00:00
994500 -- (-261.024) (-261.432) (-260.045) [-261.999] * (-259.254) (-260.923) [-261.137] (-261.218) -- 0:00:00
995000 -- (-262.866) (-263.199) [-260.722] (-264.749) * (-264.118) (-262.960) (-262.323) [-263.581] -- 0:00:00
Average standard deviation of split frequencies: 0.007541
995500 -- (-261.677) (-265.527) [-259.944] (-261.460) * [-261.528] (-260.364) (-261.259) (-262.677) -- 0:00:00
996000 -- (-262.385) (-261.601) (-260.160) [-261.541] * [-260.184] (-260.579) (-263.730) (-260.969) -- 0:00:00
996500 -- (-260.220) [-260.903] (-262.283) (-261.323) * (-264.665) [-259.807] (-261.915) (-261.738) -- 0:00:00
997000 -- (-264.899) (-259.342) [-261.213] (-261.904) * (-264.001) [-262.376] (-261.861) (-260.546) -- 0:00:00
997500 -- (-261.277) (-261.149) [-263.120] (-263.142) * (-265.096) (-261.971) (-261.124) [-259.300] -- 0:00:00
998000 -- (-263.438) [-263.525] (-259.732) (-259.370) * (-261.045) (-262.973) (-259.909) [-260.556] -- 0:00:00
998500 -- [-261.497] (-261.431) (-259.859) (-262.802) * (-259.707) (-263.227) (-261.216) [-259.554] -- 0:00:00
999000 -- (-260.863) [-263.005] (-259.838) (-259.987) * (-260.155) (-261.626) (-260.236) [-260.027] -- 0:00:00
999500 -- [-262.153] (-263.270) (-261.245) (-260.856) * (-259.911) [-261.778] (-261.892) (-263.927) -- 0:00:00
1000000 -- (-259.892) (-263.577) [-260.706] (-260.091) * (-266.249) [-264.226] (-266.251) (-260.530) -- 0:00:00
Average standard deviation of split frequencies: 0.007349
Analysis completed in 1 mins 7 seconds
Analysis used 65.88 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -258.82
Likelihood of best state for "cold" chain of run 2 was -258.82
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 76 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
48.5 % ( 50 %) Dirichlet(Pi{all})
44.0 % ( 28 %) Slider(Pi{all})
78.8 % ( 55 %) Multiplier(Alpha{1,2})
77.7 % ( 47 %) Multiplier(Alpha{3})
27.1 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 19 %) Multiplier(V{all})
97.3 % ( 96 %) Nodeslider(V{all})
30.4 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
48.4 % ( 42 %) Dirichlet(Pi{all})
44.7 % ( 29 %) Slider(Pi{all})
79.3 % ( 55 %) Multiplier(Alpha{1,2})
77.3 % ( 49 %) Multiplier(Alpha{3})
27.6 % ( 15 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167040 0.82 0.67
3 | 166248 166513 0.84
4 | 166435 165812 167952
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166740 0.82 0.67
3 | 166169 166472 0.84
4 | 167730 166571 166318
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -260.67
| 1 1 2 2 2 |
| 1 1 2 2 21 1 21 1 |
| 2 2 2 1 2111 121 1 2 11 2 |
|2 2 1 1 2 2 1 11 1 2 2 2 2 2 2 1 2 1 1 2|
| 1 22 1 2 2 2 2 21 22 11 1 1 1|
| 1 211 2 2 1 1 12 1 2 2 1 2* 2 |
|12 1 1 11 2 1 2 2 1 2 |
| 1 222 1 2 2 1 1 2 2 2 1 |
| 1 2 1 1 |
| |
| 1 2 |
| |
| |
| |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -262.87
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -260.56 -264.01
2 -260.55 -266.04
--------------------------------------
TOTAL -260.55 -265.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892706 0.084457 0.361475 1.470542 0.860392 1161.08 1331.04 1.001
r(A<->C){all} 0.168765 0.020473 0.000086 0.453337 0.126834 130.34 277.76 1.000
r(A<->G){all} 0.161664 0.019119 0.000059 0.435086 0.125719 158.74 197.89 1.008
r(A<->T){all} 0.167705 0.020977 0.000070 0.452850 0.128453 224.69 240.58 1.000
r(C<->G){all} 0.166912 0.019082 0.000139 0.437465 0.132201 255.98 271.31 1.003
r(C<->T){all} 0.156395 0.017698 0.000036 0.429743 0.121762 188.93 217.08 1.004
r(G<->T){all} 0.178560 0.021794 0.000053 0.471430 0.140978 192.73 327.62 1.000
pi(A){all} 0.239230 0.000910 0.180514 0.299419 0.238491 1130.77 1315.88 1.000
pi(C){all} 0.315046 0.001081 0.251174 0.377104 0.314444 1229.46 1264.85 1.000
pi(G){all} 0.297188 0.001059 0.236939 0.363530 0.296298 1199.58 1236.90 1.000
pi(T){all} 0.148536 0.000678 0.100978 0.200612 0.147031 997.60 1019.80 1.001
alpha{1,2} 0.422856 0.240358 0.000222 1.362852 0.253647 1414.54 1439.03 1.000
alpha{3} 0.436903 0.217933 0.000281 1.417373 0.289340 1244.60 1342.80 1.000
pinvar{all} 0.991023 0.000132 0.969171 0.999996 0.994734 1220.96 1284.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..****
8 -- ..**..
9 -- ....**
10 -- ...**.
11 -- .**.**
12 -- .*...*
13 -- .***.*
14 -- ..*.*.
15 -- .*..*.
16 -- .****.
17 -- .**...
18 -- .*.***
19 -- ...*.*
20 -- ..*..*
21 -- .*.*..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.008951 0.149234 0.161892 2
8 457 0.152232 0.006124 0.147901 0.156562 2
9 454 0.151233 0.018844 0.137908 0.164557 2
10 451 0.150233 0.012719 0.141239 0.159227 2
11 446 0.148568 0.005653 0.144570 0.152565 2
12 437 0.145570 0.000471 0.145237 0.145903 2
13 433 0.144237 0.001413 0.143238 0.145237 2
14 428 0.142572 0.001884 0.141239 0.143904 2
15 426 0.141905 0.012248 0.133245 0.150566 2
16 423 0.140906 0.008951 0.134577 0.147235 2
17 414 0.137908 0.006595 0.133245 0.142572 2
18 413 0.137575 0.001413 0.136576 0.138574 2
19 402 0.133911 0.000942 0.133245 0.134577 2
20 396 0.131912 0.009422 0.125250 0.138574 2
21 387 0.128914 0.014604 0.118588 0.139241 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097589 0.009331 0.000011 0.291156 0.068462 1.001 2
length{all}[2] 0.100795 0.010084 0.000023 0.294034 0.070776 1.001 2
length{all}[3] 0.098703 0.009958 0.000025 0.294006 0.067005 1.000 2
length{all}[4] 0.098623 0.009335 0.000007 0.292673 0.070280 1.000 2
length{all}[5] 0.099563 0.009477 0.000111 0.296200 0.072264 1.001 2
length{all}[6] 0.099530 0.009324 0.000065 0.298275 0.070134 1.000 2
length{all}[7] 0.096680 0.007836 0.000336 0.274825 0.074931 0.999 2
length{all}[8] 0.097764 0.009778 0.000045 0.299105 0.066789 0.998 2
length{all}[9] 0.094249 0.009314 0.000308 0.276937 0.065102 0.998 2
length{all}[10] 0.098378 0.011727 0.000093 0.303142 0.064042 1.000 2
length{all}[11] 0.096054 0.009514 0.000466 0.275597 0.061717 0.999 2
length{all}[12] 0.096741 0.010158 0.000073 0.303660 0.061032 0.999 2
length{all}[13] 0.106407 0.012974 0.000263 0.315995 0.068830 0.998 2
length{all}[14] 0.100518 0.008687 0.000025 0.267981 0.072439 0.998 2
length{all}[15] 0.104804 0.010180 0.000131 0.310500 0.075041 0.998 2
length{all}[16] 0.091460 0.008262 0.000389 0.267094 0.066364 1.007 2
length{all}[17] 0.097319 0.008344 0.000119 0.274075 0.070188 0.998 2
length{all}[18] 0.099716 0.011304 0.000130 0.295505 0.065652 0.999 2
length{all}[19] 0.109064 0.013376 0.000149 0.346026 0.073180 1.010 2
length{all}[20] 0.100059 0.008978 0.000032 0.267617 0.078581 1.001 2
length{all}[21] 0.103042 0.008892 0.000586 0.271467 0.077668 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007349
Maximum standard deviation of split frequencies = 0.018844
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 192
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 36 patterns at 64 / 64 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 36 patterns at 64 / 64 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
35136 bytes for conP
3168 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109067 0.041038 0.101458 0.045647 0.033332 0.106276 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -276.833716
Iterating by ming2
Initial: fx= 276.833716
x= 0.10907 0.04104 0.10146 0.04565 0.03333 0.10628 0.30000 1.30000
1 h-m-p 0.0000 0.0005 153.0382 +++ 264.392364 m 0.0005 14 | 1/8
2 h-m-p 0.0018 0.0138 40.8470 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 140.3475 ++ 261.974974 m 0.0001 46 | 2/8
4 h-m-p 0.0005 0.0186 33.0175 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 125.4780 ++ 260.818747 m 0.0001 77 | 3/8
6 h-m-p 0.0003 0.0224 26.7442 ----------.. | 3/8
7 h-m-p 0.0000 0.0009 108.4583 ++++ 250.200749 m 0.0009 109 | 4/8
8 h-m-p 0.0041 0.0348 19.5910 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 89.4296 ++ 249.579883 m 0.0001 141 | 5/8
10 h-m-p 0.0004 0.0774 12.4865 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 63.2759 ++ 249.399794 m 0.0000 171 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 -----Y 249.399794 0 0.0004 187 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 +++++ 249.399794 m 8.0000 203 | 6/8
14 h-m-p 0.0081 4.0704 0.5387 ---------Y 249.399794 0 0.0000 225 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 249.399794 m 8.0000 265 | 6/8
17 h-m-p 0.0012 0.6203 1.5981 +++++ 249.399775 m 0.6203 281 | 7/8
18 h-m-p 1.4088 8.0000 0.6708 ++ 249.399758 m 8.0000 292 | 7/8
19 h-m-p 1.6000 8.0000 0.6031 ++ 249.399755 m 8.0000 304 | 7/8
20 h-m-p 1.6000 8.0000 2.9948 ++ 249.399751 m 8.0000 316 | 7/8
21 h-m-p 1.6000 8.0000 3.9412 ++ 249.399751 m 8.0000 327 | 7/8
22 h-m-p 1.6000 8.0000 10.3209 ++ 249.399750 m 8.0000 338 | 7/8
23 h-m-p 0.4986 5.1238 165.6012 ++ 249.399750 m 5.1238 349 | 7/8
24 h-m-p 1.6000 8.0000 17.1737 --------Y 249.399750 0 0.0000 368 | 7/8
25 h-m-p 0.0800 0.4000 0.0000 Y 249.399750 0 0.0200 379
Out..
lnL = -249.399750
380 lfun, 380 eigenQcodon, 2280 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.105865 0.096044 0.102000 0.092353 0.016811 0.043220 0.000100 0.709273 0.470286
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.756164
np = 9
lnL0 = -278.006230
Iterating by ming2
Initial: fx= 278.006230
x= 0.10586 0.09604 0.10200 0.09235 0.01681 0.04322 0.00011 0.70927 0.47029
1 h-m-p 0.0000 0.0000 149.8519 ++ 277.673162 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0007 111.6688 +++ 271.664508 m 0.0007 27 | 2/9
3 h-m-p 0.0002 0.0010 79.0586 ++ 264.968881 m 0.0010 39 | 3/9
4 h-m-p 0.0001 0.0004 688.6692 ++ 251.411091 m 0.0004 51 | 4/9
5 h-m-p 0.0009 0.0043 29.2628 ++ 250.698115 m 0.0043 63 | 4/9
6 h-m-p 0.0001 0.0006 10.7972 ++ 250.678437 m 0.0006 75 | 5/9
7 h-m-p 0.0000 0.0001 55.4635 ++ 250.201994 m 0.0001 87 | 6/9
8 h-m-p 0.0003 0.0013 4.9277 ----------.. | 6/9
9 h-m-p 0.0000 0.0002 66.7400 +++ 249.399905 m 0.0002 120 | 7/9
10 h-m-p 0.7327 8.0000 0.0001 ++ 249.399905 m 8.0000 132 | 7/9
11 h-m-p 0.0016 0.8154 0.3887 +++++ 249.399877 m 0.8154 149 | 7/9
12 h-m-p 0.1042 0.5211 0.6133 -----------Y 249.399877 0 0.0000 174 | 7/9
13 h-m-p 0.0160 8.0000 0.0009 -------------.. | 7/9
14 h-m-p 0.0160 8.0000 0.0003 +++++ 249.399876 m 8.0000 216 | 7/9
15 h-m-p 0.0147 5.2354 0.1732 +++++ 249.399801 m 5.2354 233 | 8/9
16 h-m-p 1.6000 8.0000 0.0000 N 249.399801 0 1.6000 247 | 8/9
17 h-m-p 0.0160 8.0000 0.0000 N 249.399801 0 0.0160 260
Out..
lnL = -249.399801
261 lfun, 783 eigenQcodon, 3132 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069511 0.051305 0.101217 0.052535 0.067132 0.043159 0.000100 1.353998 0.157455 0.389903 1039.742283
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.063548
np = 11
lnL0 = -259.022895
Iterating by ming2
Initial: fx= 259.022895
x= 0.06951 0.05130 0.10122 0.05254 0.06713 0.04316 0.00011 1.35400 0.15746 0.38990 951.42857
1 h-m-p 0.0000 0.0000 19.7122 ++ 259.016995 m 0.0000 16 | 1/11
2 h-m-p 0.0003 0.1484 8.0391 +++++ 252.348216 m 0.1484 33 | 2/11
3 h-m-p 0.0000 0.0002 340.9544 ++ 251.678138 m 0.0002 47 | 3/11
4 h-m-p 0.0007 0.0036 44.8109 ++ 251.303092 m 0.0036 61 | 4/11
5 h-m-p 0.0000 0.0002 1341.9866 ++ 250.159017 m 0.0002 75 | 5/11
6 h-m-p 0.0001 0.0004 405.4020 ++ 249.911167 m 0.0004 89 | 6/11
7 h-m-p 0.0000 0.0002 3645.3233 ++ 249.399752 m 0.0002 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 249.399752 m 8.0000 117 | 7/11
9 h-m-p 0.0160 8.0000 0.0489 -------------.. | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 249.399752 m 8.0000 167 | 7/11
11 h-m-p 0.0160 8.0000 0.2912 -------Y 249.399752 0 0.0000 192 | 7/11
12 h-m-p 0.0160 8.0000 0.0002 -------------.. | 7/11
13 h-m-p 0.0160 8.0000 0.0000 ------------N 249.399752 0 0.0000 251 | 7/11
14 h-m-p 0.0160 8.0000 0.0000 ------------N 249.399752 0 0.0000 281
Out..
lnL = -249.399752
282 lfun, 1128 eigenQcodon, 5076 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -249.398484 S = -249.398299 -0.000071
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 36 patterns 0:03
did 20 / 36 patterns 0:03
did 30 / 36 patterns 0:03
did 36 / 36 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.033287 0.038766 0.035729 0.013601 0.055998 0.076721 0.000100 0.629803 1.037665
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.543166
np = 9
lnL0 = -265.479752
Iterating by ming2
Initial: fx= 265.479752
x= 0.03329 0.03877 0.03573 0.01360 0.05600 0.07672 0.00011 0.62980 1.03767
1 h-m-p 0.0000 0.0001 149.5152 ++ 264.177921 m 0.0001 14 | 1/9
2 h-m-p 0.0011 0.0988 7.7489 -----------.. | 1/9
3 h-m-p 0.0000 0.0002 150.4507 +++ 260.490490 m 0.0002 48 | 2/9
4 h-m-p 0.0036 0.1564 6.0700 ------------.. | 2/9
5 h-m-p 0.0000 0.0003 139.4907 +++ 254.259217 m 0.0003 83 | 3/9
6 h-m-p 0.0084 0.2307 4.6586 -------------.. | 3/9
7 h-m-p 0.0000 0.0000 128.4461 ++ 253.627109 m 0.0000 118 | 4/9
8 h-m-p 0.0007 0.2322 5.8170 -----------.. | 4/9
9 h-m-p 0.0000 0.0000 111.3846 ++ 253.036848 m 0.0000 151 | 5/9
10 h-m-p 0.0008 0.2545 5.5568 -----------.. | 5/9
11 h-m-p 0.0000 0.0003 90.9446 +++ 250.782263 m 0.0003 185 | 6/9
12 h-m-p 0.0032 0.2913 5.4754 ------------.. | 6/9
13 h-m-p 0.0000 0.0003 65.0034 +++ 249.399854 m 0.0003 220 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 249.399854 m 8.0000 232 | 6/9
15 h-m-p 0.0356 8.0000 0.0007 ++++ 249.399854 m 8.0000 248 | 6/9
16 h-m-p 0.0160 8.0000 0.6199 +++++ 249.399848 m 8.0000 266 | 6/9
17 h-m-p 1.6000 8.0000 0.7283 ++ 249.399846 m 8.0000 281 | 6/9
18 h-m-p 0.4671 8.0000 12.4747 +++ 249.399832 m 8.0000 297 | 6/9
19 h-m-p 0.0968 0.4839 16.2734 ++ 249.399832 m 0.4839 309 | 6/9
20 h-m-p 0.0000 0.0000 117.2413
h-m-p: 0.00000000e+00 0.00000000e+00 1.17241327e+02 249.399832
.. | 6/9
21 h-m-p 0.0160 8.0000 0.0000 Y 249.399832 0 0.0040 330 | 6/9
22 h-m-p 0.0268 8.0000 0.0000 C 249.399832 0 0.0067 345
Out..
lnL = -249.399832
346 lfun, 3806 eigenQcodon, 20760 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059569 0.059869 0.085179 0.070724 0.075582 0.093187 3.753321 0.900000 0.522418 1.096792 998.999986
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.042244
np = 11
lnL0 = -255.994443
Iterating by ming2
Initial: fx= 255.994443
x= 0.05957 0.05987 0.08518 0.07072 0.07558 0.09319 3.75332 0.90000 0.52242 1.09679 951.42857
1 h-m-p 0.0000 0.0017 58.8001 +++YCYYYYCC 251.572065 7 0.0014 29 | 0/11
2 h-m-p 0.0043 0.0214 6.5147 ++ 250.479078 m 0.0214 43 | 1/11
3 h-m-p 0.0005 0.0027 1.2138 ++ 250.470619 m 0.0027 57 | 2/11
4 h-m-p 0.0001 0.0009 42.0061 ++ 250.305504 m 0.0009 71 | 3/11
5 h-m-p 0.0085 0.0425 1.2542 ++ 250.051406 m 0.0425 85 | 4/11
6 h-m-p 0.0003 0.0016 52.4635 CYCYC 250.001300 4 0.0006 106 | 4/11
7 h-m-p 0.0004 0.0021 4.3497 ++ 249.884890 m 0.0021 120 | 5/11
8 h-m-p 0.0059 0.9588 0.6312 ++++ 249.815003 m 0.9588 136 | 6/11
9 h-m-p 0.9434 8.0000 0.2831 ----------------.. | 6/11
10 h-m-p 0.0000 0.0003 30.4508 ++YYYCYCYCC 249.670578 8 0.0002 202 | 6/11
11 h-m-p 0.0003 0.0014 11.0364 ++ 249.399793 m 0.0014 216 | 7/11
12 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 7/11
13 h-m-p 0.0160 8.0000 0.0055 +++++ 249.399784 m 8.0000 265 | 7/11
14 h-m-p 1.6000 8.0000 0.0001 ++ 249.399784 m 8.0000 283 | 7/11
15 h-m-p 0.0222 8.0000 0.0233 +++++ 249.399783 m 8.0000 304 | 7/11
16 h-m-p 1.6000 8.0000 0.0127 ++ 249.399783 m 8.0000 322 | 7/11
17 h-m-p 0.4466 2.9353 0.2275 ++ 249.399783 m 2.9353 340 | 8/11
18 h-m-p 0.0160 8.0000 2.6527 ---------C 249.399783 0 0.0000 367 | 8/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 249.399783 m 8.0000 384 | 8/11
20 h-m-p 0.0160 8.0000 0.0233 +++++ 249.399782 m 8.0000 404 | 8/11
21 h-m-p 0.0595 8.0000 3.1343 ----------C 249.399782 0 0.0000 431 | 8/11
22 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11
23 h-m-p 0.0160 8.0000 0.0000 ------------- | 8/11
24 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -249.399782
513 lfun, 6156 eigenQcodon, 33858 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -249.398280 S = -249.398275 -0.000002
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 36 patterns 0:18
did 20 / 36 patterns 0:19
did 30 / 36 patterns 0:19
did 36 / 36 patterns 0:19
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=64
NC_011896_1_WP_010908314_1_1475_MLBR_RS06970 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
NC_002677_1_NP_301993_1_865_rpmI MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
NZ_CP029543_1_WP_010908314_1_1497_rpmI MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
NZ_AP014567_1_WP_010908314_1_1533_rpmI MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV
**************************************************
NC_011896_1_WP_010908314_1_1475_MLBR_RS06970 SANDTQRVNSLLNG
NC_002677_1_NP_301993_1_865_rpmI SANDTQRVNSLLNG
NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085 SANDTQRVNSLLNG
NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635 SANDTQRVNSLLNG
NZ_CP029543_1_WP_010908314_1_1497_rpmI SANDTQRVNSLLNG
NZ_AP014567_1_WP_010908314_1_1533_rpmI SANDTQRVNSLLNG
**************
>NC_011896_1_WP_010908314_1_1475_MLBR_RS06970 ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC >NC_002677_1_NP_301993_1_865_rpmI ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC >NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085 ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC >NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635 ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC >NZ_CP029543_1_WP_010908314_1_1497_rpmI ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC >NZ_AP014567_1_WP_010908314_1_1533_rpmI ATGCCCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCAC CGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCG AGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTT TCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGC
>NC_011896_1_WP_010908314_1_1475_MLBR_RS06970 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV SANDTQRVNSLLNG >NC_002677_1_NP_301993_1_865_rpmI MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV SANDTQRVNSLLNG >NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV SANDTQRVNSLLNG >NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635 MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV SANDTQRVNSLLNG >NZ_CP029543_1_WP_010908314_1_1497_rpmI MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV SANDTQRVNSLLNG >NZ_AP014567_1_WP_010908314_1_1533_rpmI MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRV SANDTQRVNSLLNG
#NEXUS
[ID: 0146483075]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908314_1_1475_MLBR_RS06970
NC_002677_1_NP_301993_1_865_rpmI
NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085
NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635
NZ_CP029543_1_WP_010908314_1_1497_rpmI
NZ_AP014567_1_WP_010908314_1_1533_rpmI
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908314_1_1475_MLBR_RS06970,
2 NC_002677_1_NP_301993_1_865_rpmI,
3 NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085,
4 NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635,
5 NZ_CP029543_1_WP_010908314_1_1497_rpmI,
6 NZ_AP014567_1_WP_010908314_1_1533_rpmI
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06846164,2:0.07077599,3:0.06700484,4:0.0702805,5:0.0722643,6:0.07013396);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06846164,2:0.07077599,3:0.06700484,4:0.0702805,5:0.0722643,6:0.07013396);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -260.56 -264.01
2 -260.55 -266.04
--------------------------------------
TOTAL -260.55 -265.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892706 0.084457 0.361475 1.470542 0.860392 1161.08 1331.04 1.001
r(A<->C){all} 0.168765 0.020473 0.000086 0.453337 0.126834 130.34 277.76 1.000
r(A<->G){all} 0.161664 0.019119 0.000059 0.435086 0.125719 158.74 197.89 1.008
r(A<->T){all} 0.167705 0.020977 0.000070 0.452850 0.128453 224.69 240.58 1.000
r(C<->G){all} 0.166912 0.019082 0.000139 0.437465 0.132201 255.98 271.31 1.003
r(C<->T){all} 0.156395 0.017698 0.000036 0.429743 0.121762 188.93 217.08 1.004
r(G<->T){all} 0.178560 0.021794 0.000053 0.471430 0.140978 192.73 327.62 1.000
pi(A){all} 0.239230 0.000910 0.180514 0.299419 0.238491 1130.77 1315.88 1.000
pi(C){all} 0.315046 0.001081 0.251174 0.377104 0.314444 1229.46 1264.85 1.000
pi(G){all} 0.297188 0.001059 0.236939 0.363530 0.296298 1199.58 1236.90 1.000
pi(T){all} 0.148536 0.000678 0.100978 0.200612 0.147031 997.60 1019.80 1.001
alpha{1,2} 0.422856 0.240358 0.000222 1.362852 0.253647 1414.54 1439.03 1.000
alpha{3} 0.436903 0.217933 0.000281 1.417373 0.289340 1244.60 1342.80 1.000
pinvar{all} 0.991023 0.000132 0.969171 0.999996 0.994734 1220.96 1284.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpmI/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 64
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 3 3 3 3 3 3
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 1 1 1 1 1 1 | ACC 5 5 5 5 5 5 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 0 0 0 0 0 0 | Asp GAT 1 1 1 1 1 1 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 3 3 3 3 3 3 | GAC 1 1 1 1 1 1 | GGC 1 1 1 1 1 1
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 0 0 0 0 0 0 | GCG 1 1 1 1 1 1 | GAG 1 1 1 1 1 1 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908314_1_1475_MLBR_RS06970
position 1: T:0.07812 C:0.35938 A:0.32812 G:0.23438
position 2: T:0.17188 C:0.25000 A:0.29688 G:0.28125
position 3: T:0.18750 C:0.34375 A:0.09375 G:0.37500
Average T:0.14583 C:0.31771 A:0.23958 G:0.29688
#2: NC_002677_1_NP_301993_1_865_rpmI
position 1: T:0.07812 C:0.35938 A:0.32812 G:0.23438
position 2: T:0.17188 C:0.25000 A:0.29688 G:0.28125
position 3: T:0.18750 C:0.34375 A:0.09375 G:0.37500
Average T:0.14583 C:0.31771 A:0.23958 G:0.29688
#3: NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085
position 1: T:0.07812 C:0.35938 A:0.32812 G:0.23438
position 2: T:0.17188 C:0.25000 A:0.29688 G:0.28125
position 3: T:0.18750 C:0.34375 A:0.09375 G:0.37500
Average T:0.14583 C:0.31771 A:0.23958 G:0.29688
#4: NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635
position 1: T:0.07812 C:0.35938 A:0.32812 G:0.23438
position 2: T:0.17188 C:0.25000 A:0.29688 G:0.28125
position 3: T:0.18750 C:0.34375 A:0.09375 G:0.37500
Average T:0.14583 C:0.31771 A:0.23958 G:0.29688
#5: NZ_CP029543_1_WP_010908314_1_1497_rpmI
position 1: T:0.07812 C:0.35938 A:0.32812 G:0.23438
position 2: T:0.17188 C:0.25000 A:0.29688 G:0.28125
position 3: T:0.18750 C:0.34375 A:0.09375 G:0.37500
Average T:0.14583 C:0.31771 A:0.23958 G:0.29688
#6: NZ_AP014567_1_WP_010908314_1_1533_rpmI
position 1: T:0.07812 C:0.35938 A:0.32812 G:0.23438
position 2: T:0.17188 C:0.25000 A:0.29688 G:0.28125
position 3: T:0.18750 C:0.34375 A:0.09375 G:0.37500
Average T:0.14583 C:0.31771 A:0.23958 G:0.29688
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 0 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 18
CTC 0 | CCC 6 | CAC 12 | CGC 6
CTA 0 | CCA 0 | Gln Q CAA 6 | CGA 6
CTG 24 | CCG 6 | CAG 6 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 6
ATC 6 | ACC 30 | AAC 12 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 6 | ACG 6 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 0 | Asp D GAT 6 | Gly G GGT 6
GTC 12 | GCC 18 | GAC 6 | GGC 6
GTA 0 | GCA 0 | Glu E GAA 0 | GGA 6
GTG 0 | GCG 6 | GAG 6 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.07812 C:0.35938 A:0.32812 G:0.23438
position 2: T:0.17188 C:0.25000 A:0.29688 G:0.28125
position 3: T:0.18750 C:0.34375 A:0.09375 G:0.37500
Average T:0.14583 C:0.31771 A:0.23958 G:0.29688
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -249.399750 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 998.999986
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908314_1_1475_MLBR_RS06970: 0.000004, NC_002677_1_NP_301993_1_865_rpmI: 0.000004, NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085: 0.000004, NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635: 0.000004, NZ_CP029543_1_WP_010908314_1_1497_rpmI: 0.000004, NZ_AP014567_1_WP_010908314_1_1533_rpmI: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 998.99999
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 156.1 35.9 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 156.1 35.9 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 156.1 35.9 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 156.1 35.9 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 156.1 35.9 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 156.1 35.9 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -249.399801 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.462294 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908314_1_1475_MLBR_RS06970: 0.000004, NC_002677_1_NP_301993_1_865_rpmI: 0.000004, NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085: 0.000004, NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635: 0.000004, NZ_CP029543_1_WP_010908314_1_1497_rpmI: 0.000004, NZ_AP014567_1_WP_010908314_1_1533_rpmI: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.46229 0.53771
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 156.1 35.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 156.1 35.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 156.1 35.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 156.1 35.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 156.1 35.9 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 156.1 35.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -249.399752 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.932075 0.048077 0.323715 951.428643
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908314_1_1475_MLBR_RS06970: 0.000004, NC_002677_1_NP_301993_1_865_rpmI: 0.000004, NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085: 0.000004, NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635: 0.000004, NZ_CP029543_1_WP_010908314_1_1497_rpmI: 0.000004, NZ_AP014567_1_WP_010908314_1_1533_rpmI: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.93207 0.04808 0.01985
w: 0.32372 1.00000 951.42864
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 156.1 35.9 19.2336 0.0000 0.0000 0.0 0.0
7..2 0.000 156.1 35.9 19.2336 0.0000 0.0000 0.0 0.0
7..3 0.000 156.1 35.9 19.2336 0.0000 0.0000 0.0 0.0
7..4 0.000 156.1 35.9 19.2336 0.0000 0.0000 0.0 0.0
7..5 0.000 156.1 35.9 19.2336 0.0000 0.0000 0.0 0.0
7..6 0.000 156.1 35.9 19.2336 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908314_1_1475_MLBR_RS06970)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908314_1_1475_MLBR_RS06970)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -249.399832 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 3.753321 67.135882 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908314_1_1475_MLBR_RS06970: 0.000004, NC_002677_1_NP_301993_1_865_rpmI: 0.000004, NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085: 0.000004, NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635: 0.000004, NZ_CP029543_1_WP_010908314_1_1497_rpmI: 0.000004, NZ_AP014567_1_WP_010908314_1_1533_rpmI: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 3.75332
Parameters in M7 (beta):
p = 67.13588 q = 99.00000
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.34231 0.36468 0.37820 0.38909 0.39893 0.40851 0.41846 0.42959 0.44358 0.46721
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 144.2 47.8 0.4041 0.0000 0.0000 0.0 0.0
7..2 0.000 144.2 47.8 0.4041 0.0000 0.0000 0.0 0.0
7..3 0.000 144.2 47.8 0.4041 0.0000 0.0000 0.0 0.0
7..4 0.000 144.2 47.8 0.4041 0.0000 0.0000 0.0 0.0
7..5 0.000 144.2 47.8 0.4041 0.0000 0.0000 0.0 0.0
7..6 0.000 144.2 47.8 0.4041 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 11): -249.399782 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 3.492002 0.000010 0.005000 1.350633 951.431826
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908314_1_1475_MLBR_RS06970: 0.000004, NC_002677_1_NP_301993_1_865_rpmI: 0.000004, NZ_LVXE01000004_1_WP_010908314_1_1790_A3216_RS03085: 0.000004, NZ_LYPH01000077_1_WP_010908314_1_2623_A8144_RS12635: 0.000004, NZ_CP029543_1_WP_010908314_1_1497_rpmI: 0.000004, NZ_AP014567_1_WP_010908314_1_1533_rpmI: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 3.49200
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.35063
(p1 = 0.99999) w = 951.43183
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 951.43183
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 144.5 47.5 951.4223 0.0000 0.0000 0.0 0.0
7..2 0.000 144.5 47.5 951.4223 0.0000 0.0000 0.0 0.0
7..3 0.000 144.5 47.5 951.4223 0.0000 0.0000 0.0 0.0
7..4 0.000 144.5 47.5 951.4223 0.0000 0.0000 0.0 0.0
7..5 0.000 144.5 47.5 951.4223 0.0000 0.0000 0.0 0.0
7..6 0.000 144.5 47.5 951.4223 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908314_1_1475_MLBR_RS06970)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.422
2 P 1.000** 951.422
3 K 1.000** 951.422
4 A 1.000** 951.422
5 K 1.000** 951.422
6 T 1.000** 951.422
7 H 1.000** 951.422
8 S 1.000** 951.422
9 G 1.000** 951.422
10 A 1.000** 951.422
11 S 1.000** 951.422
12 K 1.000** 951.422
13 R 1.000** 951.422
14 F 1.000** 951.422
15 R 1.000** 951.422
16 R 1.000** 951.422
17 T 1.000** 951.422
18 G 1.000** 951.422
19 T 1.000** 951.422
20 G 1.000** 951.422
21 K 1.000** 951.422
22 I 1.000** 951.422
23 V 1.000** 951.422
24 R 1.000** 951.422
25 Q 1.000** 951.422
26 K 1.000** 951.422
27 A 1.000** 951.422
28 N 1.000** 951.422
29 R 1.000** 951.422
30 R 1.000** 951.422
31 H 1.000** 951.422
32 L 1.000** 951.422
33 F 1.000** 951.422
34 E 1.000** 951.422
35 H 1.000** 951.422
36 K 1.000** 951.422
37 P 1.000** 951.422
38 S 1.000** 951.422
39 T 1.000** 951.422
40 R 1.000** 951.422
41 T 1.000** 951.422
42 R 1.000** 951.422
43 R 1.000** 951.422
44 L 1.000** 951.422
45 D 1.000** 951.422
46 G 1.000** 951.422
47 H 1.000** 951.422
48 T 1.000** 951.422
49 R 1.000** 951.422
50 V 1.000** 951.422
51 S 1.000** 951.422
52 A 1.000** 951.422
53 N 1.000** 951.422
54 D 1.000** 951.422
55 T 1.000** 951.422
56 Q 1.000** 951.422
57 R 1.000** 951.422
58 V 1.000** 951.422
59 N 1.000** 951.422
60 S 1.000** 951.422
61 L 1.000** 951.422
62 L 1.000** 951.422
63 N 1.000** 951.422
64 G 1.000** 951.422
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908314_1_1475_MLBR_RS06970)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:19
Model 1: NearlyNeutral -249.399801 Model 2: PositiveSelection -249.399752 Model 0: one-ratio -249.39975 Model 7: beta -249.399832 Model 8: beta&w>1 -249.399782 Model 0 vs 1 1.0199999996984843E-4 Model 2 vs 1 9.799999997994746E-5 Model 8 vs 7 1.0000000003174137E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
