--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:12:05 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpsA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1980.39         -1983.97
2      -1980.41         -1984.56
--------------------------------------
TOTAL    -1980.40         -1984.31
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpsA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.904721    0.089304    0.359617    1.471244    0.870815   1295.69   1349.47    1.000
r(A<->C){all}   0.186730    0.023420    0.000269    0.493878    0.146250     93.79    165.20    1.002
r(A<->G){all}   0.163059    0.019405    0.000023    0.437438    0.126024    180.99    210.00    1.004
r(A<->T){all}   0.168516    0.019996    0.000066    0.456065    0.133391    173.57    191.91    1.002
r(C<->G){all}   0.172066    0.020052    0.000263    0.453694    0.135875    156.89    160.96    1.008
r(C<->T){all}   0.156296    0.017969    0.000001    0.424138    0.117616    234.27    241.38    1.008
r(G<->T){all}   0.153333    0.018021    0.000013    0.419888    0.115919    237.11    293.41    1.000
pi(A){all}      0.227368    0.000119    0.205915    0.248461    0.227271   1211.09   1231.07    1.000
pi(C){all}      0.267350    0.000134    0.246177    0.291144    0.267178   1271.98   1342.58    1.000
pi(G){all}      0.310255    0.000144    0.286346    0.332166    0.310372   1345.41   1357.28    1.000
pi(T){all}      0.195027    0.000106    0.174243    0.214811    0.194655   1367.80   1402.78    1.000
alpha{1,2}      0.423599    0.227731    0.000471    1.427641    0.261927   1053.76   1247.06    1.000
alpha{3}        0.454737    0.234431    0.000159    1.413153    0.292067   1356.31   1428.65    1.000
pinvar{all}     0.999005    0.000001    0.996677    0.999998    0.999388   1150.52   1222.41    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1870.819262
Model 2: PositiveSelection	-1870.819261
Model 0: one-ratio	-1870.820296
Model 7: beta	-1870.819261
Model 8: beta&w>1	-1870.819262


Model 0 vs 1	0.00206800000023577

Model 2 vs 1	1.99999976757681E-6

Model 8 vs 7	1.99999976757681E-6
>C1
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
>C2
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
>C3
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
>C4
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
>C5
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
>C6
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=481 

C1              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
C2              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
C3              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
C4              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
C5              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
C6              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
                **************************************************

C1              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
C2              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
C3              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
C4              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
C5              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
C6              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
                **************************************************

C1              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
C2              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
C3              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
C4              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
C5              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
C6              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
                **************************************************

C1              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
C2              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
C3              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
C4              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
C5              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
C6              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
                **************************************************

C1              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
C2              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
C3              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
C4              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
C5              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
C6              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
                **************************************************

C1              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
C2              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
C3              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
C4              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
C5              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
C6              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
                **************************************************

C1              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
C2              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
C3              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
C4              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
C5              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
C6              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
                **************************************************

C1              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
C2              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
C3              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
C4              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
C5              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
C6              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
                **************************************************

C1              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
C2              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
C3              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
C4              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
C5              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
C6              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
                **************************************************

C1              ASSTPSAKATGGSLASDAQLAALREKLAGSA
C2              ASSTPSAKATGGSLASDAQLAALREKLAGSA
C3              ASSTPSAKATGGSLASDAQLAALREKLAGSA
C4              ASSTPSAKATGGSLASDAQLAALREKLAGSA
C5              ASSTPSAKATGGSLASDAQLAALREKLAGSA
C6              ASSTPSAKATGGSLASDAQLAALREKLAGSA
                *******************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  481 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  481 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14430]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [14430]--->[14430]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.555 Mb, Max= 31.077 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
C2              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
C3              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
C4              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
C5              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
C6              MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
                **************************************************

C1              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
C2              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
C3              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
C4              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
C5              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
C6              VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
                **************************************************

C1              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
C2              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
C3              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
C4              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
C5              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
C6              ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
                **************************************************

C1              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
C2              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
C3              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
C4              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
C5              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
C6              SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
                **************************************************

C1              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
C2              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
C3              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
C4              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
C5              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
C6              EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
                **************************************************

C1              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
C2              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
C3              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
C4              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
C5              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
C6              VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
                **************************************************

C1              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
C2              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
C3              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
C4              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
C5              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
C6              VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
                **************************************************

C1              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
C2              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
C3              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
C4              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
C5              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
C6              IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
                **************************************************

C1              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
C2              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
C3              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
C4              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
C5              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
C6              NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
                **************************************************

C1              ASSTPSAKATGGSLASDAQLAALREKLAGSA
C2              ASSTPSAKATGGSLASDAQLAALREKLAGSA
C3              ASSTPSAKATGGSLASDAQLAALREKLAGSA
C4              ASSTPSAKATGGSLASDAQLAALREKLAGSA
C5              ASSTPSAKATGGSLASDAQLAALREKLAGSA
C6              ASSTPSAKATGGSLASDAQLAALREKLAGSA
                *******************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
C2              ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
C3              ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
C4              ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
C5              ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
C6              ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
                **************************************************

C1              CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
C2              CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
C3              CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
C4              CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
C5              CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
C6              CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
                **************************************************

C1              ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
C2              ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
C3              ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
C4              ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
C5              ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
C6              ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
                **************************************************

C1              GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
C2              GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
C3              GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
C4              GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
C5              GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
C6              GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
                **************************************************

C1              ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
C2              ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
C3              ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
C4              ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
C5              ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
C6              ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
                **************************************************

C1              ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
C2              ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
C3              ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
C4              ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
C5              ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
C6              ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
                **************************************************

C1              ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
C2              ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
C3              ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
C4              ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
C5              ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
C6              ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
                **************************************************

C1              GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
C2              GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
C3              GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
C4              GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
C5              GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
C6              GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
                **************************************************

C1              TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
C2              TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
C3              TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
C4              TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
C5              TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
C6              TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
                **************************************************

C1              TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
C2              TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
C3              TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
C4              TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
C5              TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
C6              TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
                **************************************************

C1              GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
C2              GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
C3              GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
C4              GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
C5              GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
C6              GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
                **************************************************

C1              TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
C2              TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
C3              TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
C4              TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
C5              TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
C6              TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
                **************************************************

C1              GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
C2              GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
C3              GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
C4              GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
C5              GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
C6              GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
                **************************************************

C1              GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
C2              GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
C3              GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
C4              GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
C5              GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
C6              GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
                **************************************************

C1              TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
C2              TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
C3              TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
C4              TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
C5              TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
C6              TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
                **************************************************

C1              GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
C2              GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
C3              GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
C4              GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
C5              GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
C6              GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
                **************************************************

C1              GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
C2              GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
C3              GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
C4              GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
C5              GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
C6              GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
                **************************************************

C1              GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
C2              GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
C3              GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
C4              GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
C5              GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
C6              GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
                **************************************************

C1              GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
C2              GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
C3              GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
C4              GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
C5              GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
C6              GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
                **************************************************

C1              CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
C2              CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
C3              CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
C4              CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
C5              CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
C6              CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
                **************************************************

C1              CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
C2              CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
C3              CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
C4              CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
C5              CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
C6              CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
                **************************************************

C1              ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
C2              ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
C3              ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
C4              ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
C5              ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
C6              ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
                **************************************************

C1              GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
C2              GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
C3              GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
C4              GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
C5              GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
C6              GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
                **************************************************

C1              ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
C2              ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
C3              ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
C4              ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
C5              ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
C6              ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
                **************************************************

C1              AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
C2              AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
C3              AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
C4              AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
C5              AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
C6              AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
                **************************************************

C1              TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
C2              TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
C3              TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
C4              TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
C5              TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
C6              TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
                **************************************************

C1              AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
C2              AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
C3              AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
C4              AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
C5              AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
C6              AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
                **************************************************

C1              GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
C2              GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
C3              GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
C4              GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
C5              GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
C6              GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
                **************************************************

C1              TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
C2              TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
C3              TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
C4              TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
C5              TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
C6              TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
                *******************************************



>C1
ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
>C2
ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
>C3
ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
>C4
ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
>C5
ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
>C6
ATGTCAATTCCCGCCGTCCCCTCGCCCCAAATAGCCGTCAATGACGTAGG
CTCCAGCGAGGACTTTCTTGCCGCAATAGACAAAACGATCAAGTACTTTA
ACGATGGCGACATCGTCGAAGGCACCATCGTTAAAGTGGACCGGGACGAG
GTGCTCCTTGACATCGGATACAAGACCGAAGGGGTAATTCCCGCCCGCGA
ACTCTCCATCAAACACGACGTCGACCCCAATGAGGTCGTTTCTGTGGGCG
ACGAGGTGGAGGCTCTGGTACTTACCAAAGAGGACAAAGAGGGGCGGCTC
ATCCTGTCCAAGAAGCGTGCGCAGTACGAGCGCGCGTGGGGCACCATCGA
GGCACTTAAGGAGAAGGATGAGGCTGTCAAGGGCATCGTCATCGAGGTGG
TCAAGGGCGGTCTGATCCTCGATATCGGGTTGCGTGGCTTCCTACCTGCC
TCGTTGGTGGAGATGCGCCGTGTTCGCGATCTGCAACCGTACATCGGCAA
GGAGATCGAGGCCAAGATCATCGAGCTAGACAAAAACCGCAACAACGTGG
TATTATCGCGGCGGGCTTGGCTGGAACAGACCCAATCCGAGGTGCGCAGT
GAATTCCTCAATCAGCTGCAGAAGGGTGCTATACGCAAGGGTGTAGTATC
GTCCATCGTAAACTTTGGTGCGTTTGTCGATCTGGGCGGTGTAGACGGTT
TGGTGCACGTCTCCGAACTGTCCTGGAAGCACATCGACCATCCGTCCGAG
GTGGTCCAGGTGGGGAATGAAGTTACCGTCGAGGTTCTCGACGTTGATAT
GGACCGCGAGCGGGTTTCGTTGTCTCTCAAAGCAACTCAGGAAGACCCGT
GGCGGCATTTTGCCCGCACCCACGCCATCGGGCAAATCGTGCCAGGTAAG
GTGACCAAGTTGGTTCCGTTTGGTGCCTTCGTTCGTGTTGAGGAAGGCAT
CGAAGGTCTGGTGCACATCTCGGAGCTGGCCGAACGGCACGTCGAGGTGC
CTGACCAGGTGGTTGCTGTCGGCGACGATGCGATGGTCAAAGTCATTGAC
ATCGACTTGGAGCGACGCCGGATTTCGCTGTCGTTGAAGCAGGCCAACGA
GGACTACATCGAGGAGTTCGACCCGGCAAAGTACGGTATGGCCGACAGCT
ACGACGAGCAGGGCAACTACATCTTCCCTGAGGGCTTTGATCCCGACTCC
AACGAGTGGCTAGAGGGTTTTGACACCCAGCGCGCCGAATGGGAGGCCCG
TTACGCTGAAGCCGAACGTCGCTACAAGATGCACACCATCCAAATGGAGA
AGTTCGCTGCAACCGAGGAGGCCGGACACGGCAGTAGCGAGCAGCCCCCG
GCCAGCAGTACACCTTCGGCGAAGGCCACGGGTGGGTCGCTGGCTAGCGA
TGCCCAACTAGCAGCTTTACGGGAAAAGCTCGCCGGCAGCGCA
>C1
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
>C2
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
>C3
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
>C4
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
>C5
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA
>C6
MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGIVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGNEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYIEEFDPAKYGMADSYDEQGNYIFPEGFDPDS
NEWLEGFDTQRAEWEARYAEAERRYKMHTIQMEKFAATEEAGHGSSEQPP
ASSTPSAKATGGSLASDAQLAALREKLAGSA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpsA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1443 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579792234
      Setting output file names to "/data/11res/rpsA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1291057582
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0195113651
      Seed = 1651736038
      Swapseed = 1579792234
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3229.503179 -- -24.965149
         Chain 2 -- -3229.503179 -- -24.965149
         Chain 3 -- -3229.502994 -- -24.965149
         Chain 4 -- -3229.503179 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3229.502994 -- -24.965149
         Chain 2 -- -3229.503179 -- -24.965149
         Chain 3 -- -3229.503179 -- -24.965149
         Chain 4 -- -3229.503179 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3229.503] (-3229.503) (-3229.503) (-3229.503) * [-3229.503] (-3229.503) (-3229.503) (-3229.503) 
        500 -- [-2002.032] (-1998.794) (-1998.401) (-2020.224) * [-1987.802] (-2000.463) (-1995.359) (-2007.698) -- 0:00:00
       1000 -- (-1986.857) (-1992.745) [-1990.298] (-1997.699) * (-1987.501) [-1987.023] (-1986.327) (-1992.301) -- 0:00:00
       1500 -- (-1990.966) (-1990.654) (-1988.551) [-2000.198] * (-1990.159) (-1987.281) [-1989.101] (-1992.368) -- 0:00:00
       2000 -- (-1994.699) [-1995.163] (-1991.224) (-1992.488) * (-1987.792) [-1985.961] (-1992.161) (-1995.112) -- 0:00:00
       2500 -- (-1998.985) (-1984.782) (-1985.352) [-1987.484] * [-1994.034] (-1994.064) (-1990.999) (-1992.029) -- 0:00:00
       3000 -- (-1998.822) [-1990.176] (-1988.417) (-1985.686) * (-1985.251) (-1989.157) (-1999.544) [-1984.925] -- 0:00:00
       3500 -- (-1996.233) [-1988.981] (-1990.840) (-1988.791) * (-1986.503) (-1987.421) [-1989.901] (-1984.634) -- 0:00:00
       4000 -- (-1989.518) (-1988.953) (-1989.690) [-1987.473] * (-1987.929) (-1995.921) [-1998.505] (-1987.212) -- 0:00:00
       4500 -- (-1993.816) [-1989.218] (-1995.775) (-1992.226) * (-1995.383) (-1999.791) (-1986.646) [-1990.061] -- 0:00:00
       5000 -- (-1993.250) (-1995.256) [-1986.542] (-1991.544) * [-1996.027] (-1987.858) (-1994.309) (-1989.681) -- 0:00:00

      Average standard deviation of split frequencies: 0.054656

       5500 -- (-1986.925) (-1990.980) (-1989.818) [-1983.534] * (-1996.347) (-1989.812) (-1988.685) [-1985.727] -- 0:00:00
       6000 -- [-1990.530] (-1991.841) (-1989.264) (-1992.792) * (-1989.846) (-1997.775) (-1983.264) [-1989.582] -- 0:00:00
       6500 -- [-1987.287] (-1991.426) (-1989.509) (-1992.673) * (-1993.269) [-1991.162] (-2002.664) (-1989.310) -- 0:00:00
       7000 -- (-1990.725) [-1992.421] (-1992.441) (-1994.235) * [-1986.607] (-1993.283) (-1990.867) (-2006.391) -- 0:00:00
       7500 -- (-1989.739) [-1991.677] (-1989.372) (-1987.817) * (-1994.797) (-1989.551) (-1989.400) [-1993.239] -- 0:00:00
       8000 -- (-1985.534) (-1986.179) [-1984.972] (-1989.404) * (-1992.020) (-1996.653) [-1986.838] (-1988.803) -- 0:00:00
       8500 -- (-1983.252) [-1995.904] (-1991.817) (-1994.230) * (-1986.454) (-1989.353) [-1989.568] (-1984.826) -- 0:00:00
       9000 -- (-1989.929) (-1993.237) [-1984.869] (-1996.442) * (-1989.779) [-1987.430] (-1988.407) (-1986.478) -- 0:00:00
       9500 -- (-1992.106) (-1992.437) (-1997.058) [-1990.834] * (-1988.429) [-1990.196] (-1992.827) (-1986.207) -- 0:00:00
      10000 -- (-1987.436) [-1989.279] (-1988.864) (-1994.216) * [-1986.145] (-1991.321) (-1994.821) (-1986.114) -- 0:00:00

      Average standard deviation of split frequencies: 0.055824

      10500 -- (-1998.990) (-1989.399) (-1995.046) [-1996.469] * (-1987.876) (-1985.037) (-1990.359) [-1988.842] -- 0:00:00
      11000 -- [-1986.069] (-1991.942) (-1989.295) (-1985.662) * [-1984.044] (-1996.837) (-1994.797) (-1992.650) -- 0:00:00
      11500 -- [-1989.864] (-1991.805) (-2001.012) (-1989.072) * [-1988.453] (-1993.444) (-1993.391) (-1991.171) -- 0:00:00
      12000 -- (-1993.130) (-1992.478) (-1997.518) [-1984.289] * (-1987.090) (-1989.947) (-1991.582) [-1989.970] -- 0:01:22
      12500 -- [-1993.809] (-1989.688) (-1996.563) (-1986.808) * (-1997.487) [-1991.329] (-2002.799) (-1993.255) -- 0:01:19
      13000 -- (-1993.315) (-1988.316) (-1992.311) [-1989.873] * (-1999.427) (-1996.605) [-1995.057] (-1991.553) -- 0:01:15
      13500 -- [-1985.396] (-1987.952) (-1991.764) (-1993.159) * (-1992.426) (-1989.008) [-1990.504] (-1997.457) -- 0:01:13
      14000 -- (-1993.561) (-1991.692) [-1986.228] (-1990.133) * (-1989.820) [-1994.147] (-1993.777) (-1989.731) -- 0:01:10
      14500 -- (-1990.446) (-1987.644) [-1990.765] (-1993.135) * (-1994.675) (-1999.570) [-1987.839] (-1988.353) -- 0:01:07
      15000 -- (-1989.146) (-1997.159) (-1989.149) [-1987.408] * [-1995.280] (-1991.219) (-1990.827) (-1990.409) -- 0:01:05

      Average standard deviation of split frequencies: 0.076931

      15500 -- [-1985.433] (-1986.938) (-1988.766) (-1990.030) * (-1996.228) (-1994.724) (-1993.188) [-1989.184] -- 0:01:03
      16000 -- [-1988.201] (-1996.489) (-1991.512) (-1988.470) * (-1988.913) (-1992.888) [-1989.213] (-1992.424) -- 0:01:01
      16500 -- (-1994.235) (-1986.194) [-1992.794] (-1987.632) * (-1995.214) (-1988.860) [-1985.165] (-1990.093) -- 0:00:59
      17000 -- (-1990.959) (-1986.584) [-1987.959] (-1995.847) * (-1989.178) (-1990.713) [-1986.045] (-1994.375) -- 0:00:57
      17500 -- (-1988.437) (-1997.589) (-1994.490) [-1985.621] * [-1986.735] (-1991.307) (-1992.072) (-1991.525) -- 0:00:56
      18000 -- [-1987.514] (-1988.449) (-1999.200) (-1986.190) * (-1992.391) (-1990.515) (-1991.779) [-1988.903] -- 0:00:54
      18500 -- (-1991.092) [-1990.060] (-1988.866) (-1985.451) * (-1988.742) [-1988.226] (-1990.175) (-1994.320) -- 0:00:53
      19000 -- [-1990.977] (-1996.856) (-2000.321) (-1983.378) * (-1990.299) [-1990.877] (-1999.408) (-1990.964) -- 0:00:51
      19500 -- [-1983.429] (-1993.917) (-1993.792) (-1983.722) * (-1992.343) [-1996.178] (-1989.490) (-1993.288) -- 0:00:50
      20000 -- (-1995.139) (-1992.217) (-1991.164) [-1981.504] * (-1989.713) [-1992.277] (-1993.859) (-1987.826) -- 0:00:49

      Average standard deviation of split frequencies: 0.061302

      20500 -- [-1993.071] (-1994.415) (-1987.873) (-1979.672) * [-1992.481] (-1993.795) (-1997.117) (-1989.515) -- 0:00:47
      21000 -- (-1994.310) [-1983.377] (-1995.250) (-1979.626) * [-1988.940] (-2001.526) (-1992.526) (-1989.521) -- 0:00:46
      21500 -- (-1997.637) (-1989.586) (-1993.995) [-1979.575] * (-1995.613) (-1990.302) [-1987.881] (-1985.771) -- 0:00:45
      22000 -- (-1999.179) (-1991.684) (-1991.015) [-1979.574] * (-1987.284) (-1990.576) (-1986.437) [-1984.140] -- 0:00:44
      22500 -- (-1987.500) (-1998.591) [-1988.971] (-1981.019) * (-1992.713) [-1983.190] (-1991.750) (-1985.856) -- 0:00:43
      23000 -- (-1983.528) (-1990.532) (-1995.878) [-1983.102] * (-1990.713) [-1989.102] (-1991.455) (-1990.062) -- 0:00:42
      23500 -- (-1990.222) (-1995.060) [-1995.394] (-1980.790) * [-1988.099] (-1992.264) (-1995.226) (-1988.167) -- 0:00:41
      24000 -- (-1985.590) [-1985.803] (-1988.901) (-1985.377) * [-1985.664] (-1988.602) (-1987.283) (-1996.798) -- 0:00:40
      24500 -- (-1985.049) (-1981.341) (-1990.894) [-1981.314] * (-1991.932) (-1999.080) (-1993.287) [-1995.498] -- 0:00:39
      25000 -- (-1985.265) (-1981.455) (-1991.099) [-1983.694] * (-1984.674) (-1991.057) [-1990.856] (-1991.073) -- 0:00:39

      Average standard deviation of split frequencies: 0.054393

      25500 -- (-1988.183) [-1978.984] (-1987.154) (-1981.889) * (-1988.187) (-1993.109) (-1990.235) [-1988.228] -- 0:00:38
      26000 -- [-1985.977] (-1980.185) (-2011.092) (-1983.239) * (-1993.277) [-1990.809] (-1990.846) (-1990.780) -- 0:01:14
      26500 -- (-1994.918) (-1980.196) [-1987.533] (-1981.179) * (-1990.835) (-1991.646) [-1988.721] (-1992.488) -- 0:01:13
      27000 -- [-1990.929] (-1982.025) (-1985.586) (-1981.179) * (-1993.461) (-1990.318) [-1990.604] (-1990.218) -- 0:01:12
      27500 -- [-1988.530] (-1981.423) (-1986.646) (-1980.048) * (-1984.111) [-1988.441] (-1990.170) (-1995.980) -- 0:01:10
      28000 -- (-1986.378) (-1982.825) (-1984.085) [-1980.330] * (-1988.603) (-1991.713) [-1989.575] (-1987.599) -- 0:01:09
      28500 -- (-1996.333) [-1981.587] (-1986.014) (-1980.067) * (-1992.288) [-1986.877] (-1982.060) (-1987.435) -- 0:01:08
      29000 -- [-1993.375] (-1981.613) (-1983.704) (-1979.705) * (-1992.637) (-1991.186) (-1992.455) [-1991.988] -- 0:01:06
      29500 -- (-1987.247) (-1980.638) (-1983.218) [-1979.943] * (-1988.192) [-1993.027] (-1990.177) (-1998.306) -- 0:01:05
      30000 -- (-1990.566) (-1982.620) (-1982.115) [-1982.486] * [-1989.374] (-1982.621) (-1993.433) (-1992.658) -- 0:01:04

      Average standard deviation of split frequencies: 0.046884

      30500 -- [-1986.833] (-1980.790) (-1980.716) (-1984.183) * (-1988.049) (-1984.841) [-1987.811] (-1991.634) -- 0:01:03
      31000 -- [-1984.907] (-1981.527) (-1980.752) (-1984.208) * (-1991.379) (-1990.456) [-1988.397] (-1992.431) -- 0:01:02
      31500 -- [-1988.278] (-1981.320) (-1981.068) (-1984.592) * (-2004.687) [-1988.328] (-1986.837) (-1989.953) -- 0:01:01
      32000 -- [-1982.890] (-1982.323) (-1982.099) (-1980.689) * (-1986.889) [-1986.338] (-1997.427) (-1985.913) -- 0:01:00
      32500 -- (-1999.285) [-1980.038] (-1981.762) (-1981.191) * (-1984.863) (-1991.356) (-1990.585) [-1987.320] -- 0:00:59
      33000 -- (-1991.166) [-1979.963] (-1983.509) (-1981.174) * (-1990.929) (-1987.467) [-1990.124] (-1989.666) -- 0:00:58
      33500 -- (-1986.293) (-1979.979) (-1983.942) [-1981.680] * (-1990.853) (-1989.593) (-1984.684) [-1992.115] -- 0:00:57
      34000 -- [-1994.115] (-1979.790) (-1981.738) (-1983.185) * (-1990.619) (-1992.172) (-1990.994) [-1987.630] -- 0:00:56
      34500 -- [-1988.737] (-1982.197) (-1981.619) (-1985.649) * [-1985.589] (-1989.548) (-1991.830) (-1995.972) -- 0:00:55
      35000 -- [-1988.742] (-1986.294) (-1983.033) (-1981.915) * (-1992.666) (-1987.095) (-1997.707) [-1988.758] -- 0:00:55

      Average standard deviation of split frequencies: 0.048637

      35500 -- [-1989.130] (-1984.656) (-1982.060) (-1986.050) * [-1990.562] (-1989.686) (-1991.411) (-1995.863) -- 0:00:54
      36000 -- (-1984.121) [-1981.235] (-1981.114) (-1981.598) * (-1991.261) [-1990.079] (-1986.192) (-1999.173) -- 0:00:53
      36500 -- [-1988.399] (-1980.135) (-1980.968) (-1980.238) * (-1987.877) (-1991.843) [-1987.973] (-1991.532) -- 0:00:52
      37000 -- [-1994.074] (-1979.933) (-1981.997) (-1979.662) * [-1994.943] (-1987.545) (-1989.410) (-1982.873) -- 0:00:52
      37500 -- (-1989.888) [-1980.476] (-1985.021) (-1979.999) * (-1995.253) (-1993.911) [-1991.878] (-1981.053) -- 0:00:51
      38000 -- (-1995.028) [-1982.010] (-1982.316) (-1980.429) * (-1988.385) (-1993.123) [-1986.442] (-1979.465) -- 0:00:50
      38500 -- (-1988.774) [-1980.904] (-1982.862) (-1979.931) * (-1989.322) (-1991.324) [-1984.694] (-1979.144) -- 0:00:49
      39000 -- (-1991.047) (-1980.900) [-1984.437] (-1984.293) * (-1988.478) (-1993.525) (-1991.301) [-1981.028] -- 0:00:49
      39500 -- (-1986.512) [-1979.897] (-1987.616) (-1982.287) * [-1986.411] (-2000.511) (-1992.798) (-1980.763) -- 0:00:48
      40000 -- (-1988.403) [-1984.916] (-1980.860) (-1980.644) * (-1986.867) (-2000.303) [-1990.926] (-1980.926) -- 0:00:48

      Average standard deviation of split frequencies: 0.041151

      40500 -- (-1987.141) (-1979.937) [-1980.861] (-1980.652) * (-1988.846) (-1985.350) (-2000.775) [-1979.862] -- 0:00:47
      41000 -- (-1993.318) [-1980.662] (-1982.302) (-1982.876) * (-1999.241) (-1987.519) [-1993.683] (-1983.848) -- 0:01:10
      41500 -- (-1994.854) (-1980.586) (-1981.399) [-1982.168] * (-1993.221) (-1991.673) [-1993.435] (-1982.317) -- 0:01:09
      42000 -- (-1985.001) (-1979.947) (-1980.133) [-1979.953] * (-1987.993) (-1988.504) [-1988.637] (-1980.692) -- 0:01:08
      42500 -- (-1998.408) [-1981.080] (-1979.437) (-1980.446) * [-1988.369] (-1994.111) (-1985.277) (-1982.231) -- 0:01:07
      43000 -- [-1987.611] (-1980.572) (-1982.428) (-1979.720) * [-1988.428] (-1983.903) (-1993.081) (-1979.232) -- 0:01:06
      43500 -- (-1992.485) [-1980.410] (-1979.445) (-1982.637) * (-2005.312) (-1990.882) [-1989.688] (-1979.763) -- 0:01:05
      44000 -- (-1991.309) (-1979.828) [-1979.098] (-1980.774) * (-2009.164) (-1993.066) [-1988.821] (-1979.582) -- 0:01:05
      44500 -- (-2002.287) [-1981.388] (-1979.307) (-1982.860) * (-1981.781) [-1984.019] (-1990.767) (-1979.384) -- 0:01:04
      45000 -- (-1992.067) (-1980.439) (-1979.350) [-1980.834] * (-1981.870) (-1987.449) (-1992.122) [-1979.360] -- 0:01:03

      Average standard deviation of split frequencies: 0.035402

      45500 -- [-1990.875] (-1982.177) (-1979.928) (-1980.887) * (-1981.969) (-1985.268) [-1993.203] (-1981.126) -- 0:01:02
      46000 -- (-2000.543) (-1983.106) (-1982.334) [-1982.981] * (-1982.068) (-1985.949) (-1993.805) [-1980.840] -- 0:01:02
      46500 -- (-1988.566) (-1981.458) [-1982.959] (-1980.626) * (-1985.692) (-1989.995) [-1987.394] (-1981.652) -- 0:01:01
      47000 -- (-1995.861) [-1981.957] (-1981.345) (-1980.984) * (-1980.736) [-1990.716] (-1997.221) (-1980.623) -- 0:01:00
      47500 -- (-1989.008) (-1981.041) (-1982.390) [-1982.577] * (-1980.661) [-1990.692] (-1987.741) (-1979.970) -- 0:01:00
      48000 -- [-1995.017] (-1981.545) (-1981.460) (-1981.203) * (-1979.727) (-1991.154) [-1991.093] (-1982.930) -- 0:00:59
      48500 -- (-1991.901) [-1984.021] (-1981.083) (-1982.669) * (-1979.763) (-1991.161) [-1984.641] (-1983.046) -- 0:00:58
      49000 -- (-1987.210) (-1984.201) (-1982.026) [-1982.002] * (-1979.797) (-1998.297) [-1992.311] (-1983.153) -- 0:00:58
      49500 -- [-1990.222] (-1982.183) (-1981.264) (-1979.925) * [-1981.847] (-1988.360) (-1987.421) (-1982.429) -- 0:00:57
      50000 -- [-1986.988] (-1983.259) (-1982.793) (-1979.943) * (-1983.438) (-2005.383) [-1984.850] (-1982.613) -- 0:00:57

      Average standard deviation of split frequencies: 0.032319

      50500 -- (-1992.791) [-1985.307] (-1980.869) (-1982.214) * (-1981.771) (-1990.765) (-1991.595) [-1982.038] -- 0:00:56
      51000 -- [-1991.397] (-1982.346) (-1980.589) (-1980.874) * (-1979.236) [-1990.410] (-1988.630) (-1985.360) -- 0:00:55
      51500 -- (-1990.467) (-1980.035) [-1980.887] (-1980.207) * (-1981.256) (-1991.832) [-1993.647] (-1985.962) -- 0:00:55
      52000 -- [-1985.548] (-1980.089) (-1983.508) (-1981.306) * (-1980.925) [-1993.392] (-1998.789) (-1981.948) -- 0:00:54
      52500 -- (-1992.595) (-1981.965) (-1983.112) [-1980.670] * [-1980.249] (-1990.697) (-1992.238) (-1983.249) -- 0:00:54
      53000 -- (-1998.169) (-1981.985) [-1981.934] (-1980.839) * (-1982.959) (-1989.668) [-1987.740] (-1983.173) -- 0:00:53
      53500 -- (-1988.106) [-1983.090] (-1980.503) (-1981.078) * [-1980.723] (-2002.315) (-1998.791) (-1982.248) -- 0:00:53
      54000 -- (-1991.578) (-1980.763) (-1981.286) [-1979.483] * [-1981.726] (-1987.984) (-1987.254) (-1981.855) -- 0:00:52
      54500 -- (-1994.899) (-1980.676) (-1981.814) [-1979.433] * [-1981.651] (-1994.950) (-1989.924) (-1981.935) -- 0:00:52
      55000 -- (-1994.121) (-1980.676) (-1981.168) [-1981.433] * [-1980.333] (-1988.401) (-1996.616) (-1980.067) -- 0:00:51

      Average standard deviation of split frequencies: 0.030866

      55500 -- (-1986.851) (-1979.995) [-1981.186] (-1981.446) * [-1981.630] (-2004.748) (-1990.471) (-1980.307) -- 0:01:08
      56000 -- (-1989.293) [-1979.995] (-1980.089) (-1981.196) * (-1981.282) (-1997.743) [-1992.411] (-1978.942) -- 0:01:07
      56500 -- (-1993.655) (-1980.523) (-1980.723) [-1980.413] * (-1981.811) [-1990.666] (-1989.059) (-1979.889) -- 0:01:06
      57000 -- (-1987.673) (-1980.348) (-1980.866) [-1979.543] * (-1981.532) (-1994.019) [-1988.808] (-1980.127) -- 0:01:06
      57500 -- (-1988.046) (-1979.673) (-1980.698) [-1982.996] * (-1980.731) [-1988.542] (-1990.094) (-1978.838) -- 0:01:05
      58000 -- (-1993.612) (-1980.334) (-1979.518) [-1981.934] * (-1980.246) (-1989.219) (-1991.243) [-1978.838] -- 0:01:04
      58500 -- [-1987.183] (-1980.757) (-1980.966) (-1980.967) * (-1985.844) (-1985.613) [-1988.809] (-1979.202) -- 0:01:04
      59000 -- (-1991.968) (-1981.391) [-1980.861] (-1982.432) * (-1983.819) (-1992.490) (-1995.604) [-1978.896] -- 0:01:03
      59500 -- (-1990.753) (-1981.588) (-1980.902) [-1980.438] * [-1980.693] (-1993.044) (-1990.664) (-1979.392) -- 0:01:03
      60000 -- [-1992.303] (-1981.140) (-1982.264) (-1980.430) * (-1981.459) (-1989.985) (-1991.169) [-1980.798] -- 0:01:02

      Average standard deviation of split frequencies: 0.032717

      60500 -- (-1988.781) (-1980.621) [-1980.196] (-1981.156) * (-1981.007) (-1989.686) (-1988.614) [-1980.286] -- 0:01:02
      61000 -- [-1992.516] (-1984.186) (-1979.965) (-1980.641) * [-1979.695] (-1988.966) (-1990.679) (-1980.392) -- 0:01:01
      61500 -- (-1995.115) [-1980.900] (-1980.003) (-1981.110) * (-1979.210) (-1988.139) (-1991.133) [-1980.653] -- 0:01:01
      62000 -- (-1994.794) (-1981.208) [-1980.259] (-1980.460) * (-1979.214) [-1988.798] (-1989.440) (-1979.858) -- 0:01:00
      62500 -- (-1992.346) (-1981.227) (-1980.077) [-1979.856] * (-1981.231) (-1992.153) (-1991.302) [-1980.019] -- 0:01:00
      63000 -- (-1989.761) (-1981.548) (-1979.424) [-1980.526] * (-1981.664) (-1989.928) (-1991.907) [-1979.258] -- 0:00:59
      63500 -- (-1992.624) (-1983.532) [-1981.862] (-1980.523) * [-1981.009] (-1994.078) (-1995.999) (-1980.578) -- 0:00:58
      64000 -- (-1986.072) (-1982.084) [-1979.241] (-1981.334) * (-1980.717) (-1988.099) (-1985.026) [-1981.733] -- 0:00:58
      64500 -- (-1989.175) [-1981.904] (-1980.389) (-1982.092) * [-1981.594] (-1991.483) (-1995.671) (-1981.331) -- 0:00:58
      65000 -- (-1991.422) [-1981.878] (-1986.073) (-1982.597) * (-1980.874) (-1994.495) [-1991.748] (-1984.453) -- 0:00:57

      Average standard deviation of split frequencies: 0.029698

      65500 -- (-1989.801) [-1979.716] (-1984.040) (-1982.155) * (-1981.770) (-1994.696) [-1989.798] (-1979.869) -- 0:00:57
      66000 -- (-1989.282) (-1980.215) [-1983.087] (-1979.934) * (-1980.941) [-1991.997] (-1999.587) (-1979.213) -- 0:00:56
      66500 -- [-1989.843] (-1980.340) (-1980.641) (-1981.955) * (-1979.116) (-1997.067) (-1987.826) [-1979.839] -- 0:00:56
      67000 -- (-1990.323) [-1980.366] (-1981.284) (-1987.055) * (-1979.350) (-1989.938) [-1988.136] (-1980.096) -- 0:00:55
      67500 -- [-1991.886] (-1980.513) (-1984.400) (-1981.674) * (-1980.746) [-1985.887] (-1995.388) (-1981.967) -- 0:00:55
      68000 -- [-1986.778] (-1982.741) (-1984.620) (-1981.737) * (-1980.495) [-1993.119] (-1988.131) (-1980.581) -- 0:00:54
      68500 -- (-1986.474) (-1982.598) [-1981.627] (-1982.295) * (-1980.379) [-1992.748] (-1990.911) (-1981.018) -- 0:00:54
      69000 -- [-1984.874] (-1980.256) (-1981.805) (-1980.221) * (-1980.392) [-1986.802] (-1992.690) (-1981.294) -- 0:00:53
      69500 -- [-1988.210] (-1982.217) (-1981.280) (-1984.407) * [-1980.821] (-1980.385) (-1994.399) (-1983.154) -- 0:00:53
      70000 -- (-1992.275) (-1981.331) (-1979.637) [-1981.022] * (-1981.208) (-1981.745) (-1990.645) [-1982.106] -- 0:00:53

      Average standard deviation of split frequencies: 0.029018

      70500 -- (-1988.655) (-1980.649) (-1980.241) [-1979.084] * (-1980.261) [-1981.015] (-1985.896) (-1979.448) -- 0:01:05
      71000 -- (-1987.653) (-1985.090) (-1981.629) [-1986.345] * (-1980.073) (-1981.167) (-1985.761) [-1980.505] -- 0:01:05
      71500 -- (-1990.186) (-1982.896) [-1981.054] (-1979.637) * (-1981.190) (-1980.655) (-1987.887) [-1982.416] -- 0:01:04
      72000 -- [-1991.004] (-1982.116) (-1983.810) (-1978.946) * (-1986.463) (-1981.936) [-2000.695] (-1982.705) -- 0:01:04
      72500 -- (-1992.182) [-1983.184] (-1985.637) (-1979.137) * (-1981.230) (-1986.779) (-1988.458) [-1981.670] -- 0:01:03
      73000 -- [-1990.133] (-1983.719) (-1982.708) (-1982.372) * (-1981.747) [-1981.067] (-1995.741) (-1983.076) -- 0:01:03
      73500 -- (-1994.133) (-1981.046) [-1981.686] (-1983.612) * (-1980.908) (-1979.582) (-1996.358) [-1980.818] -- 0:01:03
      74000 -- (-1988.114) (-1980.800) (-1981.674) [-1983.414] * [-1980.913] (-1981.121) (-1995.413) (-1982.181) -- 0:01:02
      74500 -- (-1993.495) (-1980.799) (-1981.087) [-1982.047] * [-1981.167] (-1980.167) (-1992.998) (-1984.034) -- 0:01:02
      75000 -- (-1988.383) [-1982.033] (-1981.049) (-1981.401) * [-1979.362] (-1981.091) (-1999.975) (-1987.429) -- 0:01:01

      Average standard deviation of split frequencies: 0.033299

      75500 -- (-1991.661) (-1983.464) (-1981.544) [-1981.139] * [-1980.100] (-1981.110) (-2003.549) (-1985.807) -- 0:01:01
      76000 -- [-1984.831] (-1982.290) (-1980.015) (-1982.054) * (-1980.112) (-1981.323) (-1986.402) [-1981.355] -- 0:01:00
      76500 -- (-1989.735) (-1980.790) (-1981.133) [-1980.134] * (-1983.521) (-1985.486) (-1997.321) [-1981.278] -- 0:01:00
      77000 -- (-1992.880) (-1979.545) [-1980.753] (-1981.262) * [-1980.290] (-1986.062) (-1992.413) (-1980.411) -- 0:00:59
      77500 -- [-1994.009] (-1982.199) (-1980.802) (-1980.511) * (-1980.051) (-1984.933) [-1984.769] (-1979.649) -- 0:00:59
      78000 -- [-1989.718] (-1983.299) (-1982.287) (-1980.502) * (-1987.506) (-1981.615) (-1987.964) [-1982.193] -- 0:00:59
      78500 -- (-1992.370) (-1983.261) (-1982.244) [-1979.825] * (-1983.688) (-1984.674) (-1986.300) [-1982.162] -- 0:00:58
      79000 -- (-1998.590) [-1983.009] (-1981.023) (-1979.814) * (-1983.569) (-1981.871) [-1984.396] (-1981.681) -- 0:00:58
      79500 -- (-1996.435) [-1982.262] (-1981.241) (-1982.500) * (-1981.599) (-1982.570) (-1984.165) [-1981.591] -- 0:00:57
      80000 -- (-1985.151) (-1982.359) [-1983.773] (-1980.308) * (-1981.597) (-1979.580) (-1983.845) [-1981.602] -- 0:00:57

      Average standard deviation of split frequencies: 0.033765

      80500 -- (-1986.382) [-1980.303] (-1983.771) (-1979.394) * [-1980.322] (-1980.049) (-1980.580) (-1980.137) -- 0:00:57
      81000 -- (-1992.131) [-1981.282] (-1983.053) (-1979.808) * (-1980.576) (-1981.312) [-1980.379] (-1980.872) -- 0:00:56
      81500 -- (-2008.396) [-1980.264] (-1983.777) (-1979.470) * (-1981.389) [-1982.953] (-1980.625) (-1981.409) -- 0:00:56
      82000 -- (-1989.336) (-1983.029) [-1984.321] (-1979.119) * [-1979.502] (-1984.389) (-1980.400) (-1980.772) -- 0:00:55
      82500 -- (-1995.222) (-1979.584) (-1982.874) [-1981.576] * [-1980.162] (-1985.402) (-1979.854) (-1979.517) -- 0:00:55
      83000 -- (-1996.705) (-1981.376) [-1982.260] (-1979.928) * [-1980.943] (-1986.301) (-1979.651) (-1979.505) -- 0:00:55
      83500 -- [-1992.108] (-1981.345) (-1981.753) (-1983.863) * (-1985.068) (-1983.324) [-1979.943] (-1979.804) -- 0:00:54
      84000 -- [-1984.862] (-1979.274) (-1979.677) (-1983.214) * (-1982.021) (-1979.581) [-1979.469] (-1980.001) -- 0:00:54
      84500 -- (-1994.473) (-1980.559) [-1979.680] (-1983.126) * (-1980.332) [-1980.292] (-1983.538) (-1980.500) -- 0:00:54
      85000 -- (-1986.264) (-1979.674) [-1979.715] (-1979.839) * (-1981.065) (-1980.578) (-1982.107) [-1979.021] -- 0:00:53

      Average standard deviation of split frequencies: 0.030278

      85500 -- [-1987.393] (-1979.589) (-1979.760) (-1980.877) * (-1981.147) [-1981.240] (-1979.729) (-1979.542) -- 0:01:04
      86000 -- (-1988.939) [-1979.589] (-1979.806) (-1979.484) * (-1980.334) [-1980.709] (-1979.884) (-1981.400) -- 0:01:03
      86500 -- (-1988.097) (-1979.362) (-1983.495) [-1979.405] * (-1980.939) (-1981.707) [-1979.599] (-1980.668) -- 0:01:03
      87000 -- (-1985.870) (-1980.765) (-1979.469) [-1980.458] * (-1985.563) (-1980.777) (-1979.817) [-1983.271] -- 0:01:02
      87500 -- (-1991.709) (-1979.331) [-1979.428] (-1982.121) * (-1980.853) [-1980.069] (-1979.630) (-1982.705) -- 0:01:02
      88000 -- (-1987.631) [-1979.182] (-1979.436) (-1982.581) * (-1980.853) (-1979.515) [-1979.316] (-1980.388) -- 0:01:02
      88500 -- (-1998.351) [-1979.307] (-1980.351) (-1982.502) * (-1979.880) [-1981.087] (-1981.037) (-1982.564) -- 0:01:01
      89000 -- (-1990.261) (-1981.522) [-1980.408] (-1982.668) * (-1979.880) (-1981.698) (-1980.368) [-1983.899] -- 0:01:01
      89500 -- (-1986.834) (-1983.578) [-1979.106] (-1981.759) * (-1980.760) (-1982.545) (-1984.439) [-1979.590] -- 0:01:01
      90000 -- (-1987.112) (-1987.947) [-1980.494] (-1982.502) * (-1981.190) (-1979.106) (-1983.607) [-1980.505] -- 0:01:00

      Average standard deviation of split frequencies: 0.029280

      90500 -- (-1994.256) (-1985.567) (-1979.392) [-1982.603] * (-1979.047) [-1980.027] (-1980.614) (-1985.458) -- 0:01:00
      91000 -- (-1996.303) (-1986.005) [-1979.284] (-1981.617) * (-1978.941) [-1979.947] (-1980.394) (-1983.442) -- 0:00:59
      91500 -- [-1986.432] (-1983.968) (-1980.273) (-1980.168) * (-1980.174) (-1983.004) [-1980.604] (-1982.699) -- 0:00:59
      92000 -- [-1981.769] (-1987.871) (-1981.516) (-1978.943) * [-1980.785] (-1983.316) (-1982.525) (-1982.610) -- 0:00:59
      92500 -- (-1997.378) [-1985.003] (-1982.470) (-1979.480) * [-1979.713] (-1982.324) (-1981.075) (-1983.553) -- 0:00:58
      93000 -- (-1991.460) (-1981.191) (-1982.470) [-1979.562] * (-1978.957) (-1984.249) (-1979.927) [-1982.526] -- 0:00:58
      93500 -- [-1990.465] (-1981.540) (-1980.969) (-1980.955) * (-1979.519) (-1980.479) [-1981.126] (-1982.267) -- 0:00:58
      94000 -- (-1991.715) (-1980.373) (-1983.514) [-1980.392] * [-1981.318] (-1981.598) (-1981.611) (-1979.966) -- 0:00:57
      94500 -- (-1989.959) [-1980.731] (-1980.216) (-1982.262) * (-1979.487) (-1980.549) [-1980.092] (-1980.057) -- 0:00:57
      95000 -- (-1988.330) (-1979.946) (-1980.230) [-1979.168] * (-1979.644) [-1981.102] (-1980.092) (-1979.478) -- 0:00:57

      Average standard deviation of split frequencies: 0.031427

      95500 -- [-1985.339] (-1979.684) (-1983.293) (-1979.965) * (-1985.249) (-1979.976) (-1980.854) [-1981.323] -- 0:00:56
      96000 -- (-1985.759) [-1980.131] (-1981.845) (-1980.156) * (-1979.134) (-1979.702) (-1980.570) [-1982.868] -- 0:00:56
      96500 -- (-1989.108) [-1983.312] (-1982.860) (-1980.223) * (-1980.846) [-1981.369] (-1979.870) (-1984.358) -- 0:00:56
      97000 -- (-1989.972) [-1980.190] (-1981.270) (-1980.485) * (-1980.517) (-1981.569) (-1979.863) [-1981.740] -- 0:00:55
      97500 -- [-1989.974] (-1980.219) (-1980.009) (-1981.184) * (-1979.283) (-1981.278) (-1980.541) [-1981.230] -- 0:00:55
      98000 -- (-1988.053) [-1981.055] (-1980.197) (-1983.008) * [-1980.541] (-1979.922) (-1981.121) (-1980.525) -- 0:00:55
      98500 -- (-1992.341) (-1982.243) (-1981.768) [-1980.958] * (-1980.637) (-1980.400) (-1981.417) [-1980.669] -- 0:00:54
      99000 -- (-1989.711) (-1981.200) [-1980.781] (-1981.048) * (-1982.785) (-1981.681) [-1982.288] (-1983.162) -- 0:00:54
      99500 -- (-1990.871) (-1980.376) (-1986.595) [-1980.541] * (-1981.315) [-1980.637] (-1982.976) (-1979.941) -- 0:00:54
      100000 -- (-1986.711) (-1980.443) (-1983.974) [-1979.205] * (-1981.158) [-1984.604] (-1982.221) (-1980.721) -- 0:00:54

      Average standard deviation of split frequencies: 0.029918

      100500 -- (-1999.891) (-1979.876) (-1980.440) [-1980.072] * (-1981.224) (-1983.675) [-1981.436] (-1981.200) -- 0:01:02
      101000 -- [-1990.200] (-1979.466) (-1980.178) (-1982.381) * (-1983.095) (-1981.126) [-1981.044] (-1981.769) -- 0:01:02
      101500 -- (-1996.606) (-1982.397) (-1981.519) [-1981.446] * (-1981.961) (-1983.650) (-1982.161) [-1980.784] -- 0:01:01
      102000 -- (-1995.507) (-1984.122) [-1979.789] (-1979.770) * (-1980.012) [-1985.041] (-1984.262) (-1981.083) -- 0:01:01
      102500 -- (-1990.228) [-1983.984] (-1980.866) (-1984.432) * (-1981.552) (-1982.915) (-1982.341) [-1981.570] -- 0:01:01
      103000 -- (-1989.013) [-1981.993] (-1980.965) (-1981.951) * [-1983.135] (-1984.034) (-1983.290) (-1979.373) -- 0:01:00
      103500 -- [-1982.656] (-1981.943) (-1980.021) (-1981.322) * (-1983.126) [-1984.056] (-1982.659) (-1981.172) -- 0:01:00
      104000 -- (-1985.782) (-1982.783) (-1979.540) [-1979.810] * (-1981.052) (-1985.414) (-1981.002) [-1981.040] -- 0:01:00
      104500 -- [-1993.538] (-1979.561) (-1981.233) (-1982.238) * (-1985.591) (-1980.611) (-1980.990) [-1982.796] -- 0:00:59
      105000 -- [-1991.648] (-1980.586) (-1980.672) (-1986.109) * (-1985.263) [-1982.024] (-1982.487) (-1981.643) -- 0:00:59

      Average standard deviation of split frequencies: 0.026239

      105500 -- [-1994.801] (-1981.424) (-1979.982) (-1982.401) * [-1983.231] (-1981.480) (-1982.121) (-1982.640) -- 0:00:59
      106000 -- (-1988.034) [-1982.074] (-1982.705) (-1985.094) * (-1981.592) (-1981.527) [-1980.490] (-1982.535) -- 0:00:59
      106500 -- (-1985.963) [-1981.175] (-1980.482) (-1986.028) * (-1981.190) [-1982.849] (-1987.772) (-1980.718) -- 0:00:58
      107000 -- (-1987.719) (-1980.779) [-1981.452] (-1984.739) * (-1980.994) (-1981.843) (-1984.040) [-1981.012] -- 0:00:58
      107500 -- (-1984.071) [-1981.112] (-1982.893) (-1984.720) * (-1980.591) (-1982.724) (-1981.471) [-1979.815] -- 0:00:58
      108000 -- (-1982.137) (-1983.450) (-1979.882) [-1982.281] * [-1979.977] (-1979.422) (-1981.299) (-1981.008) -- 0:00:57
      108500 -- (-1979.499) (-1981.397) (-1980.558) [-1981.264] * (-1980.875) (-1979.498) [-1981.584] (-1980.564) -- 0:00:57
      109000 -- (-1980.805) (-1981.088) [-1980.168] (-1978.967) * [-1979.806] (-1982.506) (-1979.854) (-1980.564) -- 0:00:57
      109500 -- (-1984.887) (-1980.552) [-1981.971] (-1980.155) * (-1979.675) (-1982.264) [-1980.012] (-1981.109) -- 0:00:56
      110000 -- (-1982.461) (-1980.937) [-1980.259] (-1981.373) * (-1979.949) (-1984.507) (-1981.219) [-1981.813] -- 0:00:56

      Average standard deviation of split frequencies: 0.026410

      110500 -- (-1984.096) (-1980.937) [-1981.454] (-1979.276) * (-1980.774) [-1982.228] (-1980.670) (-1981.036) -- 0:00:56
      111000 -- (-1982.285) (-1981.958) (-1981.044) [-1981.342] * (-1980.176) [-1980.120] (-1980.730) (-1980.391) -- 0:00:56
      111500 -- (-1981.763) [-1981.823] (-1980.615) (-1979.090) * (-1981.244) [-1980.288] (-1980.830) (-1979.814) -- 0:00:55
      112000 -- [-1983.456] (-1984.926) (-1981.874) (-1979.090) * (-1983.443) (-1981.427) (-1981.365) [-1980.001] -- 0:00:55
      112500 -- (-1980.792) [-1981.081] (-1981.645) (-1979.244) * [-1981.580] (-1980.055) (-1981.815) (-1980.800) -- 0:00:55
      113000 -- [-1979.714] (-1986.676) (-1983.342) (-1979.905) * (-1981.869) (-1979.930) (-1983.589) [-1979.856] -- 0:00:54
      113500 -- (-1979.937) [-1979.480] (-1982.129) (-1982.357) * (-1981.347) (-1981.898) (-1981.377) [-1983.571] -- 0:00:54
      114000 -- (-1980.038) (-1980.611) (-1982.451) [-1981.350] * (-1980.589) (-1981.352) (-1980.804) [-1982.720] -- 0:00:54
      114500 -- [-1978.876] (-1980.157) (-1980.914) (-1980.604) * [-1983.883] (-1979.664) (-1984.046) (-1982.135) -- 0:00:54
      115000 -- [-1978.834] (-1980.236) (-1981.412) (-1982.854) * (-1984.822) (-1984.649) [-1983.434] (-1983.514) -- 0:00:53

      Average standard deviation of split frequencies: 0.025880

      115500 -- (-1979.265) (-1982.023) (-1979.891) [-1983.838] * (-1984.098) (-1986.494) [-1981.526] (-1981.111) -- 0:01:01
      116000 -- [-1979.218] (-1982.183) (-1979.770) (-1979.838) * (-1982.514) [-1987.885] (-1982.794) (-1980.727) -- 0:01:00
      116500 -- [-1981.725] (-1983.715) (-1980.402) (-1983.021) * (-1982.512) (-1978.867) (-1981.936) [-1981.679] -- 0:01:00
      117000 -- [-1980.952] (-1983.431) (-1980.158) (-1979.756) * (-1984.055) (-1979.588) [-1980.820] (-1984.085) -- 0:01:00
      117500 -- [-1980.699] (-1979.496) (-1981.837) (-1981.274) * (-1985.915) (-1980.481) (-1979.919) [-1980.292] -- 0:01:00
      118000 -- (-1980.778) [-1982.808] (-1979.857) (-1979.864) * (-1983.211) [-1981.126] (-1980.622) (-1980.709) -- 0:00:59
      118500 -- (-1980.815) [-1981.805] (-1981.409) (-1980.527) * [-1984.412] (-1982.458) (-1981.957) (-1979.556) -- 0:00:59
      119000 -- (-1982.050) (-1979.839) [-1981.888] (-1980.265) * (-1984.070) (-1986.846) [-1981.585] (-1979.528) -- 0:00:59
      119500 -- (-1981.836) [-1980.752] (-1981.787) (-1979.868) * (-1983.987) (-1985.931) [-1981.004] (-1979.811) -- 0:00:58
      120000 -- (-1981.988) (-1981.253) [-1979.733] (-1981.847) * [-1980.493] (-1981.076) (-1981.023) (-1981.051) -- 0:00:58

      Average standard deviation of split frequencies: 0.024807

      120500 -- [-1980.010] (-1981.351) (-1980.463) (-1981.474) * (-1979.756) (-1980.936) [-1983.934] (-1984.097) -- 0:00:58
      121000 -- (-1982.225) [-1981.696] (-1981.713) (-1979.285) * (-1981.385) [-1979.611] (-1982.529) (-1981.424) -- 0:00:58
      121500 -- [-1980.431] (-1984.192) (-1981.807) (-1979.309) * (-1980.594) (-1980.863) (-1981.880) [-1983.756] -- 0:00:57
      122000 -- (-1984.356) [-1984.936] (-1980.933) (-1979.674) * (-1980.069) (-1981.678) [-1981.444] (-1981.468) -- 0:00:57
      122500 -- (-1979.668) (-1983.109) (-1979.763) [-1980.317] * (-1980.872) (-1982.541) [-1979.861] (-1980.258) -- 0:00:57
      123000 -- (-1981.141) (-1985.579) (-1980.047) [-1980.316] * (-1980.408) (-1982.453) (-1979.340) [-1981.053] -- 0:00:57
      123500 -- (-1980.127) [-1982.813] (-1980.032) (-1980.146) * (-1983.997) [-1982.645] (-1981.300) (-1980.974) -- 0:00:56
      124000 -- (-1984.763) (-1983.018) (-1979.821) [-1979.783] * (-1981.757) (-1982.645) (-1980.371) [-1980.525] -- 0:00:56
      124500 -- (-1984.271) (-1982.155) [-1979.822] (-1981.153) * (-1984.506) [-1980.739] (-1980.572) (-1982.395) -- 0:00:56
      125000 -- (-1983.706) [-1981.877] (-1981.028) (-1981.720) * (-1984.789) (-1981.464) [-1980.739] (-1986.438) -- 0:00:56

      Average standard deviation of split frequencies: 0.024880

      125500 -- (-1980.607) (-1981.339) [-1981.729] (-1980.032) * [-1983.966] (-1981.972) (-1980.143) (-1984.081) -- 0:00:55
      126000 -- (-1982.980) [-1984.172] (-1983.570) (-1980.079) * (-1985.224) (-1982.982) (-1980.081) [-1981.126] -- 0:00:55
      126500 -- (-1982.970) (-1985.247) (-1979.601) [-1980.034] * (-1979.576) (-1983.266) (-1983.238) [-1982.011] -- 0:00:55
      127000 -- (-1983.699) [-1983.874] (-1981.065) (-1980.048) * (-1980.810) [-1980.761] (-1982.503) (-1981.035) -- 0:00:54
      127500 -- (-1983.773) (-1982.671) [-1980.631] (-1979.925) * (-1980.940) [-1980.342] (-1982.480) (-1979.125) -- 0:00:54
      128000 -- (-1980.155) (-1985.225) (-1983.647) [-1982.468] * (-1979.209) (-1979.188) [-1981.167] (-1980.706) -- 0:00:54
      128500 -- [-1980.155] (-1984.171) (-1979.684) (-1979.357) * [-1979.524] (-1979.196) (-1981.914) (-1981.130) -- 0:00:54
      129000 -- [-1979.368] (-1985.778) (-1982.856) (-1980.127) * (-1980.490) [-1981.277] (-1981.829) (-1979.815) -- 0:00:54
      129500 -- [-1979.212] (-1982.167) (-1983.731) (-1980.420) * (-1979.276) [-1981.627] (-1980.851) (-1981.199) -- 0:00:53
      130000 -- (-1984.464) (-1980.819) [-1979.921] (-1980.221) * (-1979.505) [-1980.824] (-1982.416) (-1980.486) -- 0:00:53

      Average standard deviation of split frequencies: 0.022677

      130500 -- (-1980.465) [-1981.728] (-1981.250) (-1979.675) * [-1978.837] (-1981.145) (-1979.626) (-1982.233) -- 0:00:59
      131000 -- [-1980.630] (-1981.607) (-1981.012) (-1981.529) * (-1979.433) (-1979.653) [-1979.932] (-1983.540) -- 0:00:59
      131500 -- (-1980.426) (-1981.025) (-1982.118) [-1980.313] * (-1980.330) [-1981.087] (-1979.651) (-1979.906) -- 0:00:59
      132000 -- [-1985.872] (-1981.024) (-1980.967) (-1979.115) * (-1980.275) (-1980.512) (-1978.914) [-1982.779] -- 0:00:59
      132500 -- (-1981.641) [-1981.354] (-1981.075) (-1980.609) * [-1979.724] (-1981.712) (-1985.108) (-1982.930) -- 0:00:58
      133000 -- [-1981.146] (-1984.789) (-1982.373) (-1980.618) * (-1979.890) [-1981.323] (-1981.321) (-1983.232) -- 0:00:58
      133500 -- (-1979.794) (-1985.629) [-1980.289] (-1981.419) * (-1984.979) (-1983.456) (-1982.140) [-1979.299] -- 0:00:58
      134000 -- [-1979.447] (-1985.609) (-1980.498) (-1984.884) * (-1982.424) [-1981.163] (-1982.310) (-1979.578) -- 0:00:58
      134500 -- [-1979.459] (-1984.242) (-1980.536) (-1980.380) * (-1983.290) (-1982.505) (-1979.925) [-1979.557] -- 0:00:57
      135000 -- [-1979.943] (-1982.181) (-1981.028) (-1981.269) * (-1980.028) [-1980.789] (-1979.299) (-1979.543) -- 0:00:57

      Average standard deviation of split frequencies: 0.022877

      135500 -- (-1979.335) (-1981.011) (-1980.732) [-1979.593] * [-1980.451] (-1981.700) (-1984.664) (-1981.700) -- 0:00:57
      136000 -- (-1982.347) (-1981.277) (-1983.117) [-1979.593] * (-1983.137) (-1981.611) (-1981.686) [-1980.510] -- 0:00:57
      136500 -- (-1980.748) (-1981.233) [-1982.100] (-1984.058) * (-1982.682) [-1981.611] (-1983.035) (-1979.271) -- 0:00:56
      137000 -- (-1980.589) (-1980.103) [-1980.053] (-1984.417) * [-1980.005] (-1981.302) (-1983.477) (-1979.880) -- 0:00:56
      137500 -- [-1979.842] (-1983.793) (-1981.557) (-1983.016) * (-1979.919) (-1979.179) (-1980.573) [-1981.963] -- 0:00:56
      138000 -- [-1981.406] (-1984.340) (-1983.747) (-1982.323) * (-1981.036) (-1982.033) [-1986.683] (-1979.948) -- 0:00:56
      138500 -- (-1980.253) (-1982.175) [-1980.285] (-1987.108) * (-1980.166) (-1983.554) [-1982.297] (-1980.066) -- 0:00:55
      139000 -- (-1981.140) (-1981.432) [-1979.590] (-1987.987) * [-1980.717] (-1982.047) (-1980.577) (-1979.322) -- 0:00:55
      139500 -- [-1980.496] (-1981.432) (-1979.603) (-1981.379) * (-1980.603) [-1982.583] (-1980.718) (-1982.748) -- 0:00:55
      140000 -- (-1983.092) (-1987.414) [-1980.724] (-1982.761) * [-1980.444] (-1981.862) (-1983.161) (-1985.772) -- 0:00:55

      Average standard deviation of split frequencies: 0.023459

      140500 -- [-1981.435] (-1982.736) (-1982.401) (-1981.568) * [-1979.817] (-1982.552) (-1983.132) (-1985.436) -- 0:00:55
      141000 -- (-1981.049) (-1981.441) [-1980.468] (-1980.225) * [-1979.845] (-1980.672) (-1981.554) (-1985.587) -- 0:00:54
      141500 -- (-1986.544) (-1980.996) [-1980.569] (-1980.640) * (-1979.823) (-1980.778) [-1980.809] (-1980.221) -- 0:00:54
      142000 -- [-1980.130] (-1980.958) (-1983.566) (-1981.615) * (-1980.335) (-1980.764) (-1982.711) [-1980.590] -- 0:00:54
      142500 -- (-1981.209) (-1980.840) [-1980.938] (-1982.237) * (-1984.842) (-1980.347) (-1982.649) [-1980.635] -- 0:00:54
      143000 -- (-1982.016) [-1979.724] (-1983.476) (-1983.442) * (-1981.209) [-1982.920] (-1980.038) (-1979.552) -- 0:00:53
      143500 -- [-1981.592] (-1979.494) (-1983.495) (-1986.841) * (-1981.209) (-1982.155) [-1980.205] (-1979.979) -- 0:00:53
      144000 -- (-1981.209) [-1981.021] (-1982.098) (-1987.240) * (-1980.493) [-1981.109] (-1980.510) (-1985.175) -- 0:00:53
      144500 -- (-1979.659) [-1980.069] (-1982.207) (-1983.797) * [-1982.178] (-1979.757) (-1981.931) (-1987.741) -- 0:00:53
      145000 -- (-1979.610) (-1980.070) (-1982.242) [-1983.454] * (-1979.350) (-1981.175) (-1982.204) [-1980.470] -- 0:00:53

      Average standard deviation of split frequencies: 0.021242

      145500 -- (-1981.289) (-1980.406) [-1981.930] (-1983.141) * (-1982.182) (-1982.005) [-1979.612] (-1981.253) -- 0:00:58
      146000 -- (-1979.046) (-1986.972) [-1982.866] (-1982.047) * (-1986.742) (-1982.245) (-1981.613) [-1980.065] -- 0:00:58
      146500 -- [-1979.737] (-1983.865) (-1983.460) (-1982.054) * (-1987.241) (-1980.290) (-1980.015) [-1980.764] -- 0:00:58
      147000 -- (-1980.227) [-1980.904] (-1980.300) (-1982.158) * (-1985.733) (-1979.947) [-1981.724] (-1980.000) -- 0:00:58
      147500 -- [-1979.598] (-1982.158) (-1981.222) (-1984.728) * (-1983.133) (-1981.632) (-1983.867) [-1979.380] -- 0:00:57
      148000 -- [-1979.847] (-1980.455) (-1980.950) (-1981.823) * [-1981.653] (-1981.168) (-1980.019) (-1979.302) -- 0:00:57
      148500 -- [-1980.398] (-1982.154) (-1980.931) (-1982.794) * (-1982.122) (-1983.738) (-1979.923) [-1979.335] -- 0:00:57
      149000 -- [-1980.853] (-1983.601) (-1980.484) (-1984.514) * [-1984.373] (-1982.059) (-1980.728) (-1979.385) -- 0:00:57
      149500 -- (-1983.404) (-1983.310) (-1981.118) [-1982.580] * [-1979.615] (-1981.775) (-1982.641) (-1983.280) -- 0:00:56
      150000 -- (-1982.905) [-1980.856] (-1981.547) (-1981.153) * (-1980.013) (-1981.287) (-1983.575) [-1982.177] -- 0:00:56

      Average standard deviation of split frequencies: 0.022840

      150500 -- (-1984.291) [-1980.360] (-1982.849) (-1982.069) * (-1980.123) [-1984.337] (-1983.529) (-1984.241) -- 0:00:56
      151000 -- [-1980.769] (-1982.077) (-1983.847) (-1980.780) * [-1979.977] (-1981.408) (-1981.382) (-1985.227) -- 0:00:56
      151500 -- (-1980.962) [-1987.689] (-1983.847) (-1980.749) * (-1978.949) (-1982.706) [-1982.295] (-1984.286) -- 0:00:56
      152000 -- (-1979.505) (-1982.301) (-1980.506) [-1981.163] * (-1979.207) (-1980.852) (-1980.548) [-1982.085] -- 0:00:55
      152500 -- (-1990.539) (-1981.740) [-1980.695] (-1981.351) * (-1979.299) (-1979.429) (-1981.274) [-1980.483] -- 0:00:55
      153000 -- (-1987.245) [-1981.622] (-1980.694) (-1982.121) * (-1980.316) [-1980.007] (-1981.339) (-1981.117) -- 0:00:55
      153500 -- [-1979.777] (-1985.964) (-1981.105) (-1980.582) * [-1980.677] (-1985.271) (-1981.622) (-1980.603) -- 0:00:55
      154000 -- [-1979.795] (-1983.030) (-1982.960) (-1980.882) * [-1979.299] (-1988.534) (-1983.654) (-1981.097) -- 0:00:54
      154500 -- (-1979.248) [-1981.367] (-1981.680) (-1980.465) * (-1980.264) [-1982.383] (-1984.047) (-1984.319) -- 0:00:54
      155000 -- (-1979.377) (-1981.356) (-1980.901) [-1980.114] * (-1979.760) (-1982.594) [-1983.469] (-1985.523) -- 0:00:54

      Average standard deviation of split frequencies: 0.025232

      155500 -- (-1984.678) [-1981.523] (-1983.068) (-1980.268) * (-1979.015) [-1982.597] (-1980.386) (-1983.673) -- 0:00:54
      156000 -- (-1985.056) [-1983.508] (-1981.626) (-1979.711) * (-1979.014) (-1982.627) (-1979.463) [-1981.426] -- 0:00:54
      156500 -- (-1984.472) (-1982.110) (-1981.484) [-1979.772] * [-1979.021] (-1984.074) (-1980.273) (-1982.493) -- 0:00:53
      157000 -- [-1982.585] (-1980.270) (-1984.381) (-1979.742) * (-1979.022) (-1983.094) (-1981.829) [-1980.593] -- 0:00:53
      157500 -- (-1979.517) (-1982.326) (-1982.151) [-1979.605] * [-1978.904] (-1980.018) (-1980.952) (-1980.406) -- 0:00:53
      158000 -- [-1980.044] (-1980.903) (-1981.181) (-1980.161) * (-1980.818) (-1980.792) [-1980.583] (-1982.130) -- 0:00:53
      158500 -- (-1979.028) [-1980.996] (-1980.651) (-1983.268) * [-1978.917] (-1981.048) (-1982.428) (-1981.269) -- 0:00:53
      159000 -- (-1979.030) (-1981.995) [-1979.789] (-1983.091) * (-1982.265) (-1982.719) (-1980.247) [-1981.928] -- 0:00:52
      159500 -- (-1979.471) (-1982.271) (-1979.563) [-1982.231] * [-1979.264] (-1982.054) (-1983.020) (-1982.355) -- 0:00:52
      160000 -- [-1979.544] (-1980.547) (-1979.437) (-1985.499) * (-1981.264) [-1981.294] (-1984.674) (-1982.967) -- 0:00:57

      Average standard deviation of split frequencies: 0.023619

      160500 -- (-1980.317) (-1981.300) [-1979.423] (-1983.067) * [-1978.908] (-1979.684) (-1982.046) (-1983.372) -- 0:00:57
      161000 -- [-1979.266] (-1981.725) (-1980.819) (-1981.542) * (-1979.970) [-1979.844] (-1981.962) (-1979.823) -- 0:00:57
      161500 -- (-1979.286) (-1980.290) (-1981.703) [-1981.540] * (-1979.410) [-1979.835] (-1980.325) (-1979.850) -- 0:00:57
      162000 -- [-1979.380] (-1980.405) (-1985.643) (-1981.712) * (-1980.565) (-1980.824) (-1980.560) [-1979.857] -- 0:00:56
      162500 -- [-1979.342] (-1982.753) (-1983.876) (-1982.156) * (-1981.371) (-1979.493) (-1980.498) [-1979.066] -- 0:00:56
      163000 -- (-1980.403) (-1979.422) (-1983.649) [-1982.311] * (-1979.640) [-1980.347] (-1980.713) (-1980.330) -- 0:00:56
      163500 -- (-1980.262) (-1979.601) [-1983.381] (-1979.930) * (-1982.490) (-1981.039) (-1981.394) [-1980.720] -- 0:00:56
      164000 -- (-1980.263) (-1980.905) (-1982.327) [-1981.351] * (-1982.209) (-1980.040) (-1979.454) [-1979.741] -- 0:00:56
      164500 -- [-1981.240] (-1980.235) (-1982.400) (-1979.869) * [-1980.267] (-1981.143) (-1979.951) (-1979.634) -- 0:00:55
      165000 -- (-1979.123) (-1980.897) (-1984.521) [-1979.863] * (-1981.546) (-1987.797) [-1980.392] (-1984.298) -- 0:00:55

      Average standard deviation of split frequencies: 0.020588

      165500 -- (-1981.161) (-1980.916) [-1981.252] (-1981.852) * (-1979.685) (-1981.550) (-1982.049) [-1985.411] -- 0:00:55
      166000 -- (-1985.413) [-1979.192] (-1981.390) (-1979.826) * (-1982.346) [-1984.410] (-1983.774) (-1980.166) -- 0:00:55
      166500 -- [-1986.636] (-1981.235) (-1981.987) (-1980.910) * (-1983.723) (-1982.329) [-1983.075] (-1979.621) -- 0:00:55
      167000 -- (-1981.091) [-1979.804] (-1982.578) (-1980.111) * (-1980.883) (-1985.235) [-1982.518] (-1979.629) -- 0:00:54
      167500 -- [-1980.797] (-1979.804) (-1980.304) (-1980.534) * [-1981.568] (-1983.408) (-1981.389) (-1981.588) -- 0:00:54
      168000 -- (-1983.862) (-1979.837) (-1979.703) [-1981.331] * (-1986.168) (-1983.570) [-1980.552] (-1981.677) -- 0:00:54
      168500 -- (-1981.351) (-1979.839) [-1980.265] (-1978.847) * (-1982.093) [-1984.275] (-1981.357) (-1983.639) -- 0:00:54
      169000 -- (-1982.435) (-1979.895) [-1980.480] (-1984.729) * (-1980.776) (-1983.207) [-1979.820] (-1981.804) -- 0:00:54
      169500 -- [-1979.801] (-1980.482) (-1981.779) (-1979.464) * (-1982.573) (-1984.007) [-1980.472] (-1982.579) -- 0:00:53
      170000 -- (-1983.729) [-1980.000] (-1982.728) (-1979.076) * [-1982.573] (-1986.332) (-1979.482) (-1982.286) -- 0:00:53

      Average standard deviation of split frequencies: 0.018172

      170500 -- (-1980.350) (-1982.440) (-1979.851) [-1979.079] * (-1981.898) [-1983.633] (-1979.140) (-1981.599) -- 0:00:53
      171000 -- (-1980.092) (-1980.577) [-1979.875] (-1979.958) * (-1979.705) (-1981.052) [-1979.928] (-1979.344) -- 0:00:53
      171500 -- (-1980.694) (-1982.245) (-1981.280) [-1980.228] * (-1980.472) (-1981.586) (-1981.477) [-1979.344] -- 0:00:53
      172000 -- (-1980.963) (-1982.460) [-1982.849] (-1982.954) * (-1980.372) (-1981.372) [-1981.027] (-1981.219) -- 0:00:52
      172500 -- (-1980.143) (-1983.664) (-1983.233) [-1983.078] * (-1980.105) (-1983.215) [-1980.078] (-1983.897) -- 0:00:52
      173000 -- (-1984.154) [-1983.895] (-1989.708) (-1982.162) * (-1980.091) [-1981.711] (-1980.793) (-1983.358) -- 0:00:52
      173500 -- (-1982.279) [-1981.714] (-1979.241) (-1981.577) * (-1980.194) (-1984.476) [-1980.792] (-1980.917) -- 0:00:52
      174000 -- (-1981.769) (-1981.030) [-1980.289] (-1984.166) * (-1980.322) (-1984.022) (-1980.424) [-1981.444] -- 0:00:52
      174500 -- (-1982.216) [-1981.495] (-1979.508) (-1982.941) * (-1981.582) (-1980.913) (-1980.415) [-1980.556] -- 0:00:52
      175000 -- (-1981.879) (-1981.173) [-1979.895] (-1982.721) * (-1979.764) [-1982.068] (-1979.911) (-1980.634) -- 0:00:56

      Average standard deviation of split frequencies: 0.017707

      175500 -- (-1981.858) [-1980.927] (-1979.108) (-1983.617) * (-1980.209) (-1980.478) [-1980.166] (-1980.198) -- 0:00:56
      176000 -- (-1980.470) (-1981.309) (-1980.484) [-1981.478] * (-1981.106) (-1982.002) [-1980.755] (-1981.218) -- 0:00:56
      176500 -- (-1982.871) (-1979.605) [-1982.221] (-1980.361) * (-1981.023) [-1980.672] (-1980.262) (-1982.999) -- 0:00:55
      177000 -- [-1982.550] (-1979.490) (-1980.174) (-1980.036) * (-1981.725) [-1982.864] (-1980.948) (-1983.513) -- 0:00:55
      177500 -- (-1983.927) [-1980.423] (-1981.920) (-1980.802) * (-1981.139) (-1980.994) (-1981.015) [-1980.498] -- 0:00:55
      178000 -- (-1983.255) (-1979.888) [-1980.174] (-1980.829) * (-1981.168) [-1979.739] (-1981.234) (-1979.617) -- 0:00:55
      178500 -- [-1980.799] (-1982.050) (-1979.889) (-1981.437) * (-1980.314) [-1981.460] (-1980.031) (-1979.507) -- 0:00:55
      179000 -- (-1981.684) (-1980.138) [-1979.508] (-1982.201) * [-1980.406] (-1980.628) (-1979.345) (-1982.335) -- 0:00:55
      179500 -- (-1979.047) (-1984.110) (-1979.455) [-1981.495] * [-1986.008] (-1979.467) (-1979.630) (-1981.406) -- 0:00:54
      180000 -- [-1979.088] (-1980.182) (-1979.556) (-1981.745) * (-1985.533) [-1979.758] (-1980.928) (-1981.209) -- 0:00:54

      Average standard deviation of split frequencies: 0.018700

      180500 -- [-1979.189] (-1983.722) (-1982.648) (-1979.850) * (-1983.963) [-1979.860] (-1979.116) (-1979.954) -- 0:00:54
      181000 -- [-1982.084] (-1980.914) (-1980.473) (-1980.033) * (-1981.821) [-1981.639] (-1979.121) (-1980.223) -- 0:00:54
      181500 -- (-1980.102) (-1982.372) (-1980.158) [-1980.454] * (-1980.840) (-1982.871) [-1979.123] (-1980.805) -- 0:00:54
      182000 -- [-1981.661] (-1979.979) (-1980.819) (-1979.311) * (-1979.754) [-1981.845] (-1979.766) (-1983.460) -- 0:00:53
      182500 -- (-1982.943) (-1982.251) (-1979.620) [-1982.113] * (-1979.531) (-1981.455) (-1980.633) [-1982.060] -- 0:00:53
      183000 -- (-1982.389) [-1982.153] (-1980.336) (-1981.733) * [-1980.249] (-1983.908) (-1988.931) (-1981.772) -- 0:00:53
      183500 -- [-1979.588] (-1981.337) (-1982.171) (-1981.438) * (-1986.370) (-1981.334) (-1980.714) [-1981.403] -- 0:00:53
      184000 -- (-1980.528) (-1980.792) [-1980.363] (-1982.462) * (-1980.827) (-1980.533) (-1981.243) [-1980.210] -- 0:00:53
      184500 -- (-1980.224) (-1981.845) [-1981.521] (-1982.119) * (-1979.541) [-1982.092] (-1983.424) (-1982.782) -- 0:00:53
      185000 -- [-1979.865] (-1981.375) (-1980.074) (-1983.683) * [-1980.231] (-1980.495) (-1983.681) (-1986.281) -- 0:00:52

      Average standard deviation of split frequencies: 0.019431

      185500 -- (-1984.409) (-1982.955) [-1979.993] (-1984.442) * [-1980.245] (-1980.108) (-1980.402) (-1984.262) -- 0:00:52
      186000 -- (-1982.329) (-1984.463) [-1982.560] (-1982.922) * (-1980.289) [-1979.540] (-1979.331) (-1985.971) -- 0:00:52
      186500 -- [-1983.372] (-1983.941) (-1979.816) (-1984.250) * (-1981.704) (-1980.197) (-1980.003) [-1983.788] -- 0:00:52
      187000 -- [-1984.297] (-1983.714) (-1980.448) (-1981.964) * [-1979.386] (-1980.273) (-1980.285) (-1979.882) -- 0:00:52
      187500 -- (-1982.749) (-1982.260) [-1980.246] (-1982.024) * (-1979.381) [-1981.668] (-1980.165) (-1979.972) -- 0:00:52
      188000 -- (-1983.920) [-1982.225] (-1980.997) (-1983.526) * (-1979.461) [-1982.051] (-1980.243) (-1981.998) -- 0:00:51
      188500 -- (-1983.910) (-1981.317) [-1981.738] (-1982.029) * (-1979.618) [-1983.507] (-1980.109) (-1980.215) -- 0:00:51
      189000 -- (-1980.795) (-1984.250) [-1980.614] (-1981.546) * [-1980.466] (-1983.187) (-1980.862) (-1981.684) -- 0:00:51
      189500 -- (-1980.406) [-1984.638] (-1980.357) (-1984.140) * [-1979.694] (-1982.625) (-1980.073) (-1985.055) -- 0:00:51
      190000 -- [-1979.955] (-1981.065) (-1985.844) (-1981.319) * (-1980.678) (-1987.707) [-1979.643] (-1983.537) -- 0:00:55

      Average standard deviation of split frequencies: 0.018818

      190500 -- (-1983.287) (-1979.659) [-1980.058] (-1980.738) * (-1979.656) (-1980.497) (-1981.528) [-1982.421] -- 0:00:55
      191000 -- (-1981.589) (-1981.423) (-1980.133) [-1982.645] * (-1983.516) [-1979.227] (-1979.423) (-1988.786) -- 0:00:55
      191500 -- [-1979.231] (-1980.556) (-1983.769) (-1981.919) * [-1982.441] (-1979.278) (-1979.707) (-1991.047) -- 0:00:54
      192000 -- (-1979.612) (-1979.631) [-1980.361] (-1982.149) * (-1983.629) (-1981.011) [-1984.219] (-1981.413) -- 0:00:54
      192500 -- [-1980.598] (-1980.687) (-1983.698) (-1979.901) * (-1980.133) [-1981.823] (-1982.339) (-1980.572) -- 0:00:54
      193000 -- (-1979.862) [-1980.713] (-1980.790) (-1980.777) * [-1979.578] (-1985.396) (-1982.278) (-1980.188) -- 0:00:54
      193500 -- (-1980.517) (-1982.937) [-1984.368] (-1981.275) * [-1979.450] (-1985.191) (-1981.321) (-1980.907) -- 0:00:54
      194000 -- (-1981.162) (-1983.935) [-1983.134] (-1979.917) * (-1982.633) (-1982.474) [-1980.785] (-1981.014) -- 0:00:54
      194500 -- (-1980.458) (-1980.105) [-1983.612] (-1979.269) * (-1983.011) (-1983.176) [-1980.700] (-1982.054) -- 0:00:53
      195000 -- (-1980.554) (-1980.236) (-1985.712) [-1979.181] * (-1983.765) (-1980.095) [-1980.348] (-1983.400) -- 0:00:53

      Average standard deviation of split frequencies: 0.018573

      195500 -- [-1979.680] (-1981.091) (-1982.375) (-1979.297) * [-1985.010] (-1981.099) (-1980.812) (-1981.006) -- 0:00:53
      196000 -- (-1980.135) (-1982.592) (-1980.123) [-1979.317] * (-1982.576) (-1986.762) [-1981.530] (-1980.038) -- 0:00:53
      196500 -- (-1979.571) (-1982.690) (-1981.058) [-1979.341] * [-1986.106] (-1983.302) (-1980.510) (-1985.588) -- 0:00:53
      197000 -- (-1984.951) (-1981.336) [-1979.235] (-1981.536) * [-1981.464] (-1980.977) (-1980.300) (-1986.372) -- 0:00:52
      197500 -- (-1981.426) [-1980.507] (-1984.005) (-1981.749) * (-1980.364) [-1980.678] (-1982.926) (-1981.133) -- 0:00:52
      198000 -- [-1980.992] (-1983.318) (-1979.750) (-1984.779) * (-1981.955) (-1981.494) [-1982.292] (-1982.163) -- 0:00:52
      198500 -- (-1983.191) [-1979.385] (-1979.962) (-1981.185) * (-1981.115) [-1979.916] (-1980.209) (-1984.971) -- 0:00:52
      199000 -- (-1985.187) [-1979.380] (-1980.851) (-1979.833) * [-1981.763] (-1981.420) (-1981.720) (-1983.960) -- 0:00:52
      199500 -- (-1984.920) [-1981.634] (-1981.718) (-1980.180) * (-1982.102) [-1981.963] (-1980.558) (-1979.921) -- 0:00:52
      200000 -- (-1980.517) (-1980.170) (-1980.080) [-1980.625] * (-1984.185) (-1982.331) (-1980.558) [-1984.400] -- 0:00:51

      Average standard deviation of split frequencies: 0.018379

      200500 -- [-1980.948] (-1980.960) (-1979.038) (-1980.896) * (-1982.040) (-1978.878) (-1980.061) [-1981.024] -- 0:00:51
      201000 -- (-1981.685) (-1981.442) (-1982.906) [-1981.848] * (-1981.978) [-1986.585] (-1979.958) (-1980.491) -- 0:00:51
      201500 -- (-1979.523) (-1982.366) (-1981.141) [-1982.034] * (-1982.311) (-1983.304) [-1979.148] (-1981.258) -- 0:00:51
      202000 -- (-1979.883) (-1983.847) (-1981.000) [-1981.683] * [-1981.805] (-1982.879) (-1980.019) (-1980.181) -- 0:00:51
      202500 -- (-1980.614) [-1983.562] (-1986.372) (-1981.488) * (-1982.242) (-1980.637) (-1979.868) [-1982.115] -- 0:00:51
      203000 -- (-1980.528) (-1981.508) [-1986.356] (-1980.071) * (-1983.754) (-1979.621) (-1980.232) [-1981.356] -- 0:00:51
      203500 -- (-1980.468) (-1984.211) (-1981.579) [-1980.104] * [-1985.232] (-1980.751) (-1979.452) (-1982.426) -- 0:00:50
      204000 -- [-1979.705] (-1984.791) (-1980.979) (-1980.924) * (-1983.319) [-1986.013] (-1980.224) (-1981.133) -- 0:00:50
      204500 -- (-1980.249) [-1980.845] (-1979.851) (-1981.355) * (-1982.869) (-1985.998) (-1981.450) [-1981.801] -- 0:00:50
      205000 -- (-1980.259) (-1983.174) (-1980.721) [-1981.428] * [-1982.657] (-1984.818) (-1982.541) (-1983.968) -- 0:00:50

      Average standard deviation of split frequencies: 0.018561

      205500 -- (-1981.392) (-1986.126) (-1980.104) [-1981.573] * [-1982.294] (-1982.054) (-1980.456) (-1981.589) -- 0:00:54
      206000 -- (-1981.410) [-1982.539] (-1980.035) (-1981.801) * [-1982.728] (-1982.408) (-1981.783) (-1984.483) -- 0:00:53
      206500 -- (-1980.080) (-1983.095) (-1980.921) [-1987.635] * [-1982.665] (-1983.509) (-1982.649) (-1984.631) -- 0:00:53
      207000 -- [-1983.399] (-1983.301) (-1980.856) (-1982.313) * (-1985.985) (-1982.777) [-1983.077] (-1982.211) -- 0:00:53
      207500 -- (-1979.886) (-1983.040) (-1981.869) [-1979.153] * (-1985.418) [-1982.664] (-1983.045) (-1982.669) -- 0:00:53
      208000 -- (-1979.924) [-1983.759] (-1984.107) (-1978.973) * (-1986.086) (-1983.204) (-1984.807) [-1979.927] -- 0:00:53
      208500 -- [-1979.728] (-1980.519) (-1982.618) (-1982.320) * (-1986.012) (-1984.196) (-1982.792) [-1979.298] -- 0:00:53
      209000 -- [-1979.893] (-1983.062) (-1985.372) (-1981.826) * (-1984.739) (-1980.158) [-1981.322] (-1979.705) -- 0:00:52
      209500 -- (-1979.955) (-1983.135) (-1981.279) [-1981.505] * [-1983.526] (-1979.462) (-1985.153) (-1979.678) -- 0:00:52
      210000 -- [-1979.520] (-1981.012) (-1980.546) (-1980.556) * (-1984.214) (-1981.321) [-1982.420] (-1979.044) -- 0:00:52

      Average standard deviation of split frequencies: 0.016907

      210500 -- (-1979.791) [-1979.425] (-1981.029) (-1980.104) * (-1982.596) [-1981.023] (-1982.496) (-1980.111) -- 0:00:52
      211000 -- (-1979.759) (-1980.260) (-1981.280) [-1978.884] * (-1980.098) (-1980.312) (-1979.548) [-1980.421] -- 0:00:52
      211500 -- (-1979.730) (-1981.895) [-1980.822] (-1979.835) * (-1979.173) (-1980.071) [-1978.769] (-1979.802) -- 0:00:52
      212000 -- (-1980.682) (-1981.949) (-1980.890) [-1980.177] * (-1983.497) [-1984.595] (-1979.143) (-1980.095) -- 0:00:52
      212500 -- (-1980.600) [-1980.430] (-1981.589) (-1982.349) * [-1981.686] (-1982.071) (-1979.847) (-1980.410) -- 0:00:51
      213000 -- (-1980.779) [-1981.151] (-1982.400) (-1982.266) * (-1981.480) [-1980.895] (-1979.834) (-1981.552) -- 0:00:51
      213500 -- (-1982.075) (-1982.402) (-1982.848) [-1979.982] * (-1981.467) [-1981.850] (-1980.354) (-1982.037) -- 0:00:51
      214000 -- [-1982.425] (-1983.313) (-1981.485) (-1980.827) * (-1979.423) (-1982.591) [-1979.454] (-1980.650) -- 0:00:51
      214500 -- (-1983.318) (-1982.815) [-1980.556] (-1983.477) * (-1980.105) (-1982.403) [-1982.801] (-1979.750) -- 0:00:51
      215000 -- (-1987.073) [-1979.882] (-1980.720) (-1981.841) * [-1982.599] (-1980.144) (-1981.952) (-1979.340) -- 0:00:51

      Average standard deviation of split frequencies: 0.016304

      215500 -- (-1983.887) (-1979.373) [-1982.527] (-1981.940) * (-1983.044) (-1982.259) (-1981.604) [-1980.390] -- 0:00:50
      216000 -- (-1979.526) (-1981.823) (-1981.035) [-1980.498] * (-1979.721) (-1979.952) [-1981.274] (-1979.207) -- 0:00:50
      216500 -- (-1979.526) [-1980.968] (-1978.837) (-1980.896) * (-1980.086) [-1979.072] (-1980.811) (-1979.344) -- 0:00:50
      217000 -- (-1981.302) (-1981.575) [-1980.409] (-1980.495) * (-1981.897) (-1979.200) [-1982.557] (-1979.833) -- 0:00:50
      217500 -- (-1980.539) (-1981.885) [-1980.934] (-1980.926) * (-1986.119) (-1980.909) (-1981.110) [-1981.221] -- 0:00:50
      218000 -- (-1980.433) [-1982.233] (-1982.809) (-1980.381) * (-1980.757) [-1980.382] (-1980.256) (-1979.344) -- 0:00:50
      218500 -- (-1979.925) [-1981.054] (-1980.462) (-1980.153) * [-1980.146] (-1981.907) (-1981.255) (-1983.279) -- 0:00:50
      219000 -- (-1979.925) (-1983.726) [-1979.603] (-1982.368) * [-1979.207] (-1980.942) (-1980.111) (-1980.053) -- 0:00:49
      219500 -- [-1981.008] (-1980.505) (-1981.391) (-1982.342) * (-1984.915) (-1984.426) (-1981.557) [-1979.979] -- 0:00:49
      220000 -- [-1980.342] (-1982.323) (-1982.440) (-1982.167) * (-1980.289) [-1979.468] (-1981.787) (-1980.314) -- 0:00:49

      Average standard deviation of split frequencies: 0.016085

      220500 -- (-1980.336) [-1982.071] (-1980.986) (-1983.321) * (-1980.802) [-1979.377] (-1981.126) (-1980.686) -- 0:00:53
      221000 -- [-1979.855] (-1986.403) (-1981.350) (-1981.666) * (-1984.576) (-1981.446) (-1982.441) [-1979.585] -- 0:00:52
      221500 -- [-1981.505] (-1982.362) (-1981.849) (-1986.847) * (-1980.433) (-1978.925) (-1980.253) [-1980.144] -- 0:00:52
      222000 -- (-1981.926) [-1981.765] (-1983.795) (-1982.114) * (-1980.080) (-1981.579) [-1985.113] (-1981.117) -- 0:00:52
      222500 -- (-1980.693) (-1981.374) [-1983.144] (-1983.567) * (-1980.423) (-1980.281) [-1980.596] (-1980.560) -- 0:00:52
      223000 -- (-1981.203) (-1981.391) [-1983.088] (-1982.369) * (-1981.160) (-1979.877) (-1982.178) [-1979.801] -- 0:00:52
      223500 -- (-1981.424) (-1980.228) [-1980.506] (-1982.418) * (-1984.229) (-1979.606) (-1979.935) [-1979.857] -- 0:00:52
      224000 -- (-1980.288) (-1980.260) [-1981.143] (-1982.281) * (-1983.464) (-1980.238) [-1981.074] (-1979.811) -- 0:00:51
      224500 -- (-1980.273) [-1979.305] (-1981.614) (-1983.443) * [-1981.307] (-1979.582) (-1979.533) (-1980.028) -- 0:00:51
      225000 -- (-1979.955) (-1980.937) (-1981.899) [-1983.030] * (-1980.487) (-1981.486) [-1982.185] (-1981.079) -- 0:00:51

      Average standard deviation of split frequencies: 0.017150

      225500 -- (-1982.822) (-1980.482) (-1982.732) [-1979.548] * (-1982.457) (-1980.639) (-1983.768) [-1986.673] -- 0:00:51
      226000 -- (-1980.411) (-1980.595) (-1982.758) [-1979.588] * [-1980.494] (-1979.334) (-1981.961) (-1985.618) -- 0:00:51
      226500 -- [-1980.421] (-1979.748) (-1982.519) (-1979.599) * (-1982.069) (-1979.541) [-1981.973] (-1981.204) -- 0:00:51
      227000 -- (-1981.276) (-1979.278) [-1981.390] (-1980.893) * (-1979.727) (-1980.844) (-1984.872) [-1979.107] -- 0:00:51
      227500 -- (-1981.326) (-1979.248) [-1982.528] (-1979.405) * (-1979.709) (-1979.416) [-1982.459] (-1981.119) -- 0:00:50
      228000 -- [-1981.388] (-1980.151) (-1981.483) (-1983.513) * [-1984.442] (-1979.407) (-1983.346) (-1980.180) -- 0:00:50
      228500 -- (-1980.760) [-1980.556] (-1981.469) (-1981.260) * [-1978.990] (-1980.159) (-1980.942) (-1981.811) -- 0:00:50
      229000 -- (-1988.217) (-1981.049) (-1980.492) [-1979.567] * (-1981.428) (-1980.740) [-1982.774] (-1980.081) -- 0:00:50
      229500 -- (-1984.908) (-1979.995) [-1984.154] (-1979.571) * (-1981.410) (-1979.637) (-1979.367) [-1980.765] -- 0:00:50
      230000 -- (-1980.073) (-1979.847) (-1982.689) [-1979.022] * (-1981.033) (-1979.722) (-1982.736) [-1981.299] -- 0:00:50

      Average standard deviation of split frequencies: 0.017371

      230500 -- [-1979.584] (-1982.309) (-1988.064) (-1979.022) * (-1981.025) [-1980.198] (-1985.063) (-1980.737) -- 0:00:50
      231000 -- (-1979.629) (-1980.708) [-1984.490] (-1980.561) * [-1979.964] (-1980.378) (-1985.550) (-1980.276) -- 0:00:49
      231500 -- (-1980.479) (-1979.395) [-1981.536] (-1981.724) * (-1980.002) (-1980.226) (-1988.518) [-1980.317] -- 0:00:49
      232000 -- (-1981.862) (-1981.997) (-1982.944) [-1980.827] * (-1978.994) (-1980.482) [-1981.722] (-1979.345) -- 0:00:49
      232500 -- (-1980.911) (-1979.875) [-1980.697] (-1981.600) * [-1979.021] (-1980.491) (-1980.761) (-1979.337) -- 0:00:49
      233000 -- (-1982.415) [-1982.155] (-1981.576) (-1980.146) * (-1978.931) (-1980.589) (-1979.983) [-1981.025] -- 0:00:49
      233500 -- (-1982.141) (-1980.260) (-1981.235) [-1979.075] * (-1983.733) (-1987.133) [-1979.692] (-1980.360) -- 0:00:49
      234000 -- (-1985.493) (-1979.929) (-1980.696) [-1979.086] * (-1980.807) (-1986.304) (-1979.729) [-1981.804] -- 0:00:49
      234500 -- (-1980.048) [-1979.340] (-1981.092) (-1979.248) * [-1981.101] (-1984.889) (-1980.985) (-1981.509) -- 0:00:48
      235000 -- [-1981.115] (-1979.316) (-1982.654) (-1979.248) * (-1981.801) (-1984.084) [-1980.656] (-1980.098) -- 0:00:48

      Average standard deviation of split frequencies: 0.017228

      235500 -- (-1984.065) (-1979.332) (-1981.191) [-1979.240] * (-1981.114) (-1991.084) (-1980.017) [-1980.520] -- 0:00:51
      236000 -- (-1983.936) [-1980.315] (-1982.865) (-1979.147) * (-1980.672) [-1987.033] (-1979.350) (-1981.985) -- 0:00:51
      236500 -- (-1979.635) (-1979.082) (-1981.845) [-1981.214] * (-1981.478) (-1982.906) [-1979.734] (-1980.990) -- 0:00:51
      237000 -- (-1979.838) (-1979.291) [-1980.445] (-1982.427) * (-1980.595) (-1985.982) [-1979.406] (-1980.619) -- 0:00:51
      237500 -- (-1980.123) (-1979.791) (-1980.751) [-1987.806] * (-1980.595) [-1982.853] (-1981.776) (-1980.619) -- 0:00:51
      238000 -- (-1979.716) (-1981.845) (-1982.038) [-1980.377] * (-1979.939) (-1980.710) (-1979.781) [-1980.619] -- 0:00:51
      238500 -- [-1979.856] (-1983.193) (-1982.038) (-1979.375) * (-1982.319) [-1980.072] (-1983.408) (-1980.105) -- 0:00:51
      239000 -- (-1981.761) [-1979.103] (-1982.462) (-1982.015) * (-1983.688) [-1979.901] (-1981.554) (-1981.901) -- 0:00:50
      239500 -- (-1981.504) [-1979.046] (-1980.031) (-1981.135) * [-1983.625] (-1980.161) (-1980.345) (-1980.455) -- 0:00:50
      240000 -- (-1984.905) [-1979.460] (-1985.706) (-1984.839) * (-1983.786) (-1981.425) (-1982.585) [-1980.478] -- 0:00:50

      Average standard deviation of split frequencies: 0.016016

      240500 -- (-1981.073) (-1982.389) [-1984.666] (-1982.739) * (-1983.741) [-1982.105] (-1982.164) (-1981.054) -- 0:00:50
      241000 -- [-1979.561] (-1982.375) (-1985.126) (-1982.137) * (-1982.884) (-1980.068) [-1983.872] (-1979.405) -- 0:00:50
      241500 -- (-1979.369) (-1983.531) [-1983.056] (-1981.568) * (-1983.002) (-1979.937) [-1982.884] (-1986.645) -- 0:00:50
      242000 -- (-1982.502) (-1981.742) (-1984.956) [-1984.327] * (-1982.692) [-1983.270] (-1981.731) (-1984.734) -- 0:00:50
      242500 -- (-1981.190) (-1988.677) [-1981.515] (-1981.711) * (-1985.074) [-1984.599] (-1987.715) (-1983.975) -- 0:00:49
      243000 -- (-1981.580) (-1987.064) (-1981.759) [-1980.082] * [-1979.780] (-1984.198) (-1984.328) (-1981.429) -- 0:00:49
      243500 -- [-1982.049] (-1987.620) (-1982.063) (-1983.807) * [-1980.479] (-1981.964) (-1984.200) (-1983.257) -- 0:00:49
      244000 -- (-1983.168) [-1984.954] (-1980.723) (-1980.258) * [-1979.819] (-1984.315) (-1982.585) (-1984.405) -- 0:00:49
      244500 -- (-1980.666) [-1979.317] (-1979.341) (-1980.726) * (-1980.125) (-1986.389) (-1979.413) [-1979.897] -- 0:00:49
      245000 -- (-1983.657) (-1982.348) (-1980.372) [-1984.968] * (-1980.160) (-1987.531) [-1980.873] (-1980.600) -- 0:00:49

      Average standard deviation of split frequencies: 0.014053

      245500 -- (-1982.932) [-1981.034] (-1983.694) (-1983.232) * (-1982.410) [-1980.111] (-1979.538) (-1980.329) -- 0:00:49
      246000 -- (-1984.211) (-1981.793) [-1979.139] (-1980.900) * (-1981.358) [-1980.641] (-1979.487) (-1980.017) -- 0:00:49
      246500 -- (-1980.814) [-1984.010] (-1979.127) (-1980.243) * (-1981.358) (-1983.651) (-1980.626) [-1984.516] -- 0:00:48
      247000 -- (-1980.978) [-1979.493] (-1985.432) (-1980.301) * (-1983.957) (-1981.756) (-1985.221) [-1980.242] -- 0:00:48
      247500 -- [-1980.564] (-1980.443) (-1983.568) (-1980.470) * [-1981.508] (-1981.922) (-1986.011) (-1984.009) -- 0:00:48
      248000 -- (-1979.401) (-1984.826) [-1982.766] (-1980.288) * [-1982.438] (-1981.534) (-1982.944) (-1983.244) -- 0:00:48
      248500 -- (-1980.026) (-1983.255) [-1981.872] (-1980.517) * (-1979.458) [-1980.538] (-1980.918) (-1983.357) -- 0:00:48
      249000 -- [-1979.338] (-1980.308) (-1982.125) (-1983.328) * (-1979.861) (-1979.715) (-1979.661) [-1981.317] -- 0:00:48
      249500 -- (-1980.645) (-1983.007) (-1982.728) [-1979.906] * (-1979.671) (-1979.698) [-1983.231] (-1979.618) -- 0:00:48
      250000 -- [-1983.564] (-1982.934) (-1981.343) (-1980.733) * (-1980.249) (-1980.744) (-1981.395) [-1980.771] -- 0:00:48

      Average standard deviation of split frequencies: 0.014946

      250500 -- (-1984.132) (-1980.034) [-1980.653] (-1984.192) * [-1979.351] (-1981.196) (-1984.268) (-1981.157) -- 0:00:47
      251000 -- (-1983.775) (-1981.290) (-1980.776) [-1982.870] * (-1979.899) (-1980.554) (-1983.494) [-1981.811] -- 0:00:50
      251500 -- (-1981.467) (-1981.946) [-1980.358] (-1984.228) * (-1982.687) (-1979.935) (-1984.247) [-1980.202] -- 0:00:50
      252000 -- [-1980.909] (-1980.624) (-1980.163) (-1983.745) * (-1983.406) (-1980.652) (-1982.291) [-1983.711] -- 0:00:50
      252500 -- (-1985.108) (-1980.236) [-1979.841] (-1982.275) * (-1980.373) (-1981.595) (-1982.707) [-1980.307] -- 0:00:50
      253000 -- [-1979.478] (-1980.066) (-1980.383) (-1982.549) * (-1981.615) [-1981.220] (-1982.555) (-1980.991) -- 0:00:50
      253500 -- (-1979.955) (-1982.146) (-1979.524) [-1982.677] * (-1980.820) (-1982.677) [-1981.204] (-1980.842) -- 0:00:50
      254000 -- [-1980.060] (-1981.789) (-1980.725) (-1982.992) * (-1980.458) (-1982.805) (-1981.905) [-1980.811] -- 0:00:49
      254500 -- (-1982.048) (-1981.689) (-1982.568) [-1979.348] * [-1979.711] (-1981.439) (-1982.235) (-1980.442) -- 0:00:49
      255000 -- (-1981.580) (-1982.566) (-1980.321) [-1980.433] * [-1980.004] (-1981.258) (-1982.603) (-1980.555) -- 0:00:49

      Average standard deviation of split frequencies: 0.016864

      255500 -- (-1980.807) (-1980.161) [-1980.191] (-1982.226) * [-1980.890] (-1981.631) (-1980.506) (-1979.588) -- 0:00:49
      256000 -- (-1980.685) (-1980.055) (-1979.321) [-1981.911] * (-1979.137) (-1981.164) [-1982.818] (-1979.390) -- 0:00:49
      256500 -- (-1981.345) [-1981.547] (-1981.131) (-1981.424) * (-1981.454) [-1979.047] (-1982.874) (-1981.645) -- 0:00:49
      257000 -- (-1981.345) (-1979.821) [-1980.937] (-1981.116) * (-1980.414) [-1979.581] (-1980.412) (-1981.697) -- 0:00:49
      257500 -- (-1981.405) (-1982.782) [-1980.600] (-1979.756) * (-1980.583) (-1982.599) [-1980.000] (-1981.789) -- 0:00:49
      258000 -- [-1981.157] (-1980.664) (-1983.352) (-1979.370) * (-1979.969) (-1980.669) [-1981.944] (-1981.852) -- 0:00:48
      258500 -- (-1982.513) (-1980.697) (-1982.056) [-1982.866] * (-1985.600) [-1981.687] (-1981.878) (-1983.691) -- 0:00:48
      259000 -- (-1979.397) [-1981.529] (-1979.766) (-1981.401) * (-1983.086) (-1980.925) [-1980.677] (-1981.306) -- 0:00:48
      259500 -- (-1981.348) (-1986.796) (-1983.418) [-1980.101] * (-1981.516) [-1981.789] (-1982.381) (-1980.210) -- 0:00:48
      260000 -- (-1984.845) [-1980.045] (-1984.062) (-1981.621) * (-1981.646) (-1982.059) [-1980.595] (-1983.482) -- 0:00:48

      Average standard deviation of split frequencies: 0.016657

      260500 -- (-1980.407) [-1980.219] (-1983.528) (-1981.658) * (-1982.812) [-1981.043] (-1979.965) (-1979.798) -- 0:00:48
      261000 -- (-1981.493) (-1980.897) (-1982.759) [-1980.204] * (-1983.373) (-1980.817) (-1980.755) [-1980.407] -- 0:00:48
      261500 -- (-1984.841) (-1980.387) (-1982.121) [-1980.452] * (-1980.776) (-1982.520) (-1980.111) [-1981.002] -- 0:00:48
      262000 -- (-1982.947) (-1981.266) (-1981.584) [-1979.536] * (-1984.831) (-1981.026) [-1980.468] (-1985.512) -- 0:00:47
      262500 -- [-1981.496] (-1981.918) (-1980.326) (-1979.153) * (-1981.358) (-1982.466) [-1979.142] (-1983.639) -- 0:00:47
      263000 -- [-1980.113] (-1982.940) (-1980.303) (-1979.173) * [-1979.868] (-1983.017) (-1979.223) (-1979.582) -- 0:00:47
      263500 -- (-1982.488) (-1981.734) [-1981.562] (-1979.875) * [-1980.320] (-1986.024) (-1990.148) (-1980.655) -- 0:00:47
      264000 -- (-1980.439) (-1980.691) [-1980.273] (-1979.518) * (-1980.996) (-1981.732) (-1982.716) [-1979.788] -- 0:00:47
      264500 -- (-1980.345) (-1981.363) (-1980.126) [-1979.399] * (-1981.089) (-1983.257) (-1979.983) [-1979.297] -- 0:00:47
      265000 -- (-1981.115) (-1982.907) [-1979.974] (-1979.949) * (-1981.106) (-1982.397) [-1979.254] (-1980.328) -- 0:00:47

      Average standard deviation of split frequencies: 0.015483

      265500 -- (-1980.482) (-1981.577) [-1980.344] (-1979.949) * (-1980.938) (-1983.194) (-1982.144) [-1980.578] -- 0:00:47
      266000 -- (-1982.403) (-1979.699) [-1981.392] (-1979.950) * [-1979.121] (-1981.817) (-1981.272) (-1979.288) -- 0:00:46
      266500 -- (-1981.421) [-1981.333] (-1982.335) (-1980.839) * (-1981.009) (-1981.194) [-1981.551] (-1979.733) -- 0:00:49
      267000 -- [-1982.779] (-1981.853) (-1980.803) (-1982.185) * [-1982.955] (-1983.891) (-1980.972) (-1980.574) -- 0:00:49
      267500 -- (-1982.419) (-1980.562) [-1980.505] (-1983.631) * (-1980.849) (-1983.028) [-1980.312] (-1981.311) -- 0:00:49
      268000 -- (-1982.665) (-1981.256) [-1979.540] (-1980.241) * (-1979.706) (-1982.301) (-1981.752) [-1982.921] -- 0:00:49
      268500 -- (-1984.944) (-1980.583) (-1980.567) [-1979.613] * (-1980.831) [-1982.278] (-1979.697) (-1982.936) -- 0:00:49
      269000 -- (-1986.417) (-1982.006) (-1981.022) [-1981.559] * (-1982.026) [-1980.407] (-1984.919) (-1980.964) -- 0:00:48
      269500 -- (-1981.691) (-1980.373) [-1980.122] (-1981.942) * (-1983.257) [-1979.779] (-1982.328) (-1981.945) -- 0:00:48
      270000 -- [-1980.835] (-1980.500) (-1980.683) (-1982.321) * [-1978.811] (-1979.556) (-1982.246) (-1980.159) -- 0:00:48

      Average standard deviation of split frequencies: 0.015125

      270500 -- (-1980.731) [-1980.158] (-1981.903) (-1982.364) * (-1980.907) (-1981.069) (-1981.124) [-1980.279] -- 0:00:48
      271000 -- (-1981.668) (-1980.193) [-1986.383] (-1980.355) * [-1982.875] (-1980.558) (-1983.967) (-1985.021) -- 0:00:48
      271500 -- (-1980.102) (-1984.477) (-1982.328) [-1980.213] * [-1988.221] (-1980.347) (-1986.229) (-1979.990) -- 0:00:48
      272000 -- (-1979.159) (-1981.224) (-1985.559) [-1978.945] * [-1982.847] (-1981.753) (-1988.093) (-1984.822) -- 0:00:48
      272500 -- [-1979.500] (-1982.202) (-1987.324) (-1979.762) * [-1982.425] (-1980.331) (-1984.571) (-1979.695) -- 0:00:48
      273000 -- (-1980.173) (-1982.274) (-1981.626) [-1979.298] * [-1983.496] (-1980.331) (-1984.216) (-1981.930) -- 0:00:47
      273500 -- [-1981.102] (-1979.070) (-1980.741) (-1981.270) * (-1983.106) [-1979.618] (-1984.733) (-1983.388) -- 0:00:47
      274000 -- (-1980.238) [-1981.161] (-1980.025) (-1980.686) * (-1981.916) (-1980.176) (-1984.621) [-1981.569] -- 0:00:47
      274500 -- [-1979.619] (-1983.081) (-1982.681) (-1979.624) * (-1981.842) [-1983.264] (-1983.226) (-1980.024) -- 0:00:47
      275000 -- (-1980.997) (-1984.040) [-1984.257] (-1979.930) * [-1982.360] (-1980.751) (-1981.800) (-1980.735) -- 0:00:47

      Average standard deviation of split frequencies: 0.014473

      275500 -- (-1978.993) [-1981.906] (-1983.267) (-1980.996) * (-1980.835) (-1981.548) [-1981.605] (-1979.456) -- 0:00:47
      276000 -- (-1980.059) (-1981.626) [-1983.933] (-1982.302) * (-1980.885) (-1980.186) (-1982.370) [-1979.570] -- 0:00:47
      276500 -- [-1980.999] (-1980.546) (-1982.384) (-1981.477) * (-1980.356) [-1980.185] (-1982.506) (-1979.878) -- 0:00:47
      277000 -- (-1979.506) (-1982.919) [-1981.390] (-1979.859) * (-1979.901) [-1979.956] (-1984.172) (-1980.319) -- 0:00:46
      277500 -- (-1979.703) (-1979.932) [-1982.434] (-1983.230) * [-1979.859] (-1980.441) (-1982.485) (-1980.050) -- 0:00:46
      278000 -- (-1979.615) (-1981.197) [-1981.270] (-1984.120) * (-1981.311) (-1980.898) [-1984.968] (-1980.167) -- 0:00:46
      278500 -- (-1981.380) (-1980.879) [-1982.275] (-1981.073) * (-1980.287) [-1979.978] (-1981.421) (-1980.911) -- 0:00:46
      279000 -- (-1982.796) (-1980.896) (-1980.881) [-1982.335] * (-1982.374) (-1980.632) (-1979.363) [-1980.021] -- 0:00:46
      279500 -- [-1981.575] (-1980.111) (-1980.580) (-1979.873) * (-1980.822) (-1982.230) [-1981.459] (-1980.119) -- 0:00:46
      280000 -- (-1980.736) (-1990.278) [-1980.207] (-1979.896) * (-1984.084) (-1980.295) [-1980.733] (-1980.116) -- 0:00:46

      Average standard deviation of split frequencies: 0.014674

      280500 -- [-1981.171] (-1987.483) (-1980.294) (-1981.081) * [-1984.924] (-1980.258) (-1980.843) (-1980.389) -- 0:00:46
      281000 -- [-1980.211] (-1989.325) (-1985.629) (-1985.349) * (-1985.261) (-1982.180) (-1979.610) [-1982.035] -- 0:00:46
      281500 -- (-1980.943) [-1981.102] (-1985.109) (-1980.466) * (-1980.885) (-1980.691) [-1979.475] (-1980.134) -- 0:00:48
      282000 -- (-1979.052) (-1987.009) (-1981.754) [-1979.577] * [-1983.401] (-1980.933) (-1979.291) (-1980.694) -- 0:00:48
      282500 -- (-1981.979) (-1984.846) (-1981.074) [-1979.534] * (-1983.220) [-1982.256] (-1981.174) (-1982.146) -- 0:00:48
      283000 -- (-1981.504) (-1979.502) [-1981.782] (-1980.749) * (-1979.871) (-1982.248) (-1982.371) [-1980.511] -- 0:00:48
      283500 -- [-1981.295] (-1980.222) (-1981.894) (-1981.529) * (-1980.576) (-1979.492) [-1984.027] (-1981.810) -- 0:00:48
      284000 -- [-1981.075] (-1981.020) (-1981.473) (-1983.387) * (-1985.470) [-1979.564] (-1980.924) (-1980.998) -- 0:00:47
      284500 -- (-1980.894) (-1981.869) (-1982.169) [-1979.673] * (-1984.819) (-1980.083) (-1982.572) [-1983.157] -- 0:00:47
      285000 -- [-1981.576] (-1986.509) (-1979.699) (-1979.982) * (-1981.128) [-1980.083] (-1983.933) (-1981.873) -- 0:00:47

      Average standard deviation of split frequencies: 0.013446

      285500 -- (-1982.183) [-1984.026] (-1981.879) (-1979.621) * (-1982.062) [-1980.246] (-1984.427) (-1983.445) -- 0:00:47
      286000 -- [-1982.474] (-1980.088) (-1981.488) (-1979.609) * (-1981.180) [-1980.594] (-1987.019) (-1982.085) -- 0:00:47
      286500 -- [-1980.273] (-1983.051) (-1981.952) (-1979.699) * [-1981.408] (-1980.396) (-1986.656) (-1981.633) -- 0:00:47
      287000 -- [-1985.512] (-1980.798) (-1980.115) (-1979.522) * [-1982.761] (-1981.350) (-1979.665) (-1982.185) -- 0:00:47
      287500 -- (-1987.762) (-1979.437) [-1982.141] (-1979.949) * (-1980.204) (-1979.938) (-1979.374) [-1983.446] -- 0:00:47
      288000 -- (-1982.574) (-1980.103) [-1979.015] (-1982.798) * [-1982.146] (-1981.521) (-1979.341) (-1980.058) -- 0:00:46
      288500 -- (-1980.782) (-1981.124) (-1980.274) [-1979.336] * (-1981.260) (-1982.620) [-1979.120] (-1981.460) -- 0:00:46
      289000 -- [-1981.734] (-1981.295) (-1979.295) (-1981.887) * [-1980.421] (-1983.988) (-1981.133) (-1981.116) -- 0:00:46
      289500 -- [-1981.718] (-1983.106) (-1982.039) (-1980.661) * (-1981.587) (-1979.979) (-1981.007) [-1983.800] -- 0:00:46
      290000 -- [-1980.164] (-1981.218) (-1982.018) (-1988.463) * (-1983.403) [-1979.122] (-1981.467) (-1981.956) -- 0:00:46

      Average standard deviation of split frequencies: 0.012121

      290500 -- (-1982.456) (-1982.941) (-1981.396) [-1979.457] * (-1979.885) (-1980.501) [-1981.284] (-1981.330) -- 0:00:46
      291000 -- (-1979.520) [-1982.217] (-1981.405) (-1982.710) * [-1979.539] (-1982.905) (-1980.789) (-1981.385) -- 0:00:46
      291500 -- (-1981.809) (-1980.579) [-1982.718] (-1980.746) * (-1980.146) [-1983.007] (-1979.972) (-1980.884) -- 0:00:46
      292000 -- (-1981.342) (-1983.164) (-1981.703) [-1983.501] * [-1980.674] (-1982.227) (-1979.971) (-1981.632) -- 0:00:46
      292500 -- [-1982.360] (-1979.765) (-1980.821) (-1981.380) * (-1981.413) [-1980.236] (-1982.676) (-1981.758) -- 0:00:45
      293000 -- [-1981.666] (-1980.312) (-1982.850) (-1985.626) * (-1989.613) [-1980.585] (-1981.324) (-1981.423) -- 0:00:45
      293500 -- (-1980.733) (-1980.106) [-1982.899] (-1980.374) * (-1982.888) (-1981.149) [-1980.549] (-1980.150) -- 0:00:45
      294000 -- [-1980.234] (-1983.366) (-1980.460) (-1979.047) * (-1982.097) (-1980.201) (-1983.469) [-1979.970] -- 0:00:45
      294500 -- (-1979.508) (-1979.765) [-1980.765] (-1982.779) * (-1982.291) [-1981.207] (-1979.934) (-1982.326) -- 0:00:45
      295000 -- (-1978.901) [-1979.306] (-1981.684) (-1980.234) * [-1980.359] (-1980.689) (-1980.263) (-1982.305) -- 0:00:45

      Average standard deviation of split frequencies: 0.012405

      295500 -- (-1978.947) (-1981.215) [-1979.982] (-1980.685) * (-1978.937) (-1981.203) [-1980.781] (-1983.989) -- 0:00:45
      296000 -- (-1979.750) (-1979.252) [-1980.671] (-1980.872) * (-1978.941) (-1981.785) [-1981.424] (-1982.595) -- 0:00:45
      296500 -- (-1981.758) [-1979.960] (-1979.615) (-1979.549) * [-1980.760] (-1982.241) (-1980.747) (-1983.292) -- 0:00:45
      297000 -- (-1985.499) (-1981.822) (-1980.875) [-1981.128] * [-1982.828] (-1984.482) (-1979.408) (-1981.595) -- 0:00:47
      297500 -- (-1985.195) (-1981.867) (-1982.521) [-1978.955] * (-1983.069) [-1982.345] (-1979.408) (-1982.321) -- 0:00:47
      298000 -- (-1981.423) (-1982.928) [-1980.307] (-1982.590) * (-1981.546) [-1981.971] (-1980.677) (-1983.170) -- 0:00:47
      298500 -- (-1979.753) (-1980.159) (-1983.319) [-1982.000] * (-1980.583) [-1985.750] (-1980.289) (-1983.147) -- 0:00:47
      299000 -- (-1982.145) (-1980.404) (-1981.456) [-1981.310] * [-1980.296] (-1982.515) (-1980.307) (-1980.939) -- 0:00:46
      299500 -- (-1982.568) [-1979.333] (-1980.301) (-1984.338) * (-1980.229) [-1980.209] (-1980.327) (-1982.947) -- 0:00:46
      300000 -- (-1982.256) [-1983.403] (-1980.507) (-1982.112) * (-1981.372) (-1980.640) (-1980.043) [-1982.017] -- 0:00:46

      Average standard deviation of split frequencies: 0.013170

      300500 -- [-1980.522] (-1979.720) (-1980.121) (-1981.081) * (-1980.670) (-1980.361) [-1980.491] (-1979.867) -- 0:00:46
      301000 -- (-1980.745) (-1981.086) (-1979.483) [-1981.070] * (-1984.024) (-1980.324) [-1981.560] (-1980.633) -- 0:00:46
      301500 -- [-1981.005] (-1982.589) (-1980.560) (-1979.961) * (-1984.184) (-1981.566) [-1980.101] (-1980.730) -- 0:00:46
      302000 -- [-1981.555] (-1981.892) (-1979.418) (-1982.069) * (-1984.470) [-1982.596] (-1983.565) (-1980.353) -- 0:00:46
      302500 -- (-1980.844) (-1982.494) (-1980.369) [-1982.375] * (-1981.175) [-1980.299] (-1980.044) (-1980.802) -- 0:00:46
      303000 -- [-1981.195] (-1983.174) (-1981.108) (-1979.902) * (-1982.181) [-1980.850] (-1980.244) (-1981.408) -- 0:00:46
      303500 -- (-1981.726) [-1983.401] (-1980.872) (-1983.491) * (-1984.159) [-1984.090] (-1980.063) (-1983.215) -- 0:00:45
      304000 -- [-1979.918] (-1981.503) (-1981.233) (-1982.014) * [-1982.723] (-1981.350) (-1980.354) (-1983.552) -- 0:00:45
      304500 -- [-1981.494] (-1981.770) (-1981.912) (-1981.168) * (-1981.031) (-1984.271) (-1981.219) [-1982.214] -- 0:00:45
      305000 -- (-1981.812) (-1983.554) [-1981.996] (-1979.488) * (-1981.006) (-1980.911) (-1981.543) [-1981.692] -- 0:00:45

      Average standard deviation of split frequencies: 0.012632

      305500 -- [-1982.207] (-1987.545) (-1984.451) (-1980.289) * (-1980.674) (-1980.653) (-1983.630) [-1981.603] -- 0:00:45
      306000 -- (-1981.664) (-1986.629) [-1980.259] (-1983.738) * (-1978.941) [-1985.076] (-1981.484) (-1982.804) -- 0:00:45
      306500 -- (-1983.563) (-1982.622) [-1982.083] (-1982.696) * [-1981.898] (-1982.431) (-1980.666) (-1980.499) -- 0:00:45
      307000 -- (-1980.344) [-1980.861] (-1983.858) (-1980.323) * (-1983.395) (-1984.554) (-1981.374) [-1980.897] -- 0:00:45
      307500 -- (-1981.834) (-1980.830) (-1981.002) [-1980.326] * (-1979.378) (-1979.777) (-1983.924) [-1979.567] -- 0:00:45
      308000 -- [-1981.522] (-1981.879) (-1979.719) (-1981.946) * [-1979.616] (-1979.596) (-1983.061) (-1980.032) -- 0:00:44
      308500 -- [-1980.909] (-1987.037) (-1983.526) (-1981.457) * (-1980.516) (-1980.922) [-1983.057] (-1980.741) -- 0:00:44
      309000 -- (-1981.010) [-1982.386] (-1980.329) (-1981.325) * [-1980.982] (-1980.179) (-1981.652) (-1982.047) -- 0:00:44
      309500 -- (-1984.355) (-1982.300) [-1981.208] (-1981.552) * [-1981.240] (-1983.947) (-1981.995) (-1979.224) -- 0:00:44
      310000 -- (-1980.872) (-1981.469) [-1982.777] (-1981.253) * (-1980.989) (-1982.951) (-1983.902) [-1979.312] -- 0:00:44

      Average standard deviation of split frequencies: 0.011802

      310500 -- (-1980.207) [-1980.493] (-1981.029) (-1981.247) * (-1980.206) (-1982.382) (-1984.905) [-1979.821] -- 0:00:44
      311000 -- (-1980.408) [-1981.537] (-1980.457) (-1983.930) * (-1981.968) [-1983.432] (-1980.603) (-1979.632) -- 0:00:44
      311500 -- [-1980.111] (-1983.333) (-1981.119) (-1982.361) * (-1985.776) (-1981.263) [-1979.336] (-1980.231) -- 0:00:44
      312000 -- (-1979.483) [-1983.344] (-1980.640) (-1980.911) * (-1984.741) (-1982.619) [-1978.927] (-1979.776) -- 0:00:46
      312500 -- (-1984.004) (-1986.165) [-1980.283] (-1979.145) * (-1980.714) (-1984.069) [-1978.930] (-1981.298) -- 0:00:46
      313000 -- (-1983.072) (-1982.935) [-1980.499] (-1979.760) * (-1979.633) [-1980.889] (-1980.649) (-1982.652) -- 0:00:46
      313500 -- (-1982.970) [-1980.430] (-1980.831) (-1980.652) * (-1982.057) [-1985.445] (-1980.639) (-1981.536) -- 0:00:45
      314000 -- (-1983.530) (-1981.019) (-1979.479) [-1982.014] * (-1981.671) [-1982.814] (-1981.616) (-1980.188) -- 0:00:45
      314500 -- (-1980.948) [-1980.691] (-1979.797) (-1981.072) * (-1981.218) (-1981.797) [-1983.394] (-1980.432) -- 0:00:45
      315000 -- (-1989.740) [-1980.288] (-1980.497) (-1980.058) * (-1982.097) (-1980.362) [-1981.871] (-1981.169) -- 0:00:45

      Average standard deviation of split frequencies: 0.011232

      315500 -- [-1982.919] (-1979.555) (-1982.548) (-1994.858) * (-1982.097) (-1980.408) (-1981.304) [-1979.434] -- 0:00:45
      316000 -- (-1979.854) (-1983.399) [-1982.845] (-1983.232) * (-1980.754) (-1984.614) (-1982.872) [-1983.112] -- 0:00:45
      316500 -- (-1979.405) (-1983.372) [-1985.745] (-1984.978) * (-1982.074) (-1979.951) (-1984.398) [-1981.400] -- 0:00:45
      317000 -- (-1979.556) (-1982.251) (-1985.182) [-1986.796] * (-1982.074) (-1980.070) [-1982.830] (-1985.008) -- 0:00:45
      317500 -- [-1981.661] (-1984.589) (-1979.493) (-1990.411) * (-1983.620) (-1980.122) [-1985.176] (-1981.066) -- 0:00:45
      318000 -- (-1981.929) [-1982.185] (-1981.622) (-1989.365) * (-1982.911) (-1980.125) [-1983.983] (-1978.896) -- 0:00:45
      318500 -- (-1979.278) [-1979.403] (-1981.022) (-1984.279) * (-1982.748) [-1981.871] (-1984.264) (-1979.299) -- 0:00:44
      319000 -- (-1979.381) [-1979.743] (-1981.642) (-1988.468) * (-1978.887) [-1983.757] (-1983.118) (-1982.015) -- 0:00:44
      319500 -- (-1981.432) (-1981.897) (-1981.380) [-1980.321] * (-1979.067) [-1981.807] (-1981.076) (-1981.053) -- 0:00:44
      320000 -- [-1979.908] (-1982.397) (-1984.251) (-1980.098) * (-1979.016) (-1980.703) [-1979.318] (-1980.933) -- 0:00:44

      Average standard deviation of split frequencies: 0.011588

      320500 -- (-1980.091) (-1981.250) [-1980.214] (-1980.098) * (-1980.511) [-1981.723] (-1980.693) (-1980.044) -- 0:00:44
      321000 -- (-1980.079) (-1979.016) (-1980.490) [-1981.351] * [-1981.300] (-1983.784) (-1984.058) (-1982.980) -- 0:00:44
      321500 -- [-1980.079] (-1981.800) (-1980.891) (-1981.450) * (-1980.640) [-1982.643] (-1982.306) (-1980.304) -- 0:00:44
      322000 -- (-1979.884) (-1988.039) (-1981.056) [-1981.404] * (-1980.006) [-1981.990] (-1983.605) (-1979.602) -- 0:00:44
      322500 -- (-1980.649) [-1982.066] (-1981.760) (-1980.308) * (-1979.650) [-1983.285] (-1985.042) (-1982.116) -- 0:00:44
      323000 -- (-1982.058) (-1985.411) [-1980.247] (-1979.753) * (-1979.656) [-1987.500] (-1980.929) (-1980.473) -- 0:00:44
      323500 -- (-1982.011) (-1980.882) [-1979.631] (-1980.730) * [-1982.563] (-1982.047) (-1986.431) (-1979.626) -- 0:00:43
      324000 -- (-1981.062) (-1980.257) (-1979.258) [-1981.940] * (-1981.163) (-1983.323) [-1984.381] (-1981.005) -- 0:00:43
      324500 -- [-1980.989] (-1981.309) (-1979.258) (-1983.615) * (-1987.354) (-1983.107) [-1980.452] (-1982.696) -- 0:00:43
      325000 -- (-1979.088) (-1980.099) [-1980.030] (-1980.648) * (-1980.569) (-1981.516) (-1982.671) [-1980.774] -- 0:00:43

      Average standard deviation of split frequencies: 0.010377

      325500 -- (-1980.803) (-1980.565) [-1981.008] (-1979.898) * (-1980.276) [-1979.846] (-1983.698) (-1981.792) -- 0:00:43
      326000 -- [-1980.092] (-1981.542) (-1980.818) (-1983.242) * (-1981.797) (-1981.354) (-1983.306) [-1982.763] -- 0:00:43
      326500 -- [-1982.272] (-1981.731) (-1980.709) (-1987.906) * [-1979.642] (-1983.206) (-1980.048) (-1982.225) -- 0:00:43
      327000 -- (-1983.494) (-1981.795) [-1979.929] (-1982.237) * [-1979.130] (-1983.236) (-1986.202) (-1982.042) -- 0:00:45
      327500 -- (-1983.394) (-1981.015) (-1982.619) [-1982.261] * (-1979.977) [-1982.328] (-1983.429) (-1982.104) -- 0:00:45
      328000 -- (-1986.177) (-1980.165) [-1979.525] (-1979.588) * [-1980.737] (-1981.206) (-1990.116) (-1984.171) -- 0:00:45
      328500 -- (-1982.825) (-1981.038) [-1980.309] (-1979.532) * (-1982.068) (-1982.955) [-1979.397] (-1983.367) -- 0:00:44
      329000 -- (-1984.569) (-1980.233) (-1980.105) [-1979.287] * [-1980.345] (-1981.763) (-1983.158) (-1980.428) -- 0:00:44
      329500 -- [-1987.173] (-1979.213) (-1980.075) (-1984.084) * (-1980.757) (-1981.663) [-1983.089] (-1981.801) -- 0:00:44
      330000 -- (-1987.159) [-1982.418] (-1980.314) (-1983.935) * (-1984.012) (-1979.342) (-1980.661) [-1980.252] -- 0:00:44

      Average standard deviation of split frequencies: 0.010231

      330500 -- (-1984.587) (-1982.838) (-1984.698) [-1982.378] * (-1981.193) (-1981.058) [-1980.168] (-1981.918) -- 0:00:44
      331000 -- (-1979.846) (-1982.934) [-1980.274] (-1982.665) * (-1979.682) (-1982.225) [-1982.301] (-1982.253) -- 0:00:44
      331500 -- (-1982.181) (-1986.565) (-1979.778) [-1983.989] * (-1983.621) (-1982.245) [-1982.014] (-1981.734) -- 0:00:44
      332000 -- (-1980.931) [-1981.683] (-1980.176) (-1982.399) * (-1979.577) (-1979.457) (-1981.399) [-1979.824] -- 0:00:44
      332500 -- (-1982.491) (-1983.023) (-1979.493) [-1979.656] * (-1981.669) (-1979.414) (-1981.962) [-1980.289] -- 0:00:44
      333000 -- (-1983.700) (-1982.030) (-1980.444) [-1979.456] * (-1979.245) [-1980.796] (-1981.597) (-1979.852) -- 0:00:44
      333500 -- (-1981.184) (-1980.099) [-1980.827] (-1980.554) * (-1980.488) (-1980.283) (-1982.035) [-1979.970] -- 0:00:43
      334000 -- (-1979.642) (-1987.181) (-1980.589) [-1980.583] * (-1982.352) [-1981.232] (-1982.193) (-1980.729) -- 0:00:43
      334500 -- [-1980.818] (-1981.357) (-1980.961) (-1979.508) * (-1982.701) (-1983.550) (-1982.997) [-1980.326] -- 0:00:43
      335000 -- (-1985.733) (-1983.254) (-1981.094) [-1979.514] * [-1980.359] (-1981.755) (-1982.347) (-1982.184) -- 0:00:43

      Average standard deviation of split frequencies: 0.011536

      335500 -- [-1981.541] (-1980.229) (-1981.094) (-1982.782) * (-1980.336) [-1981.700] (-1982.266) (-1983.804) -- 0:00:43
      336000 -- [-1981.153] (-1980.656) (-1980.868) (-1983.155) * (-1979.477) (-1979.704) (-1983.976) [-1979.505] -- 0:00:43
      336500 -- (-1983.497) (-1984.250) (-1979.916) [-1980.501] * (-1980.948) [-1979.934] (-1985.257) (-1979.495) -- 0:00:43
      337000 -- (-1981.432) [-1979.341] (-1979.940) (-1980.026) * (-1981.921) [-1979.668] (-1981.347) (-1979.495) -- 0:00:43
      337500 -- (-1982.680) (-1979.324) [-1981.720] (-1980.331) * (-1983.210) (-1984.570) [-1979.836] (-1979.965) -- 0:00:43
      338000 -- (-1982.880) (-1979.309) (-1980.507) [-1982.246] * (-1981.640) [-1985.250] (-1979.341) (-1983.519) -- 0:00:43
      338500 -- (-1981.859) [-1979.570] (-1980.380) (-1982.290) * (-1979.767) (-1986.735) [-1979.037] (-1980.738) -- 0:00:42
      339000 -- (-1979.885) (-1981.129) [-1981.570] (-1980.035) * (-1980.091) [-1979.966] (-1979.168) (-1981.042) -- 0:00:42
      339500 -- (-1981.084) [-1981.287] (-1981.570) (-1981.504) * (-1984.859) [-1982.015] (-1980.088) (-1981.065) -- 0:00:42
      340000 -- [-1981.127] (-1983.012) (-1984.122) (-1982.278) * (-1987.195) (-1980.098) [-1980.902] (-1979.416) -- 0:00:42

      Average standard deviation of split frequencies: 0.010724

      340500 -- (-1984.536) [-1982.866] (-1983.161) (-1979.111) * (-1980.793) [-1979.464] (-1980.046) (-1981.776) -- 0:00:42
      341000 -- (-1981.867) (-1982.230) (-1980.722) [-1979.111] * (-1980.052) [-1979.895] (-1984.460) (-1980.720) -- 0:00:42
      341500 -- (-1989.169) (-1983.352) [-1981.573] (-1981.225) * (-1981.229) (-1979.573) (-1985.002) [-1979.583] -- 0:00:42
      342000 -- [-1979.939] (-1981.827) (-1983.670) (-1982.792) * (-1979.562) [-1979.811] (-1987.607) (-1983.263) -- 0:00:42
      342500 -- (-1979.919) (-1981.318) [-1983.153] (-1988.689) * (-1979.671) (-1983.019) (-1983.611) [-1983.631] -- 0:00:44
      343000 -- (-1979.923) [-1980.349] (-1984.910) (-1981.007) * [-1979.660] (-1981.720) (-1985.161) (-1983.496) -- 0:00:44
      343500 -- [-1979.854] (-1980.275) (-1982.983) (-1983.006) * (-1981.803) (-1982.917) (-1983.190) [-1982.059] -- 0:00:43
      344000 -- (-1980.220) (-1981.330) (-1982.347) [-1981.188] * (-1982.271) [-1982.698] (-1980.962) (-1980.994) -- 0:00:43
      344500 -- [-1983.072] (-1982.061) (-1980.401) (-1981.930) * [-1979.135] (-1980.114) (-1981.929) (-1979.845) -- 0:00:43
      345000 -- (-1981.024) [-1980.327] (-1982.132) (-1982.783) * (-1979.646) [-1982.144] (-1981.823) (-1979.622) -- 0:00:43

      Average standard deviation of split frequencies: 0.012102

      345500 -- [-1982.876] (-1982.472) (-1983.943) (-1981.482) * (-1980.109) (-1981.060) [-1983.264] (-1980.208) -- 0:00:43
      346000 -- [-1979.782] (-1982.028) (-1982.252) (-1980.444) * (-1980.885) [-1980.892] (-1981.090) (-1982.865) -- 0:00:43
      346500 -- (-1980.207) (-1979.620) (-1985.008) [-1979.899] * (-1982.313) (-1980.851) [-1981.137] (-1981.972) -- 0:00:43
      347000 -- (-1980.819) (-1982.564) [-1983.196] (-1980.487) * (-1984.695) (-1983.283) [-1980.200] (-1983.506) -- 0:00:43
      347500 -- (-1980.912) [-1980.083] (-1980.249) (-1979.998) * (-1984.036) [-1982.769] (-1982.135) (-1982.650) -- 0:00:43
      348000 -- [-1982.499] (-1985.729) (-1980.436) (-1979.963) * (-1983.676) (-1983.762) (-1983.064) [-1980.536] -- 0:00:43
      348500 -- (-1982.010) (-1981.845) [-1981.126] (-1979.699) * [-1981.044] (-1982.581) (-1980.554) (-1983.676) -- 0:00:42
      349000 -- [-1982.121] (-1979.922) (-1982.315) (-1981.404) * (-1983.528) (-1988.504) [-1981.143] (-1983.027) -- 0:00:42
      349500 -- [-1981.147] (-1981.871) (-1982.969) (-1982.965) * (-1984.301) (-1981.694) [-1981.305] (-1983.083) -- 0:00:42
      350000 -- [-1981.567] (-1980.615) (-1979.262) (-1984.543) * (-1982.833) (-1981.943) [-1980.271] (-1979.502) -- 0:00:42

      Average standard deviation of split frequencies: 0.011745

      350500 -- (-1982.716) (-1981.334) (-1980.955) [-1984.643] * [-1983.624] (-1981.249) (-1980.634) (-1979.712) -- 0:00:42
      351000 -- (-1981.461) (-1982.424) (-1982.626) [-1979.309] * (-1980.989) (-1980.617) [-1980.601] (-1980.421) -- 0:00:42
      351500 -- (-1980.746) (-1981.416) (-1979.525) [-1981.759] * (-1981.976) (-1979.077) [-1980.830] (-1983.918) -- 0:00:42
      352000 -- (-1980.721) [-1982.194] (-1981.773) (-1979.913) * (-1981.536) (-1980.259) (-1979.986) [-1985.880] -- 0:00:42
      352500 -- (-1980.230) [-1980.075] (-1979.605) (-1979.885) * (-1980.439) [-1979.304] (-1980.045) (-1980.700) -- 0:00:42
      353000 -- (-1981.785) (-1980.052) (-1980.504) [-1980.220] * (-1986.642) [-1980.139] (-1982.421) (-1982.749) -- 0:00:42
      353500 -- (-1983.129) [-1984.422] (-1980.326) (-1983.067) * (-1983.089) [-1979.222] (-1982.164) (-1982.540) -- 0:00:42
      354000 -- [-1979.900] (-1979.871) (-1980.502) (-1981.429) * (-1983.704) [-1979.176] (-1981.360) (-1981.901) -- 0:00:41
      354500 -- (-1981.521) (-1980.636) [-1980.189] (-1981.550) * (-1984.985) (-1984.687) (-1980.553) [-1981.582] -- 0:00:41
      355000 -- (-1984.990) (-1980.506) (-1981.449) [-1982.988] * (-1982.367) [-1987.569] (-1982.077) (-1979.531) -- 0:00:41

      Average standard deviation of split frequencies: 0.011697

      355500 -- [-1981.880] (-1980.302) (-1980.786) (-1983.397) * (-1982.846) [-1985.311] (-1980.236) (-1980.320) -- 0:00:41
      356000 -- [-1981.866] (-1982.323) (-1981.949) (-1981.998) * (-1981.993) (-1987.635) (-1983.270) [-1981.907] -- 0:00:41
      356500 -- (-1981.467) [-1981.079] (-1980.616) (-1982.410) * [-1982.066] (-1985.337) (-1981.104) (-1983.666) -- 0:00:41
      357000 -- (-1981.257) [-1980.242] (-1980.967) (-1982.000) * (-1983.090) (-1985.180) (-1984.555) [-1982.512] -- 0:00:41
      357500 -- [-1981.183] (-1981.219) (-1979.998) (-1986.119) * (-1980.538) (-1985.306) [-1980.670] (-1981.894) -- 0:00:43
      358000 -- (-1982.457) (-1980.383) (-1980.049) [-1983.696] * (-1983.012) [-1985.251] (-1981.664) (-1983.003) -- 0:00:43
      358500 -- (-1982.947) [-1983.150] (-1980.048) (-1983.054) * [-1981.480] (-1985.075) (-1983.740) (-1983.848) -- 0:00:42
      359000 -- (-1982.402) [-1983.117] (-1982.255) (-1979.276) * (-1981.542) (-1984.500) (-1981.997) [-1983.767] -- 0:00:42
      359500 -- [-1981.035] (-1983.122) (-1980.112) (-1982.096) * [-1982.860] (-1982.914) (-1980.433) (-1982.207) -- 0:00:42
      360000 -- (-1981.813) (-1982.711) (-1980.936) [-1979.312] * (-1983.267) (-1985.324) [-1979.862] (-1980.262) -- 0:00:42

      Average standard deviation of split frequencies: 0.011763

      360500 -- [-1981.264] (-1981.457) (-1981.910) (-1980.847) * (-1982.200) (-1984.205) (-1981.410) [-1980.161] -- 0:00:42
      361000 -- (-1987.092) [-1981.899] (-1981.007) (-1981.536) * (-1982.567) (-1980.424) (-1980.184) [-1984.879] -- 0:00:42
      361500 -- (-1981.129) (-1980.099) (-1984.487) [-1979.691] * (-1983.947) (-1980.950) [-1980.251] (-1987.277) -- 0:00:42
      362000 -- [-1980.757] (-1980.301) (-1980.898) (-1979.351) * (-1987.926) (-1980.498) (-1979.482) [-1981.380] -- 0:00:42
      362500 -- (-1982.031) (-1979.019) (-1980.678) [-1980.022] * (-1985.036) (-1979.532) (-1979.482) [-1979.796] -- 0:00:42
      363000 -- (-1982.196) (-1983.392) (-1981.791) [-1979.666] * [-1981.935] (-1979.832) (-1979.329) (-1984.039) -- 0:00:42
      363500 -- (-1981.419) (-1980.936) [-1980.109] (-1979.930) * (-1982.253) [-1979.797] (-1981.545) (-1983.088) -- 0:00:42
      364000 -- (-1980.296) [-1984.645] (-1981.499) (-1979.823) * (-1985.069) [-1979.558] (-1980.733) (-1986.096) -- 0:00:41
      364500 -- [-1978.869] (-1980.333) (-1978.911) (-1979.500) * (-1982.459) (-1980.345) [-1980.584] (-1981.626) -- 0:00:41
      365000 -- (-1980.389) [-1979.908] (-1979.635) (-1981.167) * (-1985.024) (-1981.309) (-1984.325) [-1979.446] -- 0:00:41

      Average standard deviation of split frequencies: 0.011807

      365500 -- (-1980.509) (-1981.664) (-1979.768) [-1981.566] * (-1980.807) [-1983.556] (-1979.893) (-1980.688) -- 0:00:41
      366000 -- (-1982.216) (-1980.273) (-1981.255) [-1982.161] * (-1982.581) (-1981.149) (-1980.115) [-1981.088] -- 0:00:41
      366500 -- (-1979.271) (-1980.705) [-1978.900] (-1982.771) * (-1982.428) (-1981.337) (-1986.332) [-1981.267] -- 0:00:41
      367000 -- (-1981.400) (-1980.307) [-1979.386] (-1980.978) * [-1983.941] (-1981.102) (-1982.811) (-1980.113) -- 0:00:41
      367500 -- (-1980.945) (-1981.123) [-1980.513] (-1981.671) * (-1983.849) [-1979.762] (-1981.062) (-1982.120) -- 0:00:41
      368000 -- (-1981.473) [-1984.469] (-1983.078) (-1981.571) * (-1984.562) (-1980.019) [-1982.873] (-1982.299) -- 0:00:41
      368500 -- [-1982.030] (-1988.344) (-1984.779) (-1981.154) * (-1981.730) [-1981.935] (-1980.174) (-1980.866) -- 0:00:41
      369000 -- (-1981.793) [-1985.309] (-1982.942) (-1979.896) * [-1980.644] (-1984.217) (-1982.689) (-1983.074) -- 0:00:41
      369500 -- (-1984.228) (-1981.090) [-1980.300] (-1979.054) * [-1980.415] (-1984.882) (-1984.541) (-1981.295) -- 0:00:40
      370000 -- [-1979.984] (-1980.541) (-1983.145) (-1980.417) * (-1983.970) [-1982.938] (-1982.438) (-1981.161) -- 0:00:40

      Average standard deviation of split frequencies: 0.012119

      370500 -- (-1980.835) [-1979.149] (-1984.786) (-1980.430) * (-1986.477) (-1979.402) [-1980.928] (-1980.219) -- 0:00:40
      371000 -- (-1980.253) [-1981.004] (-1979.900) (-1979.557) * (-1986.666) [-1980.369] (-1980.544) (-1980.892) -- 0:00:40
      371500 -- (-1980.253) (-1986.248) (-1980.238) [-1979.078] * (-1984.718) (-1981.315) [-1979.395] (-1982.017) -- 0:00:40
      372000 -- (-1979.897) (-1982.620) (-1980.924) [-1980.725] * (-1985.740) (-1981.042) [-1984.096] (-1981.613) -- 0:00:40
      372500 -- [-1978.847] (-1980.584) (-1981.123) (-1979.725) * (-1980.530) (-1979.569) (-1982.230) [-1985.295] -- 0:00:40
      373000 -- [-1980.489] (-1980.990) (-1982.425) (-1980.730) * [-1979.499] (-1980.651) (-1981.773) (-1984.042) -- 0:00:42
      373500 -- [-1980.881] (-1981.910) (-1983.429) (-1982.720) * [-1979.979] (-1980.257) (-1980.062) (-1980.040) -- 0:00:41
      374000 -- (-1982.260) (-1980.946) [-1981.117] (-1980.249) * (-1979.518) (-1979.853) (-1979.533) [-1980.301] -- 0:00:41
      374500 -- [-1985.813] (-1980.510) (-1979.383) (-1980.751) * (-1981.474) (-1982.597) (-1981.692) [-1981.559] -- 0:00:41
      375000 -- [-1983.570] (-1984.409) (-1980.440) (-1981.560) * (-1981.153) [-1983.489] (-1980.360) (-1984.757) -- 0:00:41

      Average standard deviation of split frequencies: 0.012189

      375500 -- (-1983.228) [-1980.556] (-1980.044) (-1979.735) * (-1980.902) [-1985.968] (-1980.428) (-1982.598) -- 0:00:41
      376000 -- (-1982.914) (-1982.115) [-1978.958] (-1988.240) * (-1980.139) (-1981.529) [-1980.430] (-1981.410) -- 0:00:41
      376500 -- (-1979.753) (-1985.479) [-1981.182] (-1979.211) * [-1980.743] (-1982.450) (-1981.105) (-1980.970) -- 0:00:41
      377000 -- (-1981.010) [-1980.498] (-1983.486) (-1980.545) * (-1979.470) [-1982.102] (-1981.041) (-1984.378) -- 0:00:41
      377500 -- (-1982.200) (-1980.770) (-1982.526) [-1981.504] * (-1986.323) (-1981.998) [-1981.124] (-1981.811) -- 0:00:41
      378000 -- (-1983.274) [-1982.487] (-1980.911) (-1981.636) * (-1982.315) (-1979.239) [-1979.056] (-1979.822) -- 0:00:41
      378500 -- [-1980.105] (-1983.172) (-1980.141) (-1981.912) * (-1980.087) [-1986.382] (-1980.779) (-1979.576) -- 0:00:41
      379000