--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:14:13 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1150.33 -1154.71
2 -1150.31 -1153.73
--------------------------------------
TOTAL -1150.32 -1154.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882559 0.091483 0.352579 1.513202 0.845531 1192.88 1345.45 1.000
r(A<->C){all} 0.164605 0.019435 0.000104 0.446475 0.128259 89.49 231.00 1.003
r(A<->G){all} 0.147622 0.018061 0.000018 0.427409 0.107436 214.08 257.94 1.009
r(A<->T){all} 0.161311 0.018203 0.000016 0.432762 0.128030 193.03 274.10 1.001
r(C<->G){all} 0.202551 0.025893 0.000060 0.528885 0.164689 100.52 160.63 1.006
r(C<->T){all} 0.167932 0.021000 0.000057 0.462488 0.129198 160.31 223.38 1.001
r(G<->T){all} 0.155980 0.017383 0.000096 0.426120 0.119891 192.69 196.18 1.000
pi(A){all} 0.199668 0.000182 0.174825 0.226775 0.199431 1293.26 1334.59 1.000
pi(C){all} 0.285945 0.000240 0.255358 0.315992 0.285735 1256.01 1353.37 1.000
pi(G){all} 0.345446 0.000270 0.312023 0.376636 0.344851 1292.84 1330.38 1.000
pi(T){all} 0.168942 0.000161 0.144041 0.193986 0.168539 1297.42 1348.92 1.001
alpha{1,2} 0.352095 0.168909 0.000143 1.199194 0.213214 1317.55 1398.45 1.000
alpha{3} 0.408469 0.223916 0.000122 1.351279 0.234926 1262.63 1371.63 1.000
pinvar{all} 0.996202 0.000010 0.989839 0.999969 0.997065 1240.35 1318.35 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1109.359267
Model 2: PositiveSelection -1109.134317
Model 0: one-ratio -1109.134302
Model 7: beta -1109.381501
Model 8: beta&w>1 -1109.134314
Model 0 vs 1 0.4499300000002222
Model 2 vs 1 0.4499000000000706
Model 8 vs 7 0.4943740000003345
>C1
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGQESAATNIGHSDDSVVTHEPQIAES
>C2
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C3
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C4
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C5
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C6
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=281
C1 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C2 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C3 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C4 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C5 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C6 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
**************************************************
C1 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C2 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C3 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C4 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C5 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C6 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
**************************************************
C1 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C2 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C3 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C4 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C5 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C6 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
**************************************************
C1 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C2 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C3 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C4 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C5 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C6 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
**************************************************
C1 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C2 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C3 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C4 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C5 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C6 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
**************************************************
C1 GRAVGGQESAATNIGHSDDSVVTHEPQIAES
C2 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C3 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C4 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C5 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C6 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
******:************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8430]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8430]--->[8430]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.502 Mb, Max= 30.839 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C2 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C3 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C4 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C5 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C6 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
**************************************************
C1 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C2 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C3 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C4 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C5 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C6 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
**************************************************
C1 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C2 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C3 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C4 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C5 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C6 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
**************************************************
C1 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C2 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C3 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C4 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C5 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C6 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
**************************************************
C1 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C2 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C3 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C4 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C5 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C6 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
**************************************************
C1 GRAVGGQESAATNIGHSDDSVVTHEPQIAES
C2 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C3 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C4 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C5 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C6 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
******:************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 99.64 C1 C2 99.64
TOP 1 0 99.64 C2 C1 99.64
BOT 0 2 99.64 C1 C3 99.64
TOP 2 0 99.64 C3 C1 99.64
BOT 0 3 99.64 C1 C4 99.64
TOP 3 0 99.64 C4 C1 99.64
BOT 0 4 99.64 C1 C5 99.64
TOP 4 0 99.64 C5 C1 99.64
BOT 0 5 99.64 C1 C6 99.64
TOP 5 0 99.64 C6 C1 99.64
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.64
AVG 1 C2 * 99.93
AVG 2 C3 * 99.93
AVG 3 C4 * 99.93
AVG 4 C5 * 99.93
AVG 5 C6 * 99.93
TOT TOT * 99.88
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
C2 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
C3 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
C4 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
C5 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
C6 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
**************************************************
C1 CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
C2 CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
C3 CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
C4 CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
C5 CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
C6 CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
**************************************************
C1 AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
C2 AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
C3 AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
C4 AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
C5 AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
C6 AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
**************************************************
C1 ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
C2 ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
C3 ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
C4 ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
C5 ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
C6 ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
**************************************************
C1 CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
C2 CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
C3 CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
C4 CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
C5 CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
C6 CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
**************************************************
C1 ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
C2 ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
C3 ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
C4 ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
C5 ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
C6 ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
**************************************************
C1 AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
C2 AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
C3 AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
C4 AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
C5 AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
C6 AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
**************************************************
C1 AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
C2 AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
C3 AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
C4 AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
C5 AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
C6 AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
**************************************************
C1 GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
C2 GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
C3 GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
C4 GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
C5 GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
C6 GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
**************************************************
C1 GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
C2 GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
C3 GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
C4 GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
C5 GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
C6 GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
**************************************************
C1 TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
C2 TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
C3 TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
C4 TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
C5 TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
C6 TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
**************************************************
C1 ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
C2 ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
C3 ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
C4 ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
C5 ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
C6 ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
**************************************************
C1 TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
C2 TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
C3 TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
C4 TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
C5 TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
C6 TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
**************************************************
C1 CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
C2 CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
C3 CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
C4 CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
C5 CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
C6 CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
**************************************************
C1 GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
C2 GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
C3 GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
C4 GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
C5 GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
C6 GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
**************************************************
C1 GGACGGGCGGTGGGTGGCCAAGAAAGCGCTGCTACCAACATTGGGCACTC
C2 GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
C3 GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
C4 GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
C5 GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
C6 GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
****************** *******************************
C1 TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
C2 TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
C3 TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
C4 TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
C5 TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
C6 TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
*******************************************
>C1
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCCAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C2
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C3
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C4
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C5
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C6
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C1
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGQESAATNIGHSDDSVVTHEPQIAES
>C2
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C3
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C4
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C5
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C6
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 843 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792363
Setting output file names to "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1347553195
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0147934217
Seed = 1934390529
Swapseed = 1579792363
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1890.077276 -- -24.965149
Chain 2 -- -1890.077276 -- -24.965149
Chain 3 -- -1890.077276 -- -24.965149
Chain 4 -- -1890.076923 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1890.077276 -- -24.965149
Chain 2 -- -1890.075618 -- -24.965149
Chain 3 -- -1890.075618 -- -24.965149
Chain 4 -- -1890.077276 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1890.077] (-1890.077) (-1890.077) (-1890.077) * [-1890.077] (-1890.076) (-1890.076) (-1890.077)
500 -- (-1167.602) (-1154.728) [-1164.462] (-1167.051) * (-1190.540) (-1175.484) (-1160.307) [-1159.231] -- 0:00:00
1000 -- (-1159.558) (-1153.922) [-1160.748] (-1155.274) * (-1170.730) (-1162.940) (-1164.055) [-1158.979] -- 0:00:00
1500 -- (-1158.465) [-1155.110] (-1158.227) (-1158.655) * [-1155.649] (-1160.494) (-1156.873) (-1161.468) -- 0:00:00
2000 -- (-1156.789) (-1153.977) (-1152.843) [-1157.183] * (-1154.148) [-1155.409] (-1161.880) (-1156.166) -- 0:00:00
2500 -- [-1160.378] (-1152.818) (-1152.562) (-1161.039) * (-1163.983) [-1158.382] (-1166.146) (-1156.877) -- 0:00:00
3000 -- (-1159.201) (-1159.969) (-1157.507) [-1155.192] * [-1156.313] (-1161.667) (-1156.516) (-1162.772) -- 0:00:00
3500 -- [-1157.009] (-1158.110) (-1154.025) (-1156.231) * (-1155.386) [-1155.646] (-1154.626) (-1156.275) -- 0:00:00
4000 -- (-1159.532) [-1155.625] (-1161.571) (-1160.096) * (-1154.052) (-1152.833) (-1159.134) [-1152.022] -- 0:00:00
4500 -- [-1152.579] (-1160.072) (-1152.967) (-1152.799) * [-1154.107] (-1155.945) (-1152.625) (-1156.120) -- 0:00:00
5000 -- [-1153.464] (-1156.473) (-1160.392) (-1153.963) * (-1156.871) (-1157.544) (-1156.192) [-1159.629] -- 0:00:00
Average standard deviation of split frequencies: 0.116143
5500 -- (-1165.790) (-1158.405) (-1151.741) [-1158.517] * [-1149.428] (-1155.287) (-1167.780) (-1157.306) -- 0:00:00
6000 -- (-1158.854) (-1161.538) (-1156.312) [-1157.204] * [-1156.806] (-1155.872) (-1155.035) (-1160.122) -- 0:00:00
6500 -- (-1158.671) [-1152.851] (-1161.059) (-1153.908) * (-1152.404) (-1152.848) (-1152.480) [-1153.873] -- 0:00:00
7000 -- (-1167.980) (-1154.920) [-1154.113] (-1159.406) * [-1157.810] (-1150.035) (-1156.310) (-1152.290) -- 0:00:00
7500 -- (-1161.626) (-1156.069) (-1163.282) [-1158.235] * (-1156.256) (-1158.079) [-1156.405] (-1162.600) -- 0:00:00
8000 -- (-1152.839) (-1162.750) [-1158.252] (-1151.166) * (-1163.222) (-1160.541) [-1158.141] (-1157.543) -- 0:00:00
8500 -- (-1151.949) (-1155.927) (-1159.807) [-1151.945] * (-1155.846) (-1152.699) (-1160.615) [-1152.790] -- 0:00:00
9000 -- (-1168.519) [-1158.128] (-1161.556) (-1159.802) * [-1151.057] (-1160.791) (-1155.324) (-1159.874) -- 0:00:00
9500 -- (-1160.528) [-1157.325] (-1148.636) (-1159.320) * [-1153.219] (-1166.029) (-1154.319) (-1167.834) -- 0:00:00
10000 -- (-1152.014) [-1152.554] (-1149.257) (-1151.929) * (-1150.738) [-1150.741] (-1163.313) (-1155.842) -- 0:00:00
Average standard deviation of split frequencies: 0.081759
10500 -- (-1155.424) (-1157.894) (-1149.492) [-1157.001] * (-1157.892) [-1159.687] (-1157.482) (-1164.785) -- 0:00:00
11000 -- (-1165.063) (-1157.459) [-1150.516] (-1158.438) * (-1153.930) (-1154.137) (-1157.709) [-1165.721] -- 0:00:00
11500 -- (-1154.138) (-1157.843) (-1150.040) [-1156.442] * (-1154.787) (-1151.039) (-1160.080) [-1155.901] -- 0:00:00
12000 -- (-1170.415) [-1159.291] (-1152.492) (-1159.552) * (-1163.405) (-1161.516) [-1155.906] (-1158.249) -- 0:00:00
12500 -- (-1153.603) (-1163.493) [-1150.493] (-1159.555) * [-1160.218] (-1159.792) (-1157.878) (-1154.948) -- 0:00:00
13000 -- (-1161.841) (-1161.060) (-1150.607) [-1153.489] * [-1156.294] (-1157.029) (-1153.587) (-1164.379) -- 0:00:00
13500 -- (-1160.688) (-1157.353) (-1150.322) [-1155.279] * [-1154.101] (-1153.800) (-1159.778) (-1162.515) -- 0:00:00
14000 -- [-1153.946] (-1158.668) (-1150.581) (-1160.048) * (-1154.063) (-1151.805) [-1153.434] (-1154.673) -- 0:01:10
14500 -- [-1155.223] (-1162.744) (-1149.974) (-1156.558) * (-1160.458) (-1162.819) [-1156.312] (-1163.425) -- 0:01:07
15000 -- (-1157.164) [-1157.986] (-1151.566) (-1156.113) * (-1160.010) (-1149.034) [-1156.505] (-1159.901) -- 0:01:05
Average standard deviation of split frequencies: 0.060265
15500 -- [-1160.694] (-1164.709) (-1152.004) (-1163.912) * (-1153.778) (-1150.136) [-1157.562] (-1152.402) -- 0:01:03
16000 -- (-1163.447) [-1160.527] (-1152.170) (-1159.926) * (-1150.684) (-1152.332) [-1158.117] (-1162.332) -- 0:01:01
16500 -- (-1155.276) [-1150.953] (-1151.572) (-1159.325) * (-1156.032) (-1150.378) (-1158.693) [-1158.144] -- 0:00:59
17000 -- (-1164.732) [-1155.057] (-1151.060) (-1156.211) * (-1155.430) (-1151.235) [-1156.310] (-1153.608) -- 0:00:57
17500 -- (-1155.205) (-1152.465) (-1152.347) [-1154.257] * (-1150.127) (-1149.423) (-1159.857) [-1158.752] -- 0:00:56
18000 -- (-1154.219) (-1159.661) (-1153.501) [-1153.467] * (-1159.478) (-1153.031) (-1160.302) [-1149.873] -- 0:00:54
18500 -- (-1159.056) [-1158.243] (-1150.855) (-1159.358) * [-1156.888] (-1158.965) (-1155.036) (-1155.548) -- 0:00:53
19000 -- (-1161.087) [-1154.023] (-1153.310) (-1157.562) * (-1159.521) (-1152.401) [-1155.485] (-1155.520) -- 0:00:51
19500 -- [-1153.857] (-1155.068) (-1152.833) (-1153.648) * (-1159.239) (-1149.926) [-1158.089] (-1163.611) -- 0:00:50
20000 -- (-1163.290) (-1162.785) (-1151.378) [-1157.212] * (-1154.890) (-1156.777) (-1157.993) [-1157.507] -- 0:00:49
Average standard deviation of split frequencies: 0.064628
20500 -- (-1153.824) (-1161.278) [-1150.204] (-1158.502) * [-1162.418] (-1152.882) (-1161.205) (-1151.189) -- 0:00:47
21000 -- (-1158.082) (-1149.407) [-1150.827] (-1163.354) * [-1156.193] (-1151.842) (-1155.039) (-1150.848) -- 0:00:46
21500 -- (-1160.010) [-1152.659] (-1155.307) (-1153.039) * [-1155.576] (-1149.578) (-1154.480) (-1155.041) -- 0:00:45
22000 -- (-1160.598) (-1159.004) [-1149.932] (-1158.831) * [-1155.681] (-1149.747) (-1164.197) (-1155.410) -- 0:00:44
22500 -- (-1156.748) [-1156.639] (-1153.433) (-1157.749) * [-1152.398] (-1151.863) (-1150.246) (-1151.271) -- 0:00:43
23000 -- (-1158.244) [-1155.475] (-1151.021) (-1153.626) * [-1156.941] (-1156.811) (-1150.529) (-1153.740) -- 0:00:42
23500 -- [-1153.693] (-1160.885) (-1150.744) (-1153.800) * [-1155.998] (-1153.464) (-1151.113) (-1151.094) -- 0:00:41
24000 -- [-1156.399] (-1156.051) (-1151.166) (-1155.162) * (-1154.988) (-1153.365) [-1151.511] (-1152.335) -- 0:00:40
24500 -- (-1155.478) [-1152.575] (-1151.287) (-1157.766) * [-1154.109] (-1156.093) (-1150.371) (-1151.886) -- 0:00:39
25000 -- [-1154.380] (-1155.132) (-1152.050) (-1153.986) * (-1148.935) (-1151.181) [-1150.992] (-1150.146) -- 0:00:39
Average standard deviation of split frequencies: 0.043357
25500 -- (-1152.319) (-1153.150) (-1151.060) [-1159.771] * (-1152.030) (-1151.810) [-1148.880] (-1151.719) -- 0:00:38
26000 -- [-1154.429] (-1159.609) (-1151.782) (-1154.604) * (-1159.901) [-1150.473] (-1149.258) (-1150.342) -- 0:00:37
26500 -- (-1152.376) (-1158.402) (-1151.135) [-1157.417] * [-1153.493] (-1150.729) (-1154.877) (-1154.110) -- 0:00:36
27000 -- (-1164.790) (-1157.733) [-1151.131] (-1163.467) * [-1155.951] (-1149.896) (-1151.308) (-1151.030) -- 0:00:36
27500 -- [-1154.483] (-1156.780) (-1151.591) (-1154.421) * [-1149.070] (-1154.949) (-1156.277) (-1150.414) -- 0:00:35
28000 -- [-1156.735] (-1157.342) (-1155.195) (-1156.927) * (-1158.024) (-1155.133) (-1151.561) [-1151.581] -- 0:00:34
28500 -- (-1152.514) (-1153.273) (-1151.192) [-1158.934] * (-1163.665) (-1154.282) [-1150.320] (-1150.602) -- 0:01:08
29000 -- (-1162.938) (-1153.281) [-1151.027] (-1159.059) * (-1163.170) (-1155.921) [-1150.656] (-1152.851) -- 0:01:06
29500 -- (-1160.371) (-1154.615) [-1150.539] (-1162.237) * [-1154.954] (-1152.802) (-1154.040) (-1150.970) -- 0:01:05
30000 -- [-1154.548] (-1152.955) (-1150.462) (-1155.110) * (-1156.167) (-1152.175) (-1151.948) [-1150.820] -- 0:01:04
Average standard deviation of split frequencies: 0.038796
30500 -- [-1154.731] (-1155.823) (-1151.146) (-1161.460) * (-1155.958) [-1155.200] (-1152.876) (-1150.929) -- 0:01:03
31000 -- [-1155.430] (-1151.029) (-1149.173) (-1158.264) * (-1158.869) (-1150.605) (-1154.239) [-1150.599] -- 0:01:02
31500 -- [-1154.263] (-1159.499) (-1150.861) (-1159.243) * [-1154.299] (-1151.415) (-1150.771) (-1150.901) -- 0:01:01
32000 -- [-1157.229] (-1150.099) (-1152.138) (-1165.191) * (-1158.925) [-1150.885] (-1155.593) (-1152.516) -- 0:01:00
32500 -- (-1156.743) [-1151.469] (-1151.492) (-1160.193) * [-1155.569] (-1150.964) (-1154.654) (-1150.932) -- 0:00:59
33000 -- (-1154.101) (-1152.969) [-1150.608] (-1156.566) * [-1152.898] (-1155.417) (-1153.685) (-1150.887) -- 0:00:58
33500 -- (-1155.286) (-1152.202) (-1151.207) [-1156.575] * [-1153.208] (-1151.243) (-1150.196) (-1149.460) -- 0:00:57
34000 -- (-1164.366) [-1148.762] (-1151.558) (-1152.713) * (-1153.756) [-1152.555] (-1150.639) (-1151.871) -- 0:00:56
34500 -- [-1152.588] (-1150.168) (-1150.566) (-1157.461) * (-1149.877) [-1150.547] (-1150.496) (-1150.285) -- 0:00:55
35000 -- [-1155.898] (-1151.295) (-1155.536) (-1154.312) * [-1156.478] (-1149.888) (-1151.066) (-1149.889) -- 0:00:55
Average standard deviation of split frequencies: 0.034701
35500 -- (-1157.603) [-1152.432] (-1154.509) (-1155.778) * [-1153.086] (-1150.531) (-1153.625) (-1149.699) -- 0:00:54
36000 -- (-1155.494) (-1150.588) (-1151.152) [-1159.075] * [-1156.601] (-1150.634) (-1154.319) (-1154.015) -- 0:00:53
36500 -- (-1156.899) (-1153.857) [-1150.495] (-1153.417) * (-1151.765) (-1151.049) (-1154.936) [-1149.649] -- 0:00:52
37000 -- [-1154.256] (-1151.732) (-1150.979) (-1159.985) * [-1157.281] (-1151.072) (-1156.129) (-1150.753) -- 0:00:52
37500 -- (-1155.074) (-1153.719) [-1151.064] (-1152.516) * [-1155.704] (-1150.993) (-1159.770) (-1150.644) -- 0:00:51
38000 -- (-1154.286) (-1151.505) (-1153.088) [-1157.577] * (-1152.497) [-1150.972] (-1152.075) (-1151.451) -- 0:00:50
38500 -- (-1159.369) (-1152.365) [-1150.779] (-1157.726) * (-1161.970) (-1151.805) (-1147.932) [-1154.197] -- 0:00:49
39000 -- [-1156.617] (-1150.526) (-1151.506) (-1162.450) * (-1172.991) (-1150.826) [-1148.778] (-1150.902) -- 0:00:49
39500 -- (-1156.877) [-1152.177] (-1151.128) (-1159.579) * (-1152.484) (-1150.566) [-1152.307] (-1151.081) -- 0:00:48
40000 -- (-1156.728) (-1152.625) (-1151.211) [-1158.156] * (-1150.960) [-1150.213] (-1150.930) (-1151.777) -- 0:00:48
Average standard deviation of split frequencies: 0.027241
40500 -- (-1162.224) (-1152.425) (-1153.504) [-1152.343] * [-1149.612] (-1153.180) (-1150.065) (-1150.049) -- 0:00:47
41000 -- [-1153.900] (-1152.925) (-1154.175) (-1159.183) * (-1148.887) (-1153.525) [-1149.188] (-1153.360) -- 0:00:46
41500 -- (-1152.772) [-1150.807] (-1151.655) (-1157.749) * (-1150.635) (-1151.049) [-1150.996] (-1151.817) -- 0:00:46
42000 -- (-1153.025) (-1152.523) [-1150.621] (-1152.114) * (-1152.563) (-1149.471) [-1150.893] (-1152.501) -- 0:00:45
42500 -- [-1151.661] (-1151.972) (-1150.341) (-1158.906) * (-1153.603) [-1147.773] (-1154.990) (-1152.273) -- 0:00:45
43000 -- [-1164.206] (-1153.946) (-1153.279) (-1153.327) * (-1151.502) (-1149.646) (-1154.295) [-1154.984] -- 0:00:44
43500 -- [-1162.822] (-1152.073) (-1151.484) (-1157.505) * (-1150.960) (-1150.474) (-1151.457) [-1150.260] -- 0:01:05
44000 -- (-1160.737) (-1150.261) (-1152.234) [-1153.154] * (-1150.303) (-1148.228) [-1150.546] (-1153.266) -- 0:01:05
44500 -- (-1162.429) (-1151.393) (-1152.576) [-1152.591] * [-1150.142] (-1149.011) (-1149.125) (-1153.642) -- 0:01:04
45000 -- (-1153.454) [-1149.769] (-1149.516) (-1155.491) * (-1152.232) [-1149.527] (-1156.540) (-1151.933) -- 0:01:03
Average standard deviation of split frequencies: 0.026645
45500 -- (-1163.952) [-1149.179] (-1151.102) (-1158.125) * (-1154.538) (-1150.718) (-1157.089) [-1152.339] -- 0:01:02
46000 -- (-1157.899) (-1150.322) [-1151.262] (-1160.928) * (-1151.509) (-1150.353) (-1149.409) [-1151.759] -- 0:01:02
46500 -- [-1157.173] (-1149.538) (-1151.182) (-1157.351) * (-1154.276) [-1151.009] (-1151.412) (-1151.207) -- 0:01:01
47000 -- [-1155.268] (-1151.745) (-1152.563) (-1154.732) * (-1155.210) [-1150.543] (-1150.186) (-1152.288) -- 0:01:00
47500 -- [-1149.772] (-1148.801) (-1151.579) (-1157.414) * [-1152.749] (-1153.148) (-1151.324) (-1152.391) -- 0:01:00
48000 -- (-1153.747) (-1150.476) [-1152.361] (-1156.209) * (-1152.216) (-1153.565) (-1152.205) [-1154.558] -- 0:00:59
48500 -- (-1165.383) (-1153.130) (-1150.725) [-1158.711] * (-1151.196) [-1151.192] (-1152.459) (-1149.251) -- 0:00:58
49000 -- (-1159.357) (-1150.835) (-1150.726) [-1164.152] * (-1150.831) [-1149.059] (-1151.404) (-1150.192) -- 0:00:58
49500 -- (-1156.921) (-1155.698) [-1151.319] (-1161.880) * (-1151.092) [-1149.613] (-1150.169) (-1150.682) -- 0:00:57
50000 -- [-1150.112] (-1152.605) (-1151.464) (-1159.825) * (-1156.581) [-1149.989] (-1150.868) (-1154.656) -- 0:00:57
Average standard deviation of split frequencies: 0.027912
50500 -- [-1154.740] (-1152.670) (-1151.123) (-1149.882) * [-1152.994] (-1150.485) (-1150.390) (-1151.912) -- 0:00:56
51000 -- (-1159.105) [-1151.947] (-1150.247) (-1150.710) * (-1151.473) [-1150.347] (-1152.597) (-1149.492) -- 0:00:55
51500 -- (-1158.618) (-1150.827) (-1153.001) [-1152.148] * (-1151.027) (-1151.348) (-1152.590) [-1151.244] -- 0:00:55
52000 -- (-1159.171) [-1152.516] (-1151.803) (-1152.013) * (-1153.569) (-1149.585) [-1151.207] (-1151.268) -- 0:00:54
52500 -- (-1151.555) [-1152.933] (-1151.950) (-1155.384) * (-1154.358) [-1150.104] (-1150.791) (-1151.033) -- 0:00:54
53000 -- (-1166.936) (-1154.098) (-1152.161) [-1150.631] * (-1153.415) (-1151.658) [-1150.726] (-1151.555) -- 0:00:53
53500 -- [-1154.252] (-1156.805) (-1152.484) (-1151.650) * (-1153.932) (-1152.074) [-1150.017] (-1151.988) -- 0:00:53
54000 -- [-1153.455] (-1152.102) (-1151.543) (-1154.097) * (-1158.894) (-1152.329) (-1153.476) [-1154.742] -- 0:00:52
54500 -- (-1155.072) (-1152.365) (-1153.271) [-1155.027] * [-1152.292] (-1153.037) (-1151.970) (-1151.730) -- 0:00:52
55000 -- [-1155.410] (-1151.729) (-1153.440) (-1156.644) * (-1151.356) (-1152.214) [-1152.354] (-1151.930) -- 0:00:51
Average standard deviation of split frequencies: 0.032068
55500 -- [-1158.747] (-1151.195) (-1155.347) (-1158.330) * (-1149.874) (-1156.644) [-1152.450] (-1150.674) -- 0:00:51
56000 -- [-1155.454] (-1149.661) (-1152.824) (-1161.120) * [-1149.252] (-1155.942) (-1152.173) (-1151.162) -- 0:00:50
56500 -- [-1153.208] (-1148.677) (-1151.569) (-1150.529) * (-1148.541) (-1154.608) [-1152.747] (-1150.123) -- 0:00:50
57000 -- (-1150.971) [-1150.742] (-1153.782) (-1155.319) * (-1151.912) [-1150.801] (-1157.495) (-1154.815) -- 0:00:49
57500 -- (-1155.323) [-1150.188] (-1151.890) (-1152.695) * (-1152.328) [-1150.795] (-1157.025) (-1151.661) -- 0:00:49
58000 -- [-1153.661] (-1150.295) (-1153.191) (-1150.218) * [-1150.767] (-1150.209) (-1151.181) (-1152.196) -- 0:00:48
58500 -- (-1155.725) (-1150.441) (-1150.144) [-1150.981] * (-1149.195) (-1149.956) (-1157.235) [-1149.468] -- 0:01:04
59000 -- (-1159.786) (-1150.669) [-1150.296] (-1152.677) * (-1149.215) (-1152.102) (-1151.956) [-1149.453] -- 0:01:03
59500 -- (-1164.101) (-1149.973) [-1150.827] (-1153.047) * (-1151.789) (-1151.485) (-1152.876) [-1150.558] -- 0:01:03
60000 -- (-1158.108) [-1150.952] (-1154.681) (-1152.467) * (-1150.726) (-1150.626) (-1150.544) [-1150.652] -- 0:01:02
Average standard deviation of split frequencies: 0.028491
60500 -- [-1156.798] (-1150.384) (-1150.044) (-1150.521) * (-1150.831) (-1149.408) (-1149.592) [-1155.022] -- 0:01:02
61000 -- (-1159.193) [-1148.949] (-1151.073) (-1152.234) * (-1150.806) (-1153.620) [-1149.213] (-1154.130) -- 0:01:01
61500 -- [-1154.784] (-1149.989) (-1150.157) (-1152.387) * (-1149.616) (-1150.449) (-1151.484) [-1151.837] -- 0:01:01
62000 -- (-1157.425) [-1148.721] (-1152.222) (-1150.645) * (-1148.831) [-1151.313] (-1151.207) (-1152.949) -- 0:01:00
62500 -- (-1155.710) (-1152.142) [-1148.871] (-1151.129) * (-1148.060) (-1148.446) [-1152.246] (-1152.008) -- 0:01:00
63000 -- (-1163.638) [-1150.621] (-1149.110) (-1152.665) * (-1148.670) (-1150.954) [-1150.139] (-1149.978) -- 0:00:59
63500 -- (-1157.366) (-1151.085) [-1150.836] (-1150.328) * [-1150.140] (-1151.197) (-1151.821) (-1152.635) -- 0:00:58
64000 -- [-1153.042] (-1148.341) (-1149.209) (-1153.254) * (-1155.255) [-1155.214] (-1151.069) (-1149.745) -- 0:00:58
64500 -- (-1156.248) [-1151.653] (-1149.032) (-1152.988) * (-1156.939) [-1148.398] (-1149.008) (-1149.754) -- 0:00:58
65000 -- (-1151.280) [-1153.209] (-1149.991) (-1153.099) * (-1148.935) [-1150.189] (-1154.920) (-1148.541) -- 0:00:57
Average standard deviation of split frequencies: 0.024059
65500 -- [-1154.446] (-1151.610) (-1154.120) (-1151.089) * (-1149.481) [-1150.666] (-1151.750) (-1150.931) -- 0:00:57
66000 -- [-1154.211] (-1156.911) (-1152.667) (-1152.070) * [-1151.150] (-1149.140) (-1152.570) (-1152.016) -- 0:00:56
66500 -- (-1162.747) (-1151.234) (-1152.717) [-1153.190] * (-1154.744) (-1150.235) [-1157.068] (-1150.717) -- 0:00:56
67000 -- [-1154.884] (-1150.950) (-1150.772) (-1150.307) * [-1151.087] (-1150.114) (-1150.642) (-1150.649) -- 0:00:55
67500 -- (-1163.017) [-1149.821] (-1151.357) (-1152.081) * [-1149.929] (-1149.314) (-1153.445) (-1150.468) -- 0:00:55
68000 -- [-1151.079] (-1151.025) (-1151.224) (-1152.499) * [-1150.129] (-1148.804) (-1153.389) (-1149.764) -- 0:00:54
68500 -- (-1152.742) [-1153.773] (-1153.999) (-1152.667) * (-1151.710) (-1149.874) [-1153.859] (-1150.057) -- 0:00:54
69000 -- [-1150.631] (-1150.506) (-1151.092) (-1154.718) * [-1153.678] (-1151.746) (-1150.756) (-1149.954) -- 0:00:53
69500 -- (-1149.826) (-1149.634) (-1152.077) [-1154.358] * (-1150.365) (-1152.742) [-1150.045] (-1152.085) -- 0:00:53
70000 -- (-1150.298) [-1149.820] (-1151.531) (-1156.998) * (-1152.731) (-1153.989) [-1153.140] (-1152.561) -- 0:00:53
Average standard deviation of split frequencies: 0.022681
70500 -- [-1150.405] (-1153.341) (-1148.481) (-1155.132) * (-1155.556) (-1151.880) [-1154.728] (-1152.565) -- 0:00:52
71000 -- (-1152.224) (-1150.864) [-1151.020] (-1157.169) * (-1150.635) [-1153.145] (-1155.162) (-1154.556) -- 0:00:52
71500 -- (-1151.554) (-1156.692) (-1153.383) [-1153.565] * (-1150.178) [-1151.028] (-1153.775) (-1151.916) -- 0:00:51
72000 -- (-1156.050) (-1161.988) (-1152.363) [-1153.718] * [-1150.193] (-1149.726) (-1152.036) (-1152.986) -- 0:00:51
72500 -- [-1154.157] (-1154.012) (-1151.686) (-1150.596) * (-1149.220) (-1152.937) [-1150.429] (-1152.303) -- 0:00:51
73000 -- (-1150.610) (-1154.958) (-1152.129) [-1150.362] * (-1153.745) [-1149.403] (-1150.046) (-1151.570) -- 0:00:50
73500 -- (-1150.861) (-1152.487) (-1150.370) [-1153.630] * (-1152.530) (-1151.371) [-1151.208] (-1150.661) -- 0:00:50
74000 -- (-1152.412) [-1149.404] (-1149.085) (-1150.180) * (-1152.286) [-1152.061] (-1154.903) (-1149.861) -- 0:01:02
74500 -- (-1151.227) (-1148.933) (-1151.693) [-1150.946] * (-1151.309) (-1155.010) (-1156.093) [-1151.174] -- 0:01:02
75000 -- (-1151.297) (-1151.085) [-1152.679] (-1151.070) * (-1152.219) [-1151.075] (-1151.982) (-1151.617) -- 0:01:01
Average standard deviation of split frequencies: 0.023088
75500 -- (-1149.423) (-1151.317) [-1151.703] (-1153.241) * [-1151.527] (-1150.636) (-1150.860) (-1151.151) -- 0:01:01
76000 -- (-1151.698) (-1150.819) [-1151.664] (-1156.452) * (-1149.373) [-1151.287] (-1152.125) (-1150.514) -- 0:01:00
76500 -- [-1150.446] (-1153.393) (-1150.355) (-1154.000) * (-1149.990) [-1151.537] (-1151.266) (-1149.369) -- 0:01:00
77000 -- [-1149.018] (-1153.375) (-1150.322) (-1155.268) * (-1148.749) [-1152.471] (-1150.617) (-1149.157) -- 0:00:59
77500 -- (-1149.741) [-1152.391] (-1150.123) (-1153.102) * (-1152.280) (-1150.662) (-1152.016) [-1150.238] -- 0:00:59
78000 -- [-1151.817] (-1152.209) (-1151.994) (-1151.982) * (-1152.460) (-1149.701) (-1151.115) [-1150.980] -- 0:00:59
78500 -- (-1151.183) (-1152.143) (-1150.356) [-1151.810] * (-1152.678) (-1150.238) [-1151.251] (-1150.584) -- 0:00:58
79000 -- (-1150.017) (-1149.717) (-1150.705) [-1149.259] * (-1150.240) (-1149.692) (-1152.909) [-1151.609] -- 0:00:58
79500 -- (-1151.973) [-1150.619] (-1152.217) (-1153.065) * (-1150.879) (-1149.932) [-1151.638] (-1152.379) -- 0:00:57
80000 -- (-1155.857) [-1150.751] (-1150.606) (-1153.432) * (-1157.236) [-1152.795] (-1151.272) (-1153.139) -- 0:00:57
Average standard deviation of split frequencies: 0.025221
80500 -- [-1152.242] (-1153.093) (-1153.552) (-1151.142) * (-1149.903) (-1152.896) [-1152.619] (-1153.183) -- 0:00:57
81000 -- (-1151.817) (-1151.173) [-1153.179] (-1152.373) * (-1151.468) (-1151.147) (-1154.284) [-1149.753] -- 0:00:56
81500 -- [-1152.669] (-1152.357) (-1151.281) (-1153.689) * [-1152.118] (-1154.040) (-1150.694) (-1151.256) -- 0:00:56
82000 -- (-1152.993) (-1153.543) [-1154.133] (-1154.675) * [-1152.119] (-1153.078) (-1150.924) (-1151.371) -- 0:00:55
82500 -- (-1151.153) [-1151.248] (-1150.284) (-1153.225) * (-1151.353) [-1150.150] (-1150.600) (-1150.592) -- 0:00:55
83000 -- [-1150.905] (-1153.507) (-1151.467) (-1150.408) * (-1150.878) (-1149.714) [-1149.372] (-1151.493) -- 0:00:55
83500 -- [-1149.997] (-1152.841) (-1149.129) (-1150.139) * [-1152.257] (-1149.731) (-1151.148) (-1151.066) -- 0:00:54
84000 -- (-1151.118) (-1152.741) [-1151.094] (-1152.019) * (-1151.887) (-1149.979) (-1153.299) [-1152.333] -- 0:00:54
84500 -- (-1150.389) [-1152.339] (-1149.234) (-1150.769) * (-1151.665) (-1150.887) (-1149.824) [-1150.327] -- 0:00:54
85000 -- (-1149.603) [-1150.338] (-1150.774) (-1150.506) * [-1153.566] (-1150.772) (-1150.594) (-1151.187) -- 0:00:53
Average standard deviation of split frequencies: 0.020621
85500 -- (-1149.576) [-1150.696] (-1151.480) (-1152.860) * [-1153.842] (-1152.778) (-1149.669) (-1151.148) -- 0:00:53
86000 -- [-1151.401] (-1152.966) (-1150.187) (-1152.479) * [-1151.026] (-1149.875) (-1154.799) (-1150.509) -- 0:00:53
86500 -- [-1150.542] (-1151.176) (-1152.229) (-1150.712) * [-1150.120] (-1151.154) (-1152.469) (-1150.529) -- 0:00:52
87000 -- (-1150.451) (-1151.509) (-1150.668) [-1150.220] * [-1149.516] (-1149.039) (-1151.283) (-1153.612) -- 0:00:52
87500 -- (-1151.048) (-1150.773) [-1149.871] (-1155.882) * (-1150.946) (-1153.153) (-1152.180) [-1153.402] -- 0:00:52
88000 -- (-1152.161) [-1151.402] (-1158.712) (-1155.245) * (-1150.882) [-1150.267] (-1153.463) (-1151.420) -- 0:00:51
88500 -- (-1150.023) (-1153.777) [-1153.759] (-1154.051) * (-1152.712) [-1150.733] (-1150.318) (-1151.122) -- 0:00:51
89000 -- (-1150.982) (-1151.487) [-1149.750] (-1150.925) * (-1152.342) [-1149.249] (-1153.586) (-1154.300) -- 0:01:01
89500 -- (-1153.704) [-1151.904] (-1151.735) (-1150.794) * [-1150.471] (-1153.383) (-1153.227) (-1152.932) -- 0:01:01
90000 -- (-1152.781) (-1150.392) (-1150.818) [-1149.591] * (-1149.746) (-1152.206) (-1154.370) [-1150.856] -- 0:01:00
Average standard deviation of split frequencies: 0.021345
90500 -- (-1150.794) (-1150.679) [-1148.537] (-1152.549) * (-1153.645) (-1150.993) [-1151.327] (-1150.470) -- 0:01:00
91000 -- (-1150.086) [-1151.245] (-1150.483) (-1152.583) * (-1154.448) [-1148.594] (-1151.272) (-1151.912) -- 0:00:59
91500 -- (-1150.308) [-1151.315] (-1148.804) (-1154.319) * (-1151.429) (-1150.349) [-1149.929] (-1151.789) -- 0:00:59
92000 -- (-1152.001) [-1148.871] (-1149.584) (-1150.690) * [-1149.731] (-1150.137) (-1149.929) (-1150.413) -- 0:00:59
92500 -- [-1153.795] (-1155.830) (-1151.963) (-1151.170) * [-1152.904] (-1152.108) (-1153.153) (-1152.258) -- 0:00:58
93000 -- (-1151.966) [-1151.278] (-1151.018) (-1149.840) * (-1151.937) [-1149.692] (-1151.869) (-1153.056) -- 0:00:58
93500 -- (-1154.990) (-1152.370) [-1152.262] (-1150.483) * [-1151.315] (-1150.540) (-1150.423) (-1148.649) -- 0:00:58
94000 -- [-1152.938] (-1152.659) (-1152.989) (-1155.565) * [-1153.577] (-1150.589) (-1150.198) (-1149.017) -- 0:00:57
94500 -- (-1151.837) [-1150.078] (-1150.238) (-1151.340) * [-1154.081] (-1150.631) (-1149.476) (-1149.988) -- 0:00:57
95000 -- (-1157.125) (-1151.184) [-1153.757] (-1150.791) * (-1148.765) [-1152.767] (-1150.317) (-1151.532) -- 0:00:57
Average standard deviation of split frequencies: 0.022097
95500 -- [-1154.049] (-1151.250) (-1149.824) (-1151.305) * (-1148.371) (-1151.354) (-1150.609) [-1153.146] -- 0:00:56
96000 -- (-1152.944) [-1151.214] (-1152.200) (-1150.555) * (-1149.653) (-1149.716) [-1151.159] (-1149.813) -- 0:00:56
96500 -- (-1149.738) (-1149.872) (-1151.414) [-1157.802] * (-1150.599) (-1148.820) (-1156.485) [-1151.001] -- 0:00:56
97000 -- (-1150.655) [-1151.644] (-1151.436) (-1154.506) * (-1151.703) (-1152.133) [-1150.863] (-1151.112) -- 0:00:55
97500 -- (-1149.882) (-1150.110) [-1152.169] (-1153.793) * (-1156.062) (-1150.690) [-1151.130] (-1151.355) -- 0:00:55
98000 -- (-1152.303) [-1149.229] (-1149.291) (-1153.774) * [-1151.287] (-1155.514) (-1150.630) (-1153.575) -- 0:00:55
98500 -- (-1152.011) (-1149.577) [-1150.443] (-1151.110) * [-1151.347] (-1152.925) (-1148.872) (-1157.166) -- 0:00:54
99000 -- (-1152.207) (-1150.779) [-1149.589] (-1150.210) * [-1153.847] (-1151.746) (-1150.015) (-1151.158) -- 0:00:54
99500 -- (-1151.733) [-1151.018] (-1152.219) (-1151.637) * (-1152.550) [-1155.307] (-1153.127) (-1151.115) -- 0:00:54
100000 -- (-1151.255) [-1151.999] (-1151.395) (-1151.674) * (-1150.138) [-1154.669] (-1151.825) (-1150.206) -- 0:00:54
Average standard deviation of split frequencies: 0.021593
100500 -- (-1151.210) (-1150.723) [-1149.801] (-1150.022) * (-1152.583) (-1150.259) (-1151.034) [-1149.929] -- 0:00:53
101000 -- (-1151.070) [-1150.270] (-1151.413) (-1151.245) * (-1151.170) (-1150.633) [-1150.813] (-1148.956) -- 0:00:53
101500 -- (-1151.503) (-1150.795) [-1151.054] (-1151.207) * (-1151.700) (-1149.844) [-1152.422] (-1152.146) -- 0:00:53
102000 -- [-1152.425] (-1150.091) (-1150.626) (-1150.914) * [-1150.812] (-1151.351) (-1152.822) (-1152.011) -- 0:00:52
102500 -- (-1153.789) (-1153.205) [-1150.553] (-1149.919) * [-1150.754] (-1153.345) (-1150.056) (-1153.783) -- 0:00:52
103000 -- (-1152.483) (-1151.229) [-1153.709] (-1152.581) * [-1150.585] (-1151.869) (-1151.822) (-1153.981) -- 0:00:52
103500 -- [-1152.368] (-1151.600) (-1150.013) (-1151.149) * (-1151.201) (-1153.050) [-1151.415] (-1153.556) -- 0:01:00
104000 -- (-1149.690) (-1151.431) (-1153.304) [-1151.610] * (-1151.193) (-1152.232) (-1149.631) [-1149.873] -- 0:01:00
104500 -- [-1150.692] (-1150.617) (-1151.026) (-1150.583) * [-1152.194] (-1151.512) (-1150.349) (-1152.938) -- 0:00:59
105000 -- [-1149.835] (-1150.966) (-1152.613) (-1150.192) * (-1152.046) [-1151.657] (-1151.287) (-1151.614) -- 0:00:59
Average standard deviation of split frequencies: 0.021742
105500 -- (-1150.880) (-1151.026) (-1154.544) [-1151.584] * (-1149.418) (-1152.747) [-1149.778] (-1153.514) -- 0:00:59
106000 -- (-1151.372) (-1150.259) (-1151.153) [-1149.091] * (-1153.422) (-1156.625) [-1151.745] (-1153.187) -- 0:00:59
106500 -- (-1151.590) (-1154.625) [-1151.272] (-1149.842) * [-1152.947] (-1152.369) (-1151.438) (-1152.245) -- 0:00:58
107000 -- (-1150.084) (-1149.135) (-1151.230) [-1150.385] * (-1151.917) [-1150.473] (-1154.084) (-1151.039) -- 0:00:58
107500 -- (-1152.474) (-1151.041) [-1149.891] (-1154.762) * (-1150.899) [-1151.249] (-1158.052) (-1150.359) -- 0:00:58
108000 -- (-1150.678) [-1152.203] (-1151.361) (-1149.890) * (-1150.549) (-1151.765) [-1151.078] (-1151.492) -- 0:00:57
108500 -- (-1151.311) [-1149.903] (-1150.977) (-1149.452) * (-1151.413) (-1156.243) (-1149.404) [-1152.327] -- 0:00:57
109000 -- (-1150.974) (-1149.101) [-1149.709] (-1149.992) * [-1152.552] (-1152.492) (-1150.538) (-1149.147) -- 0:00:57
109500 -- (-1151.359) (-1150.692) (-1151.340) [-1149.173] * (-1150.554) (-1150.004) [-1150.725] (-1153.842) -- 0:00:56
110000 -- (-1151.561) (-1153.981) [-1150.189] (-1153.416) * (-1150.910) [-1150.884] (-1149.613) (-1153.874) -- 0:00:56
Average standard deviation of split frequencies: 0.017711
110500 -- (-1151.695) (-1151.384) [-1152.355] (-1150.669) * (-1150.016) (-1153.479) [-1149.491] (-1150.818) -- 0:00:56
111000 -- (-1151.441) [-1147.991] (-1150.397) (-1150.340) * [-1153.178] (-1153.110) (-1151.217) (-1149.441) -- 0:00:56
111500 -- [-1152.181] (-1150.371) (-1149.168) (-1148.627) * (-1150.354) (-1150.762) (-1151.082) [-1151.716] -- 0:00:55
112000 -- (-1153.716) (-1152.402) [-1150.917] (-1151.562) * (-1152.411) [-1149.256] (-1149.432) (-1151.105) -- 0:00:55
112500 -- (-1151.089) (-1150.208) (-1152.367) [-1152.168] * (-1152.632) (-1150.623) [-1152.708] (-1151.481) -- 0:00:55
113000 -- (-1150.606) (-1152.162) [-1150.219] (-1151.847) * (-1150.101) [-1151.917] (-1150.614) (-1152.340) -- 0:00:54
113500 -- (-1150.729) (-1151.611) [-1150.082] (-1150.548) * (-1150.796) (-1152.958) (-1150.690) [-1148.661] -- 0:00:54
114000 -- [-1150.672] (-1151.227) (-1152.684) (-1149.615) * [-1151.630] (-1150.735) (-1153.459) (-1151.669) -- 0:00:54
114500 -- (-1152.943) (-1150.453) [-1153.684] (-1149.833) * (-1149.953) (-1151.641) (-1153.127) [-1153.252] -- 0:00:54
115000 -- [-1153.515] (-1150.640) (-1151.034) (-1150.159) * (-1150.437) (-1154.451) [-1150.476] (-1153.466) -- 0:00:53
Average standard deviation of split frequencies: 0.018608
115500 -- (-1151.432) (-1156.528) (-1150.820) [-1150.758] * (-1152.267) [-1150.123] (-1151.068) (-1150.961) -- 0:00:53
116000 -- (-1150.712) (-1155.211) (-1153.637) [-1150.130] * (-1154.607) [-1149.959] (-1151.914) (-1152.184) -- 0:00:53
116500 -- (-1151.185) (-1150.810) [-1156.392] (-1156.002) * (-1150.470) (-1151.113) [-1149.933] (-1150.821) -- 0:00:53
117000 -- [-1152.007] (-1150.933) (-1151.061) (-1152.585) * (-1150.051) (-1151.758) (-1150.573) [-1150.930] -- 0:00:52
117500 -- (-1150.861) (-1151.702) [-1150.561] (-1151.892) * (-1150.275) [-1152.930] (-1150.660) (-1148.467) -- 0:00:52
118000 -- (-1151.418) (-1151.441) [-1150.027] (-1150.189) * (-1151.974) (-1151.269) (-1152.659) [-1149.810] -- 0:00:52
118500 -- (-1151.054) (-1150.896) [-1150.001] (-1150.557) * (-1152.537) [-1151.758] (-1156.032) (-1151.683) -- 0:00:59
119000 -- (-1151.199) (-1153.299) (-1153.812) [-1150.910] * [-1151.392] (-1152.752) (-1154.253) (-1149.999) -- 0:00:59
119500 -- [-1150.941] (-1151.528) (-1152.697) (-1151.245) * (-1153.856) [-1153.964] (-1153.798) (-1149.122) -- 0:00:58
120000 -- (-1150.804) (-1151.243) [-1150.761] (-1153.587) * (-1155.899) [-1150.813] (-1149.261) (-1149.496) -- 0:00:58
Average standard deviation of split frequencies: 0.018947
120500 -- (-1151.490) (-1149.727) [-1151.263] (-1153.476) * (-1156.092) (-1154.007) [-1153.748] (-1153.271) -- 0:00:58
121000 -- [-1149.454] (-1149.586) (-1152.730) (-1152.095) * (-1154.606) (-1151.686) [-1150.826] (-1155.374) -- 0:00:58
121500 -- [-1149.267] (-1150.857) (-1150.729) (-1152.275) * (-1149.550) (-1153.313) (-1153.487) [-1149.613] -- 0:00:57
122000 -- (-1150.948) [-1150.278] (-1150.328) (-1150.223) * (-1151.987) (-1152.772) (-1152.012) [-1152.052] -- 0:00:57
122500 -- (-1150.825) (-1152.709) [-1154.634] (-1149.939) * [-1152.286] (-1152.318) (-1152.892) (-1151.504) -- 0:00:57
123000 -- (-1150.471) (-1151.622) (-1153.739) [-1150.281] * (-1153.132) [-1152.827] (-1152.532) (-1150.606) -- 0:00:57
123500 -- (-1151.739) [-1150.930] (-1150.590) (-1150.796) * [-1151.865] (-1154.158) (-1152.004) (-1149.312) -- 0:00:56
124000 -- (-1151.629) [-1151.030] (-1151.041) (-1151.224) * (-1153.514) (-1150.885) [-1150.259] (-1153.643) -- 0:00:56
124500 -- (-1151.578) (-1150.639) [-1150.264] (-1150.429) * [-1150.345] (-1151.603) (-1151.427) (-1154.778) -- 0:00:56
125000 -- (-1150.062) [-1152.341] (-1151.858) (-1150.703) * [-1150.642] (-1152.727) (-1153.171) (-1155.503) -- 0:00:56
Average standard deviation of split frequencies: 0.017023
125500 -- [-1151.110] (-1151.096) (-1150.111) (-1154.003) * (-1159.192) (-1150.446) (-1152.727) [-1150.628] -- 0:00:55
126000 -- (-1152.984) [-1150.050] (-1150.824) (-1151.044) * (-1151.734) [-1152.455] (-1149.345) (-1150.793) -- 0:00:55
126500 -- [-1150.858] (-1153.629) (-1152.360) (-1151.088) * (-1151.425) [-1151.217] (-1149.832) (-1154.183) -- 0:00:55
127000 -- (-1150.958) [-1151.684] (-1151.279) (-1152.868) * (-1150.660) (-1151.628) (-1153.856) [-1154.747] -- 0:00:54
127500 -- (-1151.858) [-1147.852] (-1152.290) (-1151.301) * (-1151.579) (-1154.717) [-1154.331] (-1153.345) -- 0:00:54
128000 -- [-1152.189] (-1148.645) (-1152.741) (-1152.689) * (-1150.571) (-1150.424) [-1153.182] (-1149.134) -- 0:00:54
128500 -- (-1152.499) (-1151.112) [-1151.491] (-1153.957) * [-1152.462] (-1150.456) (-1153.250) (-1152.304) -- 0:00:54
129000 -- (-1151.817) (-1150.111) (-1152.151) [-1153.422] * [-1153.155] (-1150.503) (-1156.719) (-1152.296) -- 0:00:54
129500 -- (-1152.148) (-1148.651) [-1152.420] (-1153.712) * (-1152.357) (-1152.069) [-1151.150] (-1150.243) -- 0:00:53
130000 -- (-1153.619) [-1149.912] (-1150.210) (-1151.256) * [-1149.562] (-1153.863) (-1151.374) (-1150.168) -- 0:00:53
Average standard deviation of split frequencies: 0.019350
130500 -- [-1151.745] (-1150.442) (-1151.397) (-1148.599) * [-1152.347] (-1155.711) (-1151.009) (-1150.480) -- 0:00:53
131000 -- (-1152.085) [-1151.238] (-1155.885) (-1148.842) * (-1149.114) (-1153.036) (-1148.751) [-1150.398] -- 0:00:53
131500 -- (-1155.537) (-1151.996) (-1151.940) [-1150.093] * (-1149.883) (-1155.265) [-1150.349] (-1155.536) -- 0:00:52
132000 -- [-1154.512] (-1152.531) (-1152.225) (-1152.406) * (-1148.996) (-1152.776) (-1150.921) [-1148.617] -- 0:00:52
132500 -- [-1156.183] (-1151.052) (-1151.923) (-1151.822) * (-1149.173) (-1152.753) (-1150.063) [-1151.093] -- 0:00:52
133000 -- (-1151.120) (-1156.809) [-1154.650] (-1150.620) * (-1150.844) [-1150.741] (-1150.567) (-1151.748) -- 0:00:58
133500 -- (-1151.072) (-1151.434) [-1150.525] (-1149.999) * (-1155.288) (-1152.836) [-1151.262] (-1149.619) -- 0:00:58
134000 -- (-1150.337) [-1149.029] (-1150.121) (-1151.944) * [-1152.196] (-1151.331) (-1150.656) (-1148.896) -- 0:00:58
134500 -- (-1150.529) [-1151.800] (-1150.736) (-1150.366) * [-1151.673] (-1154.844) (-1150.711) (-1149.556) -- 0:00:57
135000 -- [-1151.215] (-1152.933) (-1152.602) (-1149.279) * [-1152.658] (-1149.139) (-1150.488) (-1150.576) -- 0:00:57
Average standard deviation of split frequencies: 0.018982
135500 -- [-1154.423] (-1152.666) (-1152.495) (-1150.653) * (-1149.927) (-1152.294) [-1148.590] (-1150.620) -- 0:00:57
136000 -- (-1149.685) (-1149.993) (-1154.704) [-1150.040] * [-1151.966] (-1150.901) (-1149.689) (-1149.825) -- 0:00:57
136500 -- (-1152.874) (-1152.286) (-1151.691) [-1150.573] * (-1153.962) (-1150.588) [-1149.690] (-1152.810) -- 0:00:56
137000 -- (-1157.157) (-1154.287) (-1152.012) [-1149.011] * [-1149.849] (-1151.604) (-1150.083) (-1148.608) -- 0:00:56
137500 -- (-1152.767) [-1151.113] (-1151.476) (-1149.824) * (-1152.279) [-1151.738] (-1154.114) (-1152.326) -- 0:00:56
138000 -- (-1150.425) [-1150.046] (-1160.188) (-1150.231) * (-1157.712) [-1150.528] (-1161.187) (-1151.709) -- 0:00:56
138500 -- [-1151.136] (-1150.590) (-1152.115) (-1153.632) * (-1151.615) [-1150.288] (-1156.820) (-1151.991) -- 0:00:55
139000 -- [-1152.233] (-1150.790) (-1151.701) (-1153.079) * (-1152.675) [-1151.279] (-1152.619) (-1151.722) -- 0:00:55
139500 -- (-1153.116) (-1149.443) [-1151.030] (-1150.332) * (-1151.161) [-1150.226] (-1149.548) (-1154.170) -- 0:00:55
140000 -- (-1153.718) [-1148.975] (-1150.187) (-1149.442) * (-1150.787) [-1151.838] (-1155.854) (-1150.649) -- 0:00:55
Average standard deviation of split frequencies: 0.018033
140500 -- (-1152.377) (-1150.223) [-1150.750] (-1153.053) * (-1151.564) [-1150.055] (-1152.698) (-1151.971) -- 0:00:55
141000 -- (-1152.602) [-1150.622] (-1152.107) (-1153.865) * (-1152.924) (-1152.737) [-1150.924] (-1149.966) -- 0:00:54
141500 -- (-1151.244) [-1150.320] (-1150.839) (-1152.328) * (-1150.723) [-1151.180] (-1152.167) (-1150.851) -- 0:00:54
142000 -- (-1152.001) [-1149.486] (-1150.386) (-1150.200) * [-1152.668] (-1150.268) (-1153.699) (-1151.212) -- 0:00:54
142500 -- (-1151.675) (-1150.340) [-1150.275] (-1154.769) * [-1153.980] (-1150.749) (-1152.591) (-1151.889) -- 0:00:54
143000 -- (-1151.327) (-1150.013) [-1150.238] (-1151.953) * [-1152.952] (-1153.305) (-1154.106) (-1149.713) -- 0:00:53
143500 -- [-1152.556] (-1154.421) (-1151.460) (-1150.600) * [-1150.994] (-1153.502) (-1152.902) (-1150.746) -- 0:00:53
144000 -- (-1154.514) [-1149.382] (-1151.593) (-1153.957) * [-1150.809] (-1152.580) (-1152.595) (-1152.515) -- 0:00:53
144500 -- [-1154.597] (-1149.994) (-1149.418) (-1151.146) * (-1155.337) [-1150.554] (-1152.347) (-1154.234) -- 0:00:53
145000 -- (-1155.731) [-1148.639] (-1149.564) (-1152.502) * (-1156.699) [-1149.821] (-1154.122) (-1153.213) -- 0:00:53
Average standard deviation of split frequencies: 0.017528
145500 -- (-1152.848) (-1149.342) (-1152.541) [-1152.764] * (-1150.120) (-1151.131) (-1151.043) [-1154.848] -- 0:00:52
146000 -- (-1152.886) (-1151.369) (-1153.653) [-1155.722] * (-1151.816) (-1150.832) (-1150.476) [-1150.247] -- 0:00:52
146500 -- (-1153.237) (-1153.236) (-1151.183) [-1154.177] * (-1154.386) (-1154.544) [-1149.315] (-1150.924) -- 0:00:52
147000 -- (-1152.211) (-1153.442) [-1151.303] (-1152.129) * (-1149.895) (-1152.620) [-1150.037] (-1152.786) -- 0:00:52
147500 -- [-1151.770] (-1151.294) (-1150.199) (-1153.269) * (-1151.016) (-1154.563) (-1150.850) [-1152.030] -- 0:00:52
148000 -- [-1150.558] (-1153.241) (-1150.163) (-1151.229) * [-1151.135] (-1152.187) (-1154.340) (-1155.432) -- 0:00:57
148500 -- (-1154.802) [-1153.662] (-1151.923) (-1148.881) * (-1151.468) [-1152.931] (-1155.294) (-1151.813) -- 0:00:57
149000 -- (-1152.885) (-1153.024) (-1153.453) [-1151.050] * [-1151.977] (-1151.673) (-1156.252) (-1149.317) -- 0:00:57
149500 -- (-1152.240) (-1150.881) [-1150.344] (-1150.747) * [-1150.980] (-1150.445) (-1152.422) (-1149.915) -- 0:00:56
150000 -- (-1150.002) (-1153.318) [-1149.249] (-1151.701) * (-1150.877) (-1150.875) [-1150.521] (-1149.571) -- 0:00:56
Average standard deviation of split frequencies: 0.015809
150500 -- (-1151.133) (-1150.469) [-1150.906] (-1148.891) * (-1154.614) (-1152.027) [-1153.824] (-1152.707) -- 0:00:56
151000 -- (-1151.271) [-1150.550] (-1151.707) (-1148.169) * [-1151.818] (-1151.096) (-1150.268) (-1154.510) -- 0:00:56
151500 -- (-1156.820) [-1150.822] (-1150.502) (-1151.331) * (-1152.513) [-1150.341] (-1152.168) (-1153.036) -- 0:00:56
152000 -- (-1152.364) (-1154.223) [-1152.307] (-1152.941) * (-1150.944) [-1153.700] (-1151.482) (-1150.713) -- 0:00:55
152500 -- (-1152.102) (-1151.146) (-1151.695) [-1151.818] * (-1150.600) (-1157.382) [-1155.804] (-1154.138) -- 0:00:55
153000 -- (-1156.399) (-1150.351) [-1151.274] (-1154.414) * (-1151.058) (-1153.077) (-1151.535) [-1152.262] -- 0:00:55
153500 -- (-1152.199) (-1150.119) [-1151.680] (-1149.294) * (-1150.373) (-1153.222) (-1150.102) [-1151.223] -- 0:00:55
154000 -- (-1156.323) (-1151.141) [-1150.861] (-1155.151) * [-1150.604] (-1150.987) (-1151.782) (-1152.446) -- 0:00:54
154500 -- [-1152.741] (-1150.568) (-1154.278) (-1153.198) * (-1152.627) [-1150.954] (-1150.246) (-1152.755) -- 0:00:54
155000 -- (-1156.198) (-1153.726) [-1151.436] (-1150.083) * (-1152.397) (-1151.743) [-1149.575] (-1152.725) -- 0:00:54
Average standard deviation of split frequencies: 0.014438
155500 -- (-1151.655) [-1150.734] (-1150.852) (-1153.612) * (-1154.221) (-1152.602) (-1149.810) [-1150.433] -- 0:00:54
156000 -- [-1153.386] (-1151.634) (-1152.574) (-1154.962) * (-1159.644) [-1152.130] (-1149.494) (-1150.852) -- 0:00:54
156500 -- [-1149.767] (-1149.864) (-1149.855) (-1152.935) * (-1156.320) (-1151.705) [-1151.426] (-1156.041) -- 0:00:53
157000 -- [-1150.651] (-1153.153) (-1149.904) (-1157.332) * (-1152.362) (-1150.359) [-1150.485] (-1156.182) -- 0:00:53
157500 -- (-1149.418) (-1152.420) [-1150.489] (-1152.814) * (-1153.676) (-1149.722) (-1152.014) [-1150.050] -- 0:00:53
158000 -- (-1152.783) (-1151.727) [-1151.882] (-1152.368) * (-1153.964) (-1153.100) [-1150.561] (-1151.555) -- 0:00:53
158500 -- (-1151.002) (-1152.244) [-1152.025] (-1154.500) * (-1150.683) (-1153.523) (-1151.738) [-1152.759] -- 0:00:53
159000 -- (-1150.373) (-1153.903) [-1151.956] (-1152.274) * (-1149.395) (-1150.193) [-1151.361] (-1151.019) -- 0:00:52
159500 -- (-1157.586) (-1151.809) (-1157.955) [-1159.183] * (-1151.043) (-1151.800) [-1150.692] (-1158.886) -- 0:00:52
160000 -- (-1151.578) (-1155.619) [-1153.837] (-1156.991) * (-1150.356) [-1155.404] (-1150.738) (-1152.750) -- 0:00:52
Average standard deviation of split frequencies: 0.015485
160500 -- (-1153.157) [-1151.512] (-1150.156) (-1151.717) * [-1151.759] (-1150.849) (-1151.810) (-1151.160) -- 0:00:52
161000 -- (-1152.365) (-1152.757) (-1149.630) [-1151.417] * [-1151.223] (-1151.831) (-1152.794) (-1149.810) -- 0:00:52
161500 -- (-1151.844) (-1151.513) [-1149.431] (-1152.501) * [-1151.778] (-1150.849) (-1151.518) (-1150.992) -- 0:00:51
162000 -- [-1151.963] (-1153.194) (-1153.076) (-1150.683) * (-1150.405) (-1153.158) [-1150.386] (-1150.715) -- 0:00:51
162500 -- [-1151.772] (-1151.202) (-1153.496) (-1150.204) * (-1154.095) [-1149.756] (-1152.153) (-1152.836) -- 0:00:51
163000 -- (-1150.995) (-1153.957) [-1152.965] (-1152.395) * [-1151.809] (-1151.018) (-1152.157) (-1151.015) -- 0:00:56
163500 -- (-1150.329) (-1150.966) (-1154.189) [-1152.661] * (-1150.809) (-1150.659) (-1150.474) [-1150.767] -- 0:00:56
164000 -- (-1152.488) (-1150.272) (-1155.267) [-1150.694] * (-1150.977) [-1149.632] (-1155.221) (-1150.641) -- 0:00:56
164500 -- [-1152.394] (-1151.614) (-1152.541) (-1153.141) * (-1150.203) (-1149.211) [-1149.653] (-1152.956) -- 0:00:55
165000 -- (-1150.919) [-1150.079] (-1152.157) (-1149.827) * (-1150.282) [-1147.861] (-1154.408) (-1151.117) -- 0:00:55
Average standard deviation of split frequencies: 0.014357
165500 -- (-1150.795) (-1151.810) (-1155.933) [-1152.436] * (-1150.198) (-1154.701) (-1149.338) [-1150.776] -- 0:00:55
166000 -- (-1153.009) (-1150.722) [-1153.299] (-1150.112) * (-1150.024) (-1149.883) (-1150.087) [-1152.231] -- 0:00:55
166500 -- (-1153.581) (-1153.393) (-1152.009) [-1151.935] * (-1151.784) [-1150.518] (-1151.478) (-1149.071) -- 0:00:55
167000 -- (-1150.976) (-1152.094) (-1152.070) [-1152.739] * (-1150.972) (-1151.775) [-1152.802] (-1152.394) -- 0:00:54
167500 -- (-1151.296) (-1152.105) (-1151.333) [-1151.666] * (-1150.032) (-1152.167) (-1151.481) [-1150.261] -- 0:00:54
168000 -- (-1150.851) (-1152.013) (-1153.086) [-1149.523] * (-1153.402) [-1151.328] (-1152.359) (-1152.471) -- 0:00:54
168500 -- (-1152.542) (-1151.359) (-1153.356) [-1149.573] * (-1155.392) (-1154.327) (-1152.148) [-1152.083] -- 0:00:54
169000 -- (-1155.477) (-1156.414) (-1153.485) [-1150.673] * (-1151.425) (-1149.529) [-1150.625] (-1150.177) -- 0:00:54
169500 -- (-1151.168) (-1150.896) (-1151.420) [-1149.892] * (-1152.102) (-1151.885) (-1151.599) [-1151.706] -- 0:00:53
170000 -- (-1151.769) (-1155.015) (-1153.423) [-1148.448] * (-1149.954) (-1151.157) (-1150.675) [-1152.404] -- 0:00:53
Average standard deviation of split frequencies: 0.015345
170500 -- (-1152.024) (-1150.437) [-1150.362] (-1151.581) * [-1154.886] (-1151.828) (-1149.200) (-1151.057) -- 0:00:53
171000 -- (-1152.311) (-1149.290) (-1154.430) [-1150.082] * (-1149.904) (-1154.026) (-1156.248) [-1151.661] -- 0:00:53
171500 -- (-1152.168) [-1150.714] (-1154.077) (-1150.046) * (-1151.751) (-1153.752) (-1152.650) [-1152.087] -- 0:00:53
172000 -- (-1151.086) [-1150.925] (-1150.670) (-1156.428) * (-1151.422) (-1154.161) [-1152.192] (-1150.297) -- 0:00:52
172500 -- [-1153.651] (-1152.384) (-1152.379) (-1149.195) * (-1150.279) [-1150.031] (-1150.583) (-1153.331) -- 0:00:52
173000 -- (-1150.642) [-1153.790] (-1150.263) (-1150.232) * (-1151.352) [-1150.720] (-1153.625) (-1150.049) -- 0:00:52
173500 -- (-1151.988) [-1151.811] (-1151.436) (-1151.270) * [-1151.342] (-1151.479) (-1151.017) (-1153.630) -- 0:00:52
174000 -- (-1154.015) (-1150.835) (-1153.516) [-1151.971] * (-1151.467) (-1150.221) [-1156.165] (-1152.387) -- 0:00:52
174500 -- (-1151.989) [-1150.390] (-1150.263) (-1151.139) * (-1151.605) (-1153.066) (-1156.475) [-1151.882] -- 0:00:52
175000 -- (-1151.109) (-1152.184) [-1151.217] (-1150.178) * (-1150.833) (-1152.224) (-1155.329) [-1149.535] -- 0:00:51
Average standard deviation of split frequencies: 0.016219
175500 -- [-1151.088] (-1152.186) (-1149.496) (-1151.498) * (-1150.872) [-1150.399] (-1151.352) (-1151.183) -- 0:00:51
176000 -- (-1150.662) (-1150.674) [-1154.337] (-1152.765) * (-1154.261) (-1150.832) (-1150.990) [-1151.820] -- 0:00:51
176500 -- (-1149.992) (-1151.018) (-1153.983) [-1151.119] * (-1150.910) (-1150.642) [-1150.011] (-1156.246) -- 0:00:55
177000 -- (-1152.681) [-1150.886] (-1153.765) (-1153.892) * (-1149.617) (-1155.585) (-1152.475) [-1153.455] -- 0:00:55
177500 -- (-1150.690) [-1151.068] (-1156.384) (-1152.025) * (-1150.095) [-1155.008] (-1151.715) (-1154.385) -- 0:00:55
178000 -- [-1151.728] (-1151.072) (-1153.328) (-1157.286) * [-1150.926] (-1154.370) (-1153.976) (-1150.515) -- 0:00:55
178500 -- [-1150.745] (-1151.526) (-1150.648) (-1150.518) * (-1149.272) (-1153.264) [-1150.413] (-1153.910) -- 0:00:55
179000 -- (-1153.857) [-1151.202] (-1150.089) (-1151.717) * (-1154.136) [-1150.518] (-1150.942) (-1150.976) -- 0:00:55
179500 -- (-1152.700) (-1151.172) (-1150.680) [-1151.362] * (-1153.944) [-1150.369] (-1150.579) (-1150.739) -- 0:00:54
180000 -- (-1151.608) (-1151.460) (-1155.147) [-1149.080] * (-1153.888) (-1151.923) [-1149.455] (-1151.614) -- 0:00:54
Average standard deviation of split frequencies: 0.016235
180500 -- (-1151.118) (-1150.246) (-1157.176) [-1148.684] * (-1154.697) (-1151.887) (-1150.218) [-1152.457] -- 0:00:54
181000 -- (-1152.864) (-1150.407) (-1152.603) [-1152.439] * (-1152.626) [-1151.651] (-1156.020) (-1153.688) -- 0:00:54
181500 -- (-1151.534) (-1152.249) (-1153.307) [-1152.619] * [-1150.877] (-1150.714) (-1153.147) (-1153.902) -- 0:00:54
182000 -- (-1149.742) (-1152.499) [-1150.720] (-1151.643) * (-1150.102) [-1151.633] (-1148.897) (-1151.025) -- 0:00:53
182500 -- (-1151.643) [-1152.440] (-1152.029) (-1154.298) * (-1150.722) (-1150.848) (-1148.316) [-1151.122] -- 0:00:53
183000 -- [-1154.092] (-1152.518) (-1150.372) (-1150.697) * [-1159.613] (-1151.264) (-1149.595) (-1151.829) -- 0:00:53
183500 -- [-1153.760] (-1153.752) (-1150.111) (-1155.373) * (-1153.963) [-1150.131] (-1151.565) (-1150.894) -- 0:00:53
184000 -- (-1154.681) (-1150.119) [-1150.437] (-1149.869) * [-1152.472] (-1150.062) (-1152.290) (-1154.282) -- 0:00:53
184500 -- (-1154.412) (-1152.023) [-1151.161] (-1150.122) * [-1148.653] (-1150.954) (-1150.650) (-1153.012) -- 0:00:53
185000 -- [-1150.671] (-1151.298) (-1153.462) (-1149.764) * (-1149.861) (-1149.235) (-1152.105) [-1151.803] -- 0:00:52
Average standard deviation of split frequencies: 0.016807
185500 -- (-1152.044) [-1149.694] (-1152.185) (-1149.556) * (-1153.133) [-1151.039] (-1150.130) (-1153.343) -- 0:00:52
186000 -- (-1155.166) (-1150.755) (-1156.626) [-1150.670] * (-1152.878) [-1150.368] (-1150.873) (-1149.759) -- 0:00:52
186500 -- (-1154.127) [-1150.713] (-1153.807) (-1155.609) * [-1155.169] (-1152.518) (-1152.324) (-1149.502) -- 0:00:52
187000 -- (-1151.366) (-1150.780) [-1150.390] (-1155.077) * (-1149.880) (-1150.927) (-1151.127) [-1150.976] -- 0:00:52
187500 -- (-1150.245) (-1155.622) (-1151.557) [-1150.609] * (-1153.195) [-1150.411] (-1150.164) (-1153.742) -- 0:00:52
188000 -- [-1151.103] (-1150.621) (-1152.825) (-1154.611) * (-1153.362) [-1152.779] (-1152.104) (-1154.921) -- 0:00:51
188500 -- [-1154.104] (-1151.302) (-1149.894) (-1150.388) * (-1150.978) (-1152.535) [-1150.038] (-1151.349) -- 0:00:51
189000 -- (-1152.580) (-1152.541) (-1152.090) [-1151.867] * (-1151.968) (-1151.360) [-1150.565] (-1149.704) -- 0:00:51
189500 -- (-1152.047) (-1152.897) [-1150.294] (-1149.572) * (-1152.374) (-1152.542) [-1152.629] (-1150.321) -- 0:00:51
190000 -- (-1151.506) [-1153.398] (-1151.971) (-1150.609) * [-1152.660] (-1152.106) (-1151.967) (-1150.236) -- 0:00:51
Average standard deviation of split frequencies: 0.014574
190500 -- [-1151.983] (-1153.893) (-1151.269) (-1147.918) * [-1150.242] (-1151.581) (-1151.722) (-1149.713) -- 0:00:55
191000 -- [-1150.590] (-1151.846) (-1150.724) (-1152.884) * (-1151.121) [-1151.926] (-1152.084) (-1154.036) -- 0:00:55
191500 -- [-1151.574] (-1150.539) (-1152.224) (-1151.807) * [-1151.245] (-1151.803) (-1152.212) (-1153.191) -- 0:00:54
192000 -- [-1153.169] (-1150.909) (-1152.431) (-1153.179) * (-1151.546) [-1149.258] (-1151.490) (-1151.278) -- 0:00:54
192500 -- [-1151.046] (-1150.660) (-1151.866) (-1151.986) * (-1154.651) [-1149.405] (-1148.715) (-1152.052) -- 0:00:54
193000 -- (-1151.855) (-1151.037) [-1149.705] (-1149.476) * (-1153.774) (-1149.202) [-1150.678] (-1153.057) -- 0:00:54
193500 -- [-1149.928] (-1150.573) (-1154.021) (-1149.288) * (-1149.374) [-1151.061] (-1150.122) (-1151.772) -- 0:00:54
194000 -- [-1151.843] (-1149.804) (-1150.465) (-1151.213) * (-1151.748) (-1152.305) (-1150.896) [-1151.046] -- 0:00:54
194500 -- (-1153.820) (-1154.208) (-1150.078) [-1151.381] * (-1151.445) (-1149.931) [-1150.984] (-1149.367) -- 0:00:53
195000 -- (-1150.091) (-1150.994) (-1154.550) [-1151.273] * [-1151.332] (-1150.579) (-1152.246) (-1150.112) -- 0:00:53
Average standard deviation of split frequencies: 0.012293
195500 -- (-1152.702) (-1152.927) [-1150.176] (-1151.297) * (-1153.326) (-1150.108) (-1152.484) [-1148.498] -- 0:00:53
196000 -- (-1154.252) [-1151.221] (-1150.901) (-1151.535) * (-1151.611) (-1153.927) (-1150.380) [-1148.527] -- 0:00:53
196500 -- (-1153.475) (-1152.552) (-1150.185) [-1148.306] * (-1150.511) (-1150.784) [-1150.482] (-1150.158) -- 0:00:53
197000 -- [-1154.594] (-1153.412) (-1150.568) (-1150.217) * (-1153.443) (-1149.277) (-1151.536) [-1152.155] -- 0:00:52
197500 -- (-1151.966) (-1153.356) (-1150.900) [-1149.906] * (-1152.611) (-1151.283) (-1150.451) [-1151.892] -- 0:00:52
198000 -- (-1151.203) (-1154.745) (-1150.780) [-1152.755] * (-1150.601) [-1151.086] (-1150.375) (-1151.699) -- 0:00:52
198500 -- (-1156.248) (-1152.749) (-1151.323) [-1151.182] * (-1152.050) (-1151.068) [-1148.780] (-1151.181) -- 0:00:52
199000 -- (-1154.113) [-1149.056] (-1149.931) (-1150.755) * [-1148.576] (-1149.338) (-1149.529) (-1150.935) -- 0:00:52
199500 -- [-1152.740] (-1150.319) (-1150.827) (-1150.822) * (-1150.553) (-1150.109) (-1154.642) [-1149.445] -- 0:00:52
200000 -- (-1153.554) (-1152.711) [-1149.811] (-1151.389) * (-1150.456) (-1148.609) [-1149.697] (-1149.096) -- 0:00:51
Average standard deviation of split frequencies: 0.013704
200500 -- (-1152.504) (-1151.509) [-1149.116] (-1151.912) * [-1150.615] (-1148.792) (-1149.248) (-1149.536) -- 0:00:51
201000 -- (-1153.889) [-1149.024] (-1150.710) (-1153.276) * (-1150.426) (-1150.342) (-1148.893) [-1152.017] -- 0:00:51
201500 -- [-1153.620] (-1151.172) (-1152.335) (-1151.474) * (-1153.252) (-1150.855) [-1149.502] (-1151.367) -- 0:00:51
202000 -- (-1154.520) (-1153.005) (-1149.325) [-1151.345] * (-1150.349) [-1153.164] (-1150.812) (-1150.285) -- 0:00:51
202500 -- (-1155.110) [-1150.750] (-1149.824) (-1150.093) * (-1151.991) [-1152.364] (-1155.006) (-1151.704) -- 0:00:51
203000 -- [-1150.360] (-1152.251) (-1148.931) (-1149.208) * (-1154.499) (-1151.391) [-1154.744] (-1152.194) -- 0:00:51
203500 -- [-1150.453] (-1151.308) (-1152.141) (-1151.247) * (-1150.176) [-1150.513] (-1152.649) (-1152.006) -- 0:00:50
204000 -- (-1152.941) (-1151.517) [-1151.179] (-1149.797) * [-1152.930] (-1151.278) (-1155.345) (-1152.348) -- 0:00:50
204500 -- [-1151.153] (-1153.719) (-1151.934) (-1152.574) * (-1151.059) (-1149.750) (-1150.130) [-1152.204] -- 0:00:50
205000 -- (-1152.201) (-1154.165) (-1153.228) [-1150.871] * [-1149.809] (-1153.974) (-1157.170) (-1153.100) -- 0:00:54
Average standard deviation of split frequencies: 0.015416
205500 -- (-1153.342) (-1151.161) [-1153.300] (-1149.480) * (-1150.551) (-1151.011) [-1150.169] (-1153.897) -- 0:00:54
206000 -- (-1152.011) (-1148.601) [-1150.746] (-1153.727) * (-1152.372) [-1149.647] (-1151.541) (-1154.504) -- 0:00:53
206500 -- (-1152.123) (-1152.218) (-1149.035) [-1148.454] * [-1154.878] (-1151.376) (-1149.566) (-1151.310) -- 0:00:53
207000 -- (-1149.741) (-1152.983) (-1152.467) [-1150.714] * (-1152.336) (-1151.176) [-1151.148] (-1152.005) -- 0:00:53
207500 -- (-1152.820) [-1150.324] (-1152.529) (-1150.721) * (-1150.475) (-1151.305) (-1150.054) [-1151.481] -- 0:00:53
208000 -- (-1150.617) [-1150.393] (-1152.189) (-1150.016) * (-1149.514) [-1150.420] (-1152.239) (-1151.447) -- 0:00:53
208500 -- [-1153.092] (-1153.502) (-1150.189) (-1149.991) * (-1150.917) [-1148.391] (-1152.393) (-1159.495) -- 0:00:53
209000 -- (-1151.797) [-1152.515] (-1151.630) (-1152.793) * [-1148.618] (-1152.573) (-1149.428) (-1157.335) -- 0:00:52
209500 -- [-1149.828] (-1153.691) (-1152.136) (-1150.192) * (-1150.176) (-1154.370) (-1153.087) [-1150.192] -- 0:00:52
210000 -- (-1149.180) (-1151.194) [-1149.406] (-1150.128) * (-1149.845) [-1150.869] (-1155.881) (-1150.385) -- 0:00:52
Average standard deviation of split frequencies: 0.013923
210500 -- (-1150.779) (-1151.373) [-1152.654] (-1150.926) * (-1151.368) (-1158.134) (-1153.143) [-1150.590] -- 0:00:52
211000 -- [-1150.843] (-1151.323) (-1148.980) (-1154.412) * (-1154.026) [-1158.084] (-1151.591) (-1152.389) -- 0:00:52
211500 -- (-1151.670) [-1149.491] (-1151.789) (-1150.100) * (-1150.673) (-1152.929) [-1150.367] (-1151.051) -- 0:00:52
212000 -- (-1150.916) (-1154.032) [-1151.342] (-1151.482) * [-1153.198] (-1153.524) (-1150.929) (-1150.158) -- 0:00:52
212500 -- (-1149.441) (-1151.657) (-1150.197) [-1149.948] * (-1150.704) (-1158.734) (-1151.868) [-1152.486] -- 0:00:51
213000 -- [-1150.118] (-1154.439) (-1156.432) (-1151.414) * (-1152.694) [-1149.959] (-1154.498) (-1150.489) -- 0:00:51
213500 -- (-1149.921) [-1153.332] (-1150.545) (-1152.263) * (-1152.727) [-1150.689] (-1153.789) (-1150.050) -- 0:00:51
214000 -- [-1149.173] (-1155.004) (-1153.280) (-1150.525) * (-1151.509) (-1150.822) [-1149.842] (-1150.128) -- 0:00:51
214500 -- (-1151.287) (-1153.643) [-1149.899] (-1150.032) * [-1150.840] (-1153.090) (-1151.977) (-1148.938) -- 0:00:51
215000 -- (-1152.868) [-1151.416] (-1150.619) (-1151.362) * [-1151.786] (-1149.458) (-1149.485) (-1149.821) -- 0:00:51
Average standard deviation of split frequencies: 0.013337
215500 -- [-1150.249] (-1150.942) (-1151.309) (-1153.521) * (-1150.359) (-1152.882) [-1150.406] (-1150.572) -- 0:00:50
216000 -- [-1151.108] (-1150.431) (-1153.256) (-1154.078) * (-1150.612) [-1149.895] (-1152.098) (-1150.018) -- 0:00:50
216500 -- (-1152.671) (-1150.948) (-1153.511) [-1150.192] * (-1150.214) [-1151.861] (-1151.042) (-1150.552) -- 0:00:50
217000 -- (-1150.313) [-1150.660] (-1152.874) (-1149.933) * (-1152.726) (-1152.655) (-1154.133) [-1152.526] -- 0:00:50
217500 -- (-1150.000) [-1151.933] (-1153.567) (-1151.432) * [-1151.528] (-1152.204) (-1151.235) (-1155.885) -- 0:00:50
218000 -- (-1151.168) (-1152.010) [-1153.220] (-1150.594) * (-1151.204) [-1148.789] (-1151.140) (-1152.667) -- 0:00:50
218500 -- (-1150.838) (-1151.904) [-1149.361] (-1151.337) * (-1149.187) [-1151.736] (-1152.521) (-1152.162) -- 0:00:50
219000 -- (-1153.759) (-1152.598) (-1154.145) [-1151.592] * (-1150.379) [-1150.843] (-1154.242) (-1152.108) -- 0:00:49
219500 -- (-1153.565) (-1152.233) [-1151.043] (-1151.003) * (-1151.866) (-1150.768) [-1150.671] (-1154.221) -- 0:00:49
220000 -- (-1154.038) [-1152.386] (-1148.584) (-1151.790) * (-1155.575) (-1149.642) [-1153.122] (-1151.343) -- 0:00:49
Average standard deviation of split frequencies: 0.014954
220500 -- (-1154.819) (-1153.844) [-1148.303] (-1152.339) * (-1154.252) [-1149.432] (-1155.564) (-1151.942) -- 0:00:53
221000 -- (-1157.457) (-1151.361) [-1151.285] (-1152.002) * (-1152.173) [-1151.711] (-1155.788) (-1155.699) -- 0:00:52
221500 -- [-1150.914] (-1150.960) (-1152.370) (-1151.594) * (-1153.400) [-1151.846] (-1158.194) (-1152.895) -- 0:00:52
222000 -- (-1149.768) (-1150.751) [-1150.863] (-1151.419) * (-1151.479) (-1151.676) (-1150.957) [-1152.364] -- 0:00:52
222500 -- (-1152.527) (-1150.032) [-1154.978] (-1150.150) * [-1152.065] (-1152.375) (-1149.366) (-1150.433) -- 0:00:52
223000 -- (-1150.649) (-1151.400) (-1155.647) [-1150.652] * (-1153.887) (-1151.284) [-1151.515] (-1153.431) -- 0:00:52
223500 -- [-1150.410] (-1158.200) (-1154.299) (-1153.848) * [-1151.563] (-1155.467) (-1151.760) (-1150.464) -- 0:00:52
224000 -- (-1151.623) [-1151.160] (-1157.516) (-1151.289) * (-1148.970) (-1154.214) (-1152.481) [-1150.487] -- 0:00:51
224500 -- (-1151.712) (-1150.251) [-1152.032] (-1152.923) * [-1151.003] (-1154.399) (-1150.936) (-1150.349) -- 0:00:51
225000 -- (-1150.931) (-1150.575) (-1154.202) [-1149.459] * (-1151.002) (-1154.081) [-1150.772] (-1149.594) -- 0:00:51
Average standard deviation of split frequencies: 0.014949
225500 -- (-1151.723) (-1150.067) (-1157.128) [-1153.464] * (-1150.516) (-1156.005) [-1149.409] (-1148.564) -- 0:00:51
226000 -- [-1152.117] (-1154.395) (-1154.521) (-1152.926) * [-1148.647] (-1158.038) (-1149.839) (-1151.106) -- 0:00:51
226500 -- (-1154.552) (-1149.789) [-1152.237] (-1150.979) * [-1153.948] (-1154.388) (-1151.670) (-1151.133) -- 0:00:51
227000 -- (-1159.738) (-1151.105) (-1150.630) [-1150.581] * (-1151.073) [-1154.848] (-1151.432) (-1151.270) -- 0:00:51
227500 -- (-1152.344) [-1150.963] (-1156.249) (-1150.122) * (-1150.138) [-1151.599] (-1153.294) (-1152.393) -- 0:00:50
228000 -- [-1149.417] (-1151.747) (-1156.988) (-1159.095) * [-1153.648] (-1156.711) (-1152.014) (-1152.917) -- 0:00:50
228500 -- (-1150.010) (-1155.734) (-1153.797) [-1151.095] * (-1154.271) [-1151.795] (-1153.943) (-1150.274) -- 0:00:50
229000 -- [-1150.323] (-1149.916) (-1151.607) (-1151.666) * (-1150.961) (-1150.538) (-1152.804) [-1150.359] -- 0:00:50
229500 -- (-1152.115) (-1151.157) [-1150.984] (-1150.674) * [-1149.080] (-1151.275) (-1152.707) (-1152.310) -- 0:00:50
230000 -- (-1153.486) (-1152.515) [-1149.980] (-1150.766) * [-1152.999] (-1150.926) (-1150.736) (-1150.839) -- 0:00:50
Average standard deviation of split frequencies: 0.014987
230500 -- (-1149.268) (-1149.556) (-1151.610) [-1150.529] * [-1150.177] (-1150.953) (-1150.846) (-1150.761) -- 0:00:50
231000 -- [-1153.665] (-1152.275) (-1151.892) (-1153.549) * (-1150.268) (-1150.482) (-1151.471) [-1151.179] -- 0:00:49
231500 -- (-1150.479) (-1151.580) [-1149.077] (-1150.461) * [-1148.735] (-1150.592) (-1152.848) (-1151.378) -- 0:00:49
232000 -- [-1153.093] (-1151.585) (-1151.065) (-1150.298) * (-1151.362) (-1150.607) (-1152.780) [-1151.324] -- 0:00:49
232500 -- (-1152.752) (-1150.452) [-1152.236] (-1150.870) * (-1151.423) (-1152.393) (-1155.362) [-1151.224] -- 0:00:49
233000 -- (-1156.891) [-1150.172] (-1151.247) (-1150.166) * (-1152.537) (-1152.455) (-1151.009) [-1150.224] -- 0:00:49
233500 -- [-1151.669] (-1154.903) (-1152.657) (-1150.065) * (-1149.279) (-1150.892) [-1151.687] (-1150.850) -- 0:00:49
234000 -- (-1149.696) (-1156.387) (-1150.637) [-1150.358] * (-1150.050) (-1150.855) (-1150.795) [-1152.647] -- 0:00:49
234500 -- [-1151.135] (-1150.198) (-1152.458) (-1151.132) * [-1148.799] (-1152.142) (-1150.996) (-1149.910) -- 0:00:48
235000 -- (-1150.728) (-1150.693) (-1149.855) [-1150.790] * (-1151.526) (-1152.613) (-1152.571) [-1149.898] -- 0:00:48
Average standard deviation of split frequencies: 0.014426
235500 -- (-1150.239) [-1150.733] (-1149.681) (-1150.505) * (-1149.800) (-1152.373) (-1151.441) [-1151.912] -- 0:00:48
236000 -- [-1151.451] (-1151.249) (-1150.739) (-1151.632) * (-1149.092) [-1152.476] (-1151.308) (-1152.140) -- 0:00:51
236500 -- (-1150.272) [-1152.284] (-1151.580) (-1150.874) * [-1152.473] (-1150.548) (-1150.560) (-1149.686) -- 0:00:51
237000 -- (-1150.169) [-1153.354] (-1147.761) (-1151.668) * [-1149.271] (-1152.121) (-1155.412) (-1150.140) -- 0:00:51
237500 -- (-1150.479) [-1150.960] (-1153.419) (-1155.092) * (-1152.197) [-1150.770] (-1153.989) (-1150.383) -- 0:00:51
238000 -- (-1150.917) (-1150.244) [-1150.787] (-1152.001) * (-1152.667) [-1153.464] (-1152.033) (-1154.991) -- 0:00:51
238500 -- (-1152.318) (-1154.249) [-1150.614] (-1151.676) * [-1152.592] (-1150.391) (-1151.259) (-1152.919) -- 0:00:51
239000 -- (-1151.490) (-1149.972) [-1152.487] (-1154.376) * (-1150.863) (-1150.045) (-1151.792) [-1151.077] -- 0:00:50
239500 -- (-1149.952) (-1150.264) [-1150.965] (-1156.504) * [-1150.130] (-1151.340) (-1150.112) (-1152.496) -- 0:00:50
240000 -- [-1150.764] (-1152.148) (-1150.257) (-1150.263) * (-1151.648) (-1151.262) [-1150.120] (-1152.482) -- 0:00:50
Average standard deviation of split frequencies: 0.013494
240500 -- [-1150.988] (-1150.411) (-1150.976) (-1151.689) * (-1153.981) (-1151.995) [-1150.262] (-1152.816) -- 0:00:50
241000 -- [-1153.644] (-1150.940) (-1149.706) (-1151.873) * (-1153.684) (-1152.253) [-1151.245] (-1153.053) -- 0:00:50
241500 -- (-1151.305) (-1151.631) (-1150.476) [-1152.001] * [-1153.159] (-1155.478) (-1154.672) (-1151.063) -- 0:00:50
242000 -- (-1151.001) (-1153.206) [-1149.151] (-1154.757) * (-1151.219) (-1149.158) (-1158.968) [-1149.668] -- 0:00:50
242500 -- (-1153.353) (-1151.355) [-1149.108] (-1155.616) * (-1150.249) (-1152.981) (-1157.690) [-1152.137] -- 0:00:49
243000 -- (-1152.745) (-1152.120) (-1152.274) [-1150.895] * (-1149.706) (-1151.550) [-1152.325] (-1152.459) -- 0:00:49
243500 -- (-1149.771) (-1153.408) (-1153.060) [-1150.401] * [-1151.379] (-1151.890) (-1150.439) (-1157.533) -- 0:00:49
244000 -- (-1148.986) (-1151.488) (-1157.088) [-1151.205] * (-1149.777) [-1151.012] (-1150.463) (-1153.132) -- 0:00:49
244500 -- (-1150.144) [-1153.038] (-1151.375) (-1151.548) * (-1150.146) (-1149.787) (-1151.934) [-1153.774] -- 0:00:49
245000 -- [-1150.383] (-1154.429) (-1151.642) (-1150.958) * [-1148.499] (-1149.784) (-1151.626) (-1153.034) -- 0:00:49
Average standard deviation of split frequencies: 0.013515
245500 -- (-1154.360) [-1150.311] (-1150.829) (-1151.051) * [-1148.794] (-1151.254) (-1152.439) (-1155.730) -- 0:00:49
246000 -- (-1151.542) (-1150.426) (-1151.261) [-1149.308] * (-1150.035) [-1151.736] (-1151.966) (-1150.626) -- 0:00:49
246500 -- (-1150.592) (-1152.769) [-1150.357] (-1148.598) * (-1149.290) (-1150.248) (-1151.761) [-1152.296] -- 0:00:48
247000 -- (-1151.425) (-1148.602) (-1150.894) [-1151.866] * (-1148.818) (-1154.693) (-1150.340) [-1152.880] -- 0:00:48
247500 -- [-1151.220] (-1153.278) (-1149.895) (-1153.897) * [-1151.636] (-1157.132) (-1151.881) (-1151.706) -- 0:00:48
248000 -- (-1150.212) (-1152.390) [-1151.126] (-1155.416) * (-1149.554) (-1153.954) (-1149.875) [-1151.332] -- 0:00:48
248500 -- [-1149.573] (-1149.457) (-1152.174) (-1155.818) * (-1151.065) (-1150.601) (-1151.918) [-1150.366] -- 0:00:48
249000 -- (-1150.584) (-1151.766) [-1150.564] (-1151.231) * (-1149.890) [-1153.970] (-1150.162) (-1150.180) -- 0:00:48
249500 -- (-1150.798) [-1149.348] (-1152.522) (-1153.445) * (-1148.959) [-1151.509] (-1150.442) (-1155.004) -- 0:00:48
250000 -- (-1149.301) [-1152.052] (-1155.201) (-1151.055) * (-1149.717) (-1152.438) [-1149.980] (-1153.945) -- 0:00:48
Average standard deviation of split frequencies: 0.014209
250500 -- [-1154.916] (-1151.003) (-1157.539) (-1151.694) * (-1150.520) [-1150.327] (-1151.417) (-1154.555) -- 0:00:47
251000 -- (-1156.135) (-1153.591) [-1152.235] (-1151.233) * (-1150.831) (-1151.515) (-1156.583) [-1152.787] -- 0:00:50
251500 -- (-1150.762) (-1154.638) [-1149.139] (-1150.478) * (-1153.428) [-1151.642] (-1151.590) (-1154.979) -- 0:00:50
252000 -- (-1150.671) (-1152.399) [-1151.257] (-1154.597) * (-1151.738) [-1151.867] (-1153.742) (-1151.527) -- 0:00:50
252500 -- [-1149.195] (-1155.460) (-1150.233) (-1155.120) * (-1149.425) (-1155.679) (-1156.836) [-1149.725] -- 0:00:50
253000 -- [-1150.107] (-1151.366) (-1153.632) (-1153.800) * (-1151.562) (-1152.863) (-1158.833) [-1149.849] -- 0:00:50
253500 -- (-1150.050) (-1149.632) (-1149.115) [-1150.271] * [-1152.004] (-1150.784) (-1152.888) (-1150.620) -- 0:00:50
254000 -- (-1153.431) (-1150.551) [-1153.241] (-1152.625) * (-1150.608) (-1150.291) (-1155.436) [-1152.299] -- 0:00:49
254500 -- (-1151.940) (-1150.184) (-1152.618) [-1150.294] * (-1149.744) [-1155.023] (-1155.094) (-1152.558) -- 0:00:49
255000 -- (-1150.182) (-1149.520) (-1151.514) [-1151.469] * (-1151.185) (-1150.307) [-1155.545] (-1151.571) -- 0:00:49
Average standard deviation of split frequencies: 0.015381
255500 -- [-1148.887] (-1150.782) (-1150.806) (-1151.212) * (-1149.558) (-1152.099) (-1150.808) [-1150.176] -- 0:00:49
256000 -- (-1148.548) (-1151.696) [-1151.318] (-1151.573) * (-1150.226) (-1152.197) [-1151.226] (-1166.406) -- 0:00:49
256500 -- (-1149.422) (-1151.938) [-1151.189] (-1151.813) * (-1149.532) [-1150.221] (-1149.134) (-1151.661) -- 0:00:49
257000 -- (-1149.844) [-1150.617] (-1152.204) (-1154.034) * (-1149.570) [-1151.691] (-1150.426) (-1153.174) -- 0:00:49
257500 -- (-1151.918) (-1152.209) [-1148.294] (-1150.506) * (-1150.514) (-1151.243) [-1151.179] (-1154.012) -- 0:00:49
258000 -- [-1148.924] (-1151.220) (-1150.558) (-1151.759) * (-1150.621) (-1156.299) (-1155.360) [-1150.575] -- 0:00:48
258500 -- (-1150.357) (-1150.131) [-1150.060] (-1151.641) * (-1150.702) [-1150.359] (-1153.791) (-1152.534) -- 0:00:48
259000 -- (-1149.469) [-1149.150] (-1150.308) (-1152.436) * (-1151.888) [-1150.326] (-1152.885) (-1151.789) -- 0:00:48
259500 -- (-1150.828) (-1154.811) (-1151.046) [-1149.285] * [-1148.913] (-1151.468) (-1151.758) (-1153.688) -- 0:00:48
260000 -- [-1151.127] (-1153.449) (-1151.603) (-1150.743) * (-1148.821) (-1150.836) (-1153.879) [-1151.851] -- 0:00:48
Average standard deviation of split frequencies: 0.014468
260500 -- (-1149.183) (-1151.613) (-1152.316) [-1150.128] * (-1150.580) [-1149.166] (-1151.950) (-1151.799) -- 0:00:48
261000 -- (-1150.447) (-1152.855) [-1150.564] (-1150.909) * (-1152.062) (-1149.410) [-1149.952] (-1159.198) -- 0:00:48
261500 -- (-1149.536) [-1152.029] (-1151.553) (-1150.779) * (-1150.562) [-1148.931] (-1150.568) (-1156.835) -- 0:00:48
262000 -- (-1149.393) (-1152.785) (-1149.979) [-1151.644] * (-1150.928) [-1152.583] (-1151.339) (-1149.795) -- 0:00:47
262500 -- (-1151.567) (-1151.156) [-1154.088] (-1156.021) * (-1151.639) (-1151.963) (-1151.671) [-1152.001] -- 0:00:47
263000 -- (-1150.760) (-1152.554) [-1151.081] (-1155.823) * (-1151.152) (-1151.226) (-1150.085) [-1151.887] -- 0:00:47
263500 -- (-1150.628) (-1151.364) [-1151.897] (-1152.531) * (-1149.413) (-1150.509) [-1151.308] (-1151.764) -- 0:00:47
264000 -- [-1150.493] (-1152.392) (-1150.735) (-1149.199) * (-1154.293) (-1151.527) (-1152.222) [-1150.156] -- 0:00:47
264500 -- (-1151.574) [-1150.687] (-1150.974) (-1150.797) * (-1151.539) [-1150.052] (-1153.071) (-1152.485) -- 0:00:47
265000 -- [-1150.877] (-1151.735) (-1151.938) (-1153.238) * (-1152.992) [-1149.878] (-1150.024) (-1149.065) -- 0:00:47
Average standard deviation of split frequencies: 0.014282
265500 -- (-1149.885) (-1152.982) [-1151.479] (-1151.907) * (-1152.658) (-1152.817) (-1152.746) [-1150.653] -- 0:00:47
266000 -- (-1148.935) (-1152.675) [-1149.686] (-1152.468) * (-1152.981) (-1149.566) (-1150.824) [-1149.290] -- 0:00:49
266500 -- (-1151.036) (-1151.156) [-1154.008] (-1150.523) * (-1151.380) [-1151.511] (-1151.855) (-1150.866) -- 0:00:49
267000 -- (-1150.386) [-1150.277] (-1156.235) (-1150.396) * (-1151.830) [-1151.460] (-1150.214) (-1152.374) -- 0:00:49
267500 -- [-1153.074] (-1149.397) (-1151.741) (-1150.790) * (-1151.282) [-1151.785] (-1151.371) (-1151.712) -- 0:00:49
268000 -- [-1150.499] (-1149.635) (-1149.064) (-1148.669) * (-1151.382) (-1150.062) (-1150.497) [-1149.183] -- 0:00:49
268500 -- (-1148.731) [-1149.965] (-1149.893) (-1151.746) * (-1151.686) (-1150.462) [-1150.989] (-1149.681) -- 0:00:49
269000 -- (-1153.655) (-1151.161) [-1149.627] (-1150.459) * (-1150.601) (-1152.629) [-1151.609] (-1149.839) -- 0:00:48
269500 -- (-1152.476) (-1150.143) (-1150.792) [-1153.041] * (-1153.242) (-1152.478) (-1150.015) [-1149.883] -- 0:00:48
270000 -- [-1150.707] (-1150.710) (-1150.087) (-1151.636) * (-1151.519) (-1153.243) [-1150.116] (-1152.374) -- 0:00:48
Average standard deviation of split frequencies: 0.012191
270500 -- (-1152.727) [-1150.200] (-1149.488) (-1153.783) * [-1151.975] (-1150.780) (-1151.155) (-1153.458) -- 0:00:48
271000 -- (-1152.607) (-1150.423) (-1151.872) [-1152.854] * [-1152.435] (-1151.126) (-1153.623) (-1149.430) -- 0:00:48
271500 -- (-1151.116) (-1151.428) [-1150.611] (-1150.805) * (-1152.449) [-1150.547] (-1155.526) (-1154.031) -- 0:00:48
272000 -- (-1157.113) (-1150.600) (-1152.541) [-1149.867] * (-1151.371) (-1151.973) (-1151.330) [-1150.271] -- 0:00:48
272500 -- (-1151.483) (-1150.542) (-1153.799) [-1149.555] * (-1151.101) (-1150.488) [-1152.364] (-1151.472) -- 0:00:48
273000 -- (-1151.532) (-1150.154) [-1151.444] (-1150.966) * (-1150.668) [-1152.083] (-1151.020) (-1152.568) -- 0:00:47
273500 -- (-1151.357) [-1150.492] (-1152.121) (-1150.629) * [-1151.841] (-1151.638) (-1151.520) (-1153.893) -- 0:00:47
274000 -- (-1153.048) (-1150.761) (-1153.283) [-1148.985] * (-1153.586) [-1152.859] (-1151.809) (-1150.139) -- 0:00:47
274500 -- (-1152.964) (-1157.079) [-1153.397] (-1149.724) * (-1152.328) (-1150.782) (-1152.793) [-1151.570] -- 0:00:47
275000 -- (-1152.249) [-1152.877] (-1151.712) (-1151.376) * (-1150.801) (-1149.845) [-1154.621] (-1151.282) -- 0:00:47
Average standard deviation of split frequencies: 0.013162
275500 -- (-1153.986) [-1149.414] (-1155.465) (-1152.899) * (-1156.872) (-1150.154) (-1152.093) [-1150.808] -- 0:00:47
276000 -- (-1155.204) [-1149.737] (-1153.495) (-1150.192) * (-1151.525) [-1149.781] (-1150.848) (-1152.428) -- 0:00:47
276500 -- (-1150.892) (-1148.896) (-1150.658) [-1151.190] * [-1152.172] (-1152.041) (-1152.214) (-1150.527) -- 0:00:47
277000 -- [-1151.526] (-1152.331) (-1148.915) (-1153.811) * (-1150.429) [-1151.202] (-1151.156) (-1152.973) -- 0:00:46
277500 -- [-1153.982] (-1153.470) (-1149.892) (-1150.289) * (-1152.885) (-1150.905) [-1151.068] (-1153.001) -- 0:00:46
278000 -- (-1151.338) (-1151.441) (-1150.532) [-1149.964] * (-1150.144) (-1155.827) [-1149.384] (-1154.071) -- 0:00:46
278500 -- (-1152.221) (-1156.134) [-1149.159] (-1150.643) * (-1150.906) (-1150.296) (-1152.417) [-1149.670] -- 0:00:46
279000 -- (-1154.909) (-1152.586) [-1151.506] (-1153.464) * (-1151.445) (-1152.301) (-1152.460) [-1152.920] -- 0:00:46
279500 -- (-1151.001) (-1151.183) [-1149.526] (-1157.197) * [-1152.626] (-1150.271) (-1151.609) (-1153.516) -- 0:00:46
280000 -- (-1150.106) (-1150.121) [-1150.479] (-1151.269) * (-1157.253) (-1151.766) (-1153.939) [-1151.982] -- 0:00:46
Average standard deviation of split frequencies: 0.014622
280500 -- (-1150.341) (-1151.311) [-1149.460] (-1153.426) * (-1152.406) (-1151.404) [-1150.957] (-1152.667) -- 0:00:46
281000 -- (-1149.941) (-1150.884) [-1150.457] (-1149.739) * (-1151.043) [-1151.949] (-1152.452) (-1151.404) -- 0:00:48
281500 -- (-1150.822) (-1150.660) [-1151.731] (-1149.663) * [-1151.369] (-1152.585) (-1153.289) (-1157.981) -- 0:00:48
282000 -- (-1151.164) (-1152.647) (-1151.974) [-1152.493] * (-1151.291) [-1151.349] (-1153.368) (-1152.700) -- 0:00:48
282500 -- [-1150.675] (-1151.417) (-1150.786) (-1148.708) * (-1152.547) (-1151.109) (-1150.027) [-1150.691] -- 0:00:48
283000 -- (-1157.631) [-1153.453] (-1153.289) (-1154.057) * (-1152.616) (-1149.849) [-1151.947] (-1154.226) -- 0:00:48
283500 -- (-1150.688) (-1154.888) [-1150.607] (-1153.210) * (-1150.181) (-1154.124) [-1153.355] (-1153.540) -- 0:00:48
284000 -- (-1151.048) (-1151.947) [-1150.259] (-1149.845) * (-1149.997) [-1150.419] (-1149.618) (-1149.748) -- 0:00:47
284500 -- (-1151.855) (-1152.508) (-1150.848) [-1150.889] * [-1151.926] (-1150.151) (-1149.701) (-1149.096) -- 0:00:47
285000 -- (-1149.796) (-1149.111) [-1150.339] (-1150.869) * [-1150.238] (-1150.314) (-1150.589) (-1152.182) -- 0:00:47
Average standard deviation of split frequencies: 0.014350
285500 -- (-1152.975) [-1150.731] (-1148.641) (-1153.436) * (-1152.861) [-1153.361] (-1149.862) (-1156.116) -- 0:00:47
286000 -- (-1149.010) (-1151.278) (-1156.475) [-1151.088] * (-1152.988) (-1155.376) [-1149.871] (-1155.216) -- 0:00:47
286500 -- (-1150.742) (-1153.636) (-1152.578) [-1151.095] * [-1150.551] (-1154.452) (-1152.096) (-1150.046) -- 0:00:47
287000 -- (-1151.845) [-1150.695] (-1149.295) (-1152.071) * (-1152.112) [-1155.761] (-1149.444) (-1149.298) -- 0:00:47
287500 -- (-1152.679) (-1150.504) (-1150.340) [-1149.570] * (-1152.774) (-1155.074) (-1149.903) [-1150.082] -- 0:00:47
288000 -- [-1150.398] (-1150.446) (-1155.736) (-1150.253) * (-1151.860) [-1152.024] (-1151.387) (-1152.417) -- 0:00:46
288500 -- (-1150.234) (-1151.488) (-1150.852) [-1150.940] * (-1156.079) (-1152.125) [-1152.251] (-1152.606) -- 0:00:46
289000 -- (-1151.087) (-1151.997) [-1150.864] (-1154.452) * (-1151.605) [-1150.475] (-1149.684) (-1151.365) -- 0:00:46
289500 -- (-1150.801) [-1149.220] (-1152.428) (-1151.560) * [-1150.459] (-1149.787) (-1151.492) (-1150.277) -- 0:00:46
290000 -- (-1149.948) [-1150.025] (-1151.555) (-1152.146) * (-1151.440) [-1150.401] (-1151.287) (-1148.837) -- 0:00:46
Average standard deviation of split frequencies: 0.014119
290500 -- (-1149.599) (-1150.293) (-1151.882) [-1150.500] * (-1151.951) [-1149.510] (-1149.475) (-1151.314) -- 0:00:46
291000 -- (-1154.231) (-1154.418) (-1154.513) [-1152.545] * [-1151.508] (-1151.441) (-1150.700) (-1151.485) -- 0:00:46
291500 -- (-1150.273) [-1151.644] (-1153.726) (-1150.129) * (-1151.156) (-1150.001) [-1150.891] (-1155.574) -- 0:00:46
292000 -- (-1151.187) [-1151.483] (-1151.043) (-1149.948) * (-1151.596) [-1151.058] (-1150.367) (-1149.721) -- 0:00:46
292500 -- (-1151.356) (-1150.848) [-1154.995] (-1149.997) * (-1150.408) (-1149.578) [-1150.235] (-1149.944) -- 0:00:45
293000 -- (-1151.124) (-1149.570) [-1150.143] (-1157.439) * (-1151.434) [-1149.200] (-1151.348) (-1150.327) -- 0:00:45
293500 -- (-1151.075) [-1150.159] (-1151.098) (-1158.370) * (-1150.753) [-1148.429] (-1151.373) (-1151.767) -- 0:00:45
294000 -- (-1150.671) (-1149.894) (-1149.490) [-1151.768] * (-1150.392) (-1151.046) [-1154.029] (-1153.774) -- 0:00:45
294500 -- [-1149.945] (-1152.606) (-1153.493) (-1152.189) * [-1150.360] (-1150.305) (-1151.053) (-1153.782) -- 0:00:45
295000 -- (-1151.832) [-1150.055] (-1149.451) (-1152.124) * (-1149.868) (-1152.880) [-1150.956] (-1151.702) -- 0:00:45
Average standard deviation of split frequencies: 0.013865
295500 -- (-1151.421) [-1149.677] (-1151.121) (-1153.187) * (-1150.691) [-1153.654] (-1152.070) (-1152.693) -- 0:00:45
296000 -- (-1153.811) [-1149.355] (-1149.956) (-1152.656) * [-1152.629] (-1153.987) (-1149.085) (-1150.891) -- 0:00:45
296500 -- (-1152.389) [-1149.910] (-1153.558) (-1150.674) * (-1150.314) (-1156.948) [-1149.918] (-1150.084) -- 0:00:47
297000 -- (-1150.258) (-1150.302) [-1152.455] (-1148.596) * [-1153.576] (-1150.615) (-1149.257) (-1151.462) -- 0:00:47
297500 -- [-1150.790] (-1149.401) (-1152.404) (-1153.978) * [-1153.069] (-1150.222) (-1152.065) (-1153.104) -- 0:00:47
298000 -- (-1148.025) (-1149.327) (-1152.329) [-1153.318] * (-1149.952) (-1152.235) (-1149.383) [-1150.264] -- 0:00:47
298500 -- (-1149.714) (-1150.077) [-1153.403] (-1157.585) * (-1152.788) (-1150.307) [-1150.429] (-1150.527) -- 0:00:47
299000 -- [-1149.778] (-1152.448) (-1150.788) (-1149.300) * (-1150.364) (-1150.547) (-1151.994) [-1148.861] -- 0:00:46
299500 -- (-1155.743) [-1148.825] (-1150.686) (-1151.823) * (-1150.703) [-1150.505] (-1151.700) (-1149.760) -- 0:00:46
300000 -- (-1150.913) (-1152.961) (-1150.889) [-1149.829] * (-1149.808) (-1155.128) [-1148.909] (-1151.151) -- 0:00:46
Average standard deviation of split frequencies: 0.014019
300500 -- [-1153.345] (-1149.804) (-1150.858) (-1154.846) * (-1151.621) (-1151.715) (-1150.940) [-1149.944] -- 0:00:46
301000 -- (-1152.592) (-1151.620) [-1151.746] (-1149.924) * (-1149.848) (-1154.342) [-1150.830] (-1150.360) -- 0:00:46
301500 -- (-1151.205) (-1152.842) [-1151.628] (-1149.821) * (-1153.413) (-1154.004) [-1150.825] (-1149.530) -- 0:00:46
302000 -- [-1151.960] (-1151.614) (-1151.973) (-1155.177) * (-1151.997) [-1153.666] (-1151.024) (-1154.962) -- 0:00:46
302500 -- [-1151.406] (-1152.500) (-1153.476) (-1152.013) * (-1150.968) (-1151.250) (-1155.358) [-1153.402] -- 0:00:46
303000 -- (-1151.558) (-1150.675) [-1150.434] (-1156.855) * [-1153.372] (-1151.341) (-1152.376) (-1150.596) -- 0:00:46
303500 -- [-1151.831] (-1151.744) (-1149.940) (-1156.947) * (-1151.343) (-1153.581) (-1151.439) [-1150.105] -- 0:00:45
304000 -- (-1150.189) (-1151.029) [-1153.933] (-1152.186) * [-1150.856] (-1151.281) (-1155.422) (-1154.669) -- 0:00:45
304500 -- (-1154.127) (-1151.428) (-1154.645) [-1150.462] * [-1151.395] (-1153.580) (-1150.800) (-1150.020) -- 0:00:45
305000 -- (-1149.976) (-1154.302) (-1153.523) [-1151.315] * (-1150.776) [-1150.769] (-1153.825) (-1150.836) -- 0:00:45
Average standard deviation of split frequencies: 0.014227
305500 -- (-1155.066) (-1155.637) [-1151.104] (-1151.525) * (-1153.411) [-1149.827] (-1151.448) (-1151.308) -- 0:00:45
306000 -- (-1150.551) (-1152.558) (-1149.593) [-1150.461] * (-1154.156) (-1156.231) (-1148.704) [-1152.621] -- 0:00:45
306500 -- (-1152.538) (-1153.554) [-1150.968] (-1149.311) * (-1150.271) (-1154.467) (-1150.341) [-1151.415] -- 0:00:45
307000 -- (-1151.723) (-1151.250) [-1152.661] (-1150.554) * (-1151.120) (-1154.277) [-1152.553] (-1151.210) -- 0:00:45
307500 -- (-1152.476) [-1151.818] (-1150.715) (-1153.136) * (-1153.065) (-1150.670) [-1154.434] (-1153.049) -- 0:00:45
308000 -- [-1150.538] (-1151.806) (-1153.366) (-1151.051) * (-1152.831) (-1148.955) (-1153.613) [-1151.818] -- 0:00:44
308500 -- (-1152.514) (-1152.665) [-1150.122] (-1155.669) * (-1153.376) (-1148.872) [-1150.239] (-1151.885) -- 0:00:44
309000 -- (-1152.653) (-1150.641) [-1151.034] (-1153.669) * (-1154.422) (-1152.383) (-1149.781) [-1152.121] -- 0:00:44
309500 -- (-1150.406) (-1150.692) (-1150.364) [-1149.725] * (-1150.836) [-1150.031] (-1151.114) (-1150.342) -- 0:00:44
310000 -- (-1151.937) (-1152.006) (-1152.184) [-1150.948] * (-1151.108) (-1152.380) [-1150.297] (-1151.503) -- 0:00:44
Average standard deviation of split frequencies: 0.013562
310500 -- [-1151.383] (-1153.542) (-1150.320) (-1150.920) * (-1154.371) (-1150.273) [-1149.772] (-1152.792) -- 0:00:44
311000 -- (-1152.294) (-1155.018) (-1150.419) [-1152.180] * (-1153.375) (-1152.566) [-1149.239] (-1152.734) -- 0:00:44
311500 -- (-1151.154) (-1153.010) [-1152.102] (-1149.910) * [-1153.917] (-1151.029) (-1151.395) (-1152.167) -- 0:00:46
312000 -- (-1151.091) [-1152.077] (-1151.136) (-1149.847) * (-1159.388) [-1152.533] (-1150.268) (-1150.007) -- 0:00:46
312500 -- (-1150.815) (-1151.705) [-1152.480] (-1151.072) * (-1150.833) (-1150.107) (-1151.625) [-1149.766] -- 0:00:46
313000 -- [-1149.783] (-1151.817) (-1152.961) (-1149.396) * (-1150.591) (-1152.990) [-1149.921] (-1150.236) -- 0:00:46
313500 -- [-1150.204] (-1153.184) (-1153.151) (-1151.079) * (-1150.975) [-1153.352] (-1154.260) (-1148.814) -- 0:00:45
314000 -- [-1152.273] (-1153.057) (-1151.481) (-1152.580) * (-1153.297) (-1149.317) [-1153.145] (-1150.874) -- 0:00:45
314500 -- (-1150.025) [-1155.476] (-1151.330) (-1150.220) * (-1150.394) (-1150.749) [-1150.729] (-1149.376) -- 0:00:45
315000 -- [-1154.530] (-1152.510) (-1155.510) (-1150.457) * (-1154.758) [-1153.470] (-1151.868) (-1151.953) -- 0:00:45
Average standard deviation of split frequencies: 0.013146
315500 -- (-1150.945) (-1154.527) (-1157.000) [-1149.902] * (-1149.474) (-1155.101) (-1152.556) [-1150.448] -- 0:00:45
316000 -- (-1152.817) (-1156.771) [-1151.753] (-1150.098) * (-1150.792) [-1149.842] (-1149.177) (-1152.064) -- 0:00:45
316500 -- [-1150.571] (-1157.075) (-1151.544) (-1150.147) * [-1150.614] (-1153.091) (-1152.807) (-1153.289) -- 0:00:45
317000 -- (-1151.495) (-1152.731) [-1150.636] (-1155.585) * (-1153.809) (-1150.140) [-1149.206] (-1150.948) -- 0:00:45
317500 -- (-1150.615) (-1150.998) (-1150.405) [-1152.331] * (-1150.531) [-1151.700] (-1149.822) (-1151.422) -- 0:00:45
318000 -- (-1150.233) [-1150.208] (-1150.732) (-1154.797) * (-1151.882) (-1150.697) [-1149.673] (-1151.204) -- 0:00:45
318500 -- [-1151.448] (-1150.186) (-1150.194) (-1152.746) * (-1152.641) (-1151.344) [-1148.905] (-1151.786) -- 0:00:44
319000 -- (-1151.844) [-1150.081] (-1150.605) (-1152.639) * (-1152.813) (-1151.079) [-1152.197] (-1149.798) -- 0:00:44
319500 -- [-1150.302] (-1151.167) (-1150.204) (-1151.363) * (-1151.452) (-1152.680) [-1150.030] (-1154.001) -- 0:00:44
320000 -- (-1149.226) (-1151.512) [-1150.077] (-1156.103) * (-1152.611) [-1149.089] (-1152.615) (-1153.161) -- 0:00:44
Average standard deviation of split frequencies: 0.012496
320500 -- (-1151.402) (-1150.853) [-1150.260] (-1151.990) * [-1150.892] (-1148.817) (-1151.845) (-1151.279) -- 0:00:44
321000 -- (-1153.826) (-1150.876) [-1151.330] (-1150.304) * (-1150.484) [-1150.543] (-1156.488) (-1150.939) -- 0:00:44
321500 -- [-1150.425] (-1150.174) (-1154.846) (-1150.753) * (-1151.975) [-1150.392] (-1150.069) (-1150.539) -- 0:00:44
322000 -- (-1151.378) (-1152.364) [-1150.701] (-1150.787) * (-1157.327) (-1150.595) (-1149.842) [-1154.304] -- 0:00:44
322500 -- (-1151.647) (-1152.164) [-1150.069] (-1149.290) * (-1152.020) (-1150.835) (-1152.785) [-1150.019] -- 0:00:44
323000 -- (-1153.306) (-1153.908) [-1149.733] (-1154.628) * (-1149.933) [-1153.162] (-1152.131) (-1152.466) -- 0:00:44
323500 -- (-1151.060) (-1152.481) [-1149.422] (-1149.032) * (-1149.885) (-1149.809) (-1149.430) [-1151.806] -- 0:00:43
324000 -- (-1150.598) [-1153.501] (-1150.442) (-1150.884) * [-1152.419] (-1149.950) (-1151.395) (-1155.503) -- 0:00:43
324500 -- [-1149.963] (-1151.258) (-1150.936) (-1152.178) * (-1149.502) [-1151.445] (-1149.967) (-1153.075) -- 0:00:43
325000 -- (-1152.261) (-1151.360) [-1151.713] (-1151.847) * (-1150.119) (-1150.688) (-1151.292) [-1151.159] -- 0:00:43
Average standard deviation of split frequencies: 0.012472
325500 -- [-1148.872] (-1150.775) (-1151.831) (-1152.598) * (-1151.543) (-1153.257) (-1157.289) [-1149.198] -- 0:00:43
326000 -- (-1152.276) (-1150.811) (-1148.798) [-1150.809] * (-1154.574) [-1149.484] (-1150.593) (-1150.363) -- 0:00:43
326500 -- [-1151.431] (-1151.707) (-1150.986) (-1153.854) * (-1159.780) [-1149.746] (-1150.449) (-1150.643) -- 0:00:45
327000 -- (-1150.580) (-1150.056) [-1150.238] (-1154.606) * [-1149.055] (-1154.541) (-1150.723) (-1150.245) -- 0:00:45
327500 -- (-1151.592) [-1152.279] (-1150.509) (-1150.117) * (-1150.154) (-1150.853) [-1150.694] (-1152.393) -- 0:00:45
328000 -- (-1152.531) (-1150.292) [-1150.550] (-1149.987) * (-1151.569) (-1150.676) (-1153.025) [-1152.070] -- 0:00:45
328500 -- (-1153.859) [-1150.465] (-1150.426) (-1149.422) * (-1151.823) (-1151.365) (-1151.849) [-1152.662] -- 0:00:44
329000 -- (-1151.181) (-1152.917) (-1150.805) [-1149.149] * [-1149.896] (-1154.461) (-1151.077) (-1152.536) -- 0:00:44
329500 -- (-1150.529) (-1151.265) [-1150.139] (-1150.740) * (-1152.934) (-1156.361) [-1151.995] (-1154.573) -- 0:00:44
330000 -- (-1149.861) (-1151.810) (-1153.226) [-1151.392] * [-1150.255] (-1152.449) (-1150.274) (-1151.607) -- 0:00:44
Average standard deviation of split frequencies: 0.012652
330500 -- (-1151.500) [-1150.993] (-1150.993) (-1155.204) * (-1151.916) (-1150.275) [-1150.405] (-1150.303) -- 0:00:44
331000 -- (-1151.184) [-1152.845] (-1150.810) (-1155.611) * (-1153.442) (-1151.508) (-1150.923) [-1151.401] -- 0:00:44
331500 -- (-1154.240) (-1150.965) (-1150.055) [-1150.666] * (-1153.497) (-1150.235) [-1150.418] (-1152.122) -- 0:00:44
332000 -- (-1150.504) (-1150.597) (-1149.567) [-1151.289] * (-1150.180) (-1150.410) (-1151.857) [-1152.844] -- 0:00:44
332500 -- (-1150.708) [-1150.470] (-1154.277) (-1153.900) * (-1152.739) (-1150.063) [-1150.633] (-1157.108) -- 0:00:44
333000 -- (-1151.238) (-1152.342) [-1152.328] (-1154.269) * (-1151.741) (-1150.218) [-1149.356] (-1152.996) -- 0:00:44
333500 -- [-1151.702] (-1149.793) (-1151.893) (-1153.398) * [-1151.534] (-1150.284) (-1153.471) (-1152.202) -- 0:00:43
334000 -- (-1149.481) [-1149.654] (-1150.747) (-1151.582) * (-1153.270) (-1150.439) [-1152.805] (-1151.889) -- 0:00:43
334500 -- (-1150.377) [-1156.076] (-1152.590) (-1151.816) * (-1157.108) [-1152.861] (-1153.039) (-1150.973) -- 0:00:43
335000 -- (-1149.447) (-1150.501) [-1149.584] (-1154.046) * [-1150.776] (-1151.653) (-1148.911) (-1153.369) -- 0:00:43
Average standard deviation of split frequencies: 0.013241
335500 -- (-1149.428) (-1149.972) [-1154.586] (-1153.074) * (-1149.787) (-1154.572) [-1150.721] (-1149.197) -- 0:00:43
336000 -- (-1151.585) (-1154.801) (-1150.723) [-1149.991] * (-1151.395) (-1152.031) (-1150.944) [-1153.588] -- 0:00:43
336500 -- (-1154.322) (-1152.949) [-1151.090] (-1150.021) * (-1150.960) (-1152.068) [-1150.172] (-1150.936) -- 0:00:43
337000 -- (-1149.085) (-1149.087) [-1152.430] (-1155.449) * (-1151.970) (-1149.780) [-1148.735] (-1149.513) -- 0:00:43
337500 -- (-1149.348) (-1150.724) [-1151.884] (-1155.728) * (-1152.802) (-1149.790) (-1153.020) [-1149.936] -- 0:00:43
338000 -- (-1150.432) (-1150.065) [-1152.186] (-1150.449) * (-1152.263) (-1149.618) (-1151.504) [-1152.574] -- 0:00:43
338500 -- (-1149.711) [-1151.142] (-1149.942) (-1154.326) * [-1151.540] (-1153.903) (-1152.578) (-1150.287) -- 0:00:42
339000 -- (-1149.479) (-1149.678) (-1151.725) [-1149.611] * (-1151.812) (-1153.514) (-1151.211) [-1150.633] -- 0:00:42
339500 -- (-1151.868) (-1148.893) [-1151.989] (-1150.188) * (-1151.541) [-1153.243] (-1150.939) (-1150.963) -- 0:00:42
340000 -- (-1153.671) (-1151.742) [-1151.142] (-1151.399) * (-1151.666) (-1153.324) (-1150.500) [-1150.314] -- 0:00:42
Average standard deviation of split frequencies: 0.013232
340500 -- (-1152.067) [-1149.753] (-1151.079) (-1150.541) * (-1153.057) (-1157.005) (-1150.107) [-1150.662] -- 0:00:42
341000 -- (-1150.551) (-1149.330) [-1150.473] (-1148.700) * (-1154.978) (-1152.373) (-1150.404) [-1150.027] -- 0:00:42
341500 -- (-1150.489) (-1148.527) (-1151.120) [-1151.171] * (-1153.904) [-1151.957] (-1150.150) (-1152.115) -- 0:00:44
342000 -- (-1150.833) (-1151.941) (-1151.453) [-1154.155] * [-1151.210] (-1153.953) (-1152.288) (-1150.549) -- 0:00:44
342500 -- (-1152.746) [-1150.250] (-1150.003) (-1154.844) * (-1156.036) [-1150.720] (-1153.453) (-1149.393) -- 0:00:44
343000 -- [-1149.206] (-1149.239) (-1150.830) (-1154.403) * (-1151.222) [-1150.798] (-1150.629) (-1151.602) -- 0:00:44
343500 -- (-1150.008) [-1148.495] (-1156.767) (-1155.489) * (-1150.413) (-1151.903) (-1150.408) [-1150.693] -- 0:00:43
344000 -- (-1151.814) [-1151.494] (-1154.715) (-1153.557) * (-1151.364) (-1151.980) (-1150.969) [-1151.510] -- 0:00:43
344500 -- (-1149.795) (-1149.726) (-1153.579) [-1151.557] * [-1151.102] (-1148.905) (-1154.478) (-1151.284) -- 0:00:43
345000 -- (-1151.921) [-1150.276] (-1152.085) (-1153.399) * [-1148.936] (-1149.266) (-1154.188) (-1151.353) -- 0:00:43
Average standard deviation of split frequencies: 0.012773
345500 -- (-1152.083) (-1152.009) (-1157.252) [-1154.189] * (-1152.812) (-1149.039) (-1151.094) [-1153.080] -- 0:00:43
346000 -- (-1152.522) (-1153.508) (-1152.846) [-1151.028] * (-1154.456) (-1149.756) [-1153.382] (-1151.883) -- 0:00:43
346500 -- (-1153.268) (-1152.302) [-1149.723] (-1150.447) * (-1156.258) (-1151.371) [-1153.202] (-1153.154) -- 0:00:43
347000 -- (-1149.633) [-1151.156] (-1150.988) (-1150.822) * (-1155.328) [-1152.275] (-1150.759) (-1158.263) -- 0:00:43
347500 -- (-1149.347) (-1152.086) [-1148.601] (-1152.644) * (-1149.620) (-1151.227) [-1151.100] (-1152.488) -- 0:00:43
348000 -- [-1152.532] (-1159.657) (-1152.457) (-1151.525) * (-1150.515) (-1150.031) [-1150.619] (-1154.931) -- 0:00:43
348500 -- (-1151.805) (-1152.108) [-1158.389] (-1150.736) * (-1155.438) [-1147.962] (-1150.732) (-1150.280) -- 0:00:42
349000 -- (-1151.817) (-1150.099) (-1149.524) [-1150.560] * (-1150.121) (-1155.080) (-1150.141) [-1149.921] -- 0:00:42
349500 -- (-1151.350) (-1152.914) (-1149.488) [-1150.540] * (-1150.141) [-1154.429] (-1155.331) (-1149.886) -- 0:00:42
350000 -- (-1153.861) (-1154.902) [-1151.002] (-1148.898) * (-1151.852) [-1149.996] (-1151.592) (-1149.837) -- 0:00:42
Average standard deviation of split frequencies: 0.012351
350500 -- (-1153.475) (-1155.156) [-1151.310] (-1153.601) * (-1151.846) (-1149.992) [-1150.436] (-1150.167) -- 0:00:42
351000 -- (-1153.136) [-1151.958] (-1150.541) (-1153.177) * [-1153.461] (-1151.501) (-1150.821) (-1150.148) -- 0:00:42
351500 -- (-1151.037) (-1153.411) (-1151.270) [-1151.077] * (-1153.329) (-1151.087) (-1149.049) [-1150.271] -- 0:00:42
352000 -- (-1148.138) (-1149.823) (-1149.533) [-1150.088] * (-1151.962) (-1150.171) (-1152.055) [-1154.712] -- 0:00:42
352500 -- [-1151.957] (-1150.952) (-1150.386) (-1150.192) * (-1154.370) (-1153.202) (-1155.292) [-1150.014] -- 0:00:42
353000 -- [-1151.949] (-1152.455) (-1149.899) (-1150.903) * (-1151.573) [-1154.400] (-1154.814) (-1151.447) -- 0:00:42
353500 -- (-1153.401) (-1152.714) (-1150.255) [-1151.706] * [-1149.882] (-1150.484) (-1155.249) (-1150.681) -- 0:00:42
354000 -- [-1149.502] (-1152.383) (-1148.333) (-1151.193) * [-1149.159] (-1151.040) (-1152.721) (-1150.901) -- 0:00:41
354500 -- (-1150.227) (-1150.824) [-1150.068] (-1149.241) * (-1158.104) (-1153.503) (-1152.536) [-1149.020] -- 0:00:41
355000 -- (-1154.062) (-1153.306) [-1148.814] (-1152.145) * (-1153.038) [-1151.245] (-1151.067) (-1151.826) -- 0:00:41
Average standard deviation of split frequencies: 0.011918
355500 -- (-1155.883) (-1152.781) (-1150.950) [-1150.341] * (-1149.995) [-1151.635] (-1150.891) (-1150.714) -- 0:00:41
356000 -- (-1156.094) [-1152.772] (-1150.842) (-1153.184) * (-1152.960) (-1153.528) (-1149.885) [-1155.332] -- 0:00:41
356500 -- (-1153.491) [-1149.503] (-1148.218) (-1151.511) * (-1148.731) (-1151.560) [-1151.015] (-1152.978) -- 0:00:43
357000 -- (-1150.509) (-1152.366) [-1149.463] (-1151.075) * (-1151.503) [-1149.962] (-1152.487) (-1152.642) -- 0:00:43
357500 -- [-1150.863] (-1152.814) (-1151.521) (-1150.361) * (-1151.489) [-1150.603] (-1151.032) (-1149.497) -- 0:00:43
358000 -- (-1151.575) (-1150.741) [-1151.594] (-1151.148) * [-1152.574] (-1150.704) (-1150.345) (-1150.297) -- 0:00:43
358500 -- [-1152.105] (-1150.925) (-1150.120) (-1149.557) * (-1152.922) [-1149.504] (-1149.795) (-1152.634) -- 0:00:42
359000 -- (-1150.609) (-1150.387) [-1150.851] (-1149.996) * [-1148.814] (-1150.841) (-1160.423) (-1152.398) -- 0:00:42
359500 -- (-1152.866) (-1151.238) [-1154.920] (-1149.068) * (-1150.703) [-1152.154] (-1154.870) (-1150.578) -- 0:00:42
360000 -- [-1157.839] (-1151.894) (-1151.656) (-1151.001) * [-1150.726] (-1155.525) (-1151.155) (-1149.216) -- 0:00:42
Average standard deviation of split frequencies: 0.012090
360500 -- (-1155.390) [-1152.376] (-1150.889) (-1151.502) * (-1153.863) (-1152.120) [-1151.896] (-1150.903) -- 0:00:42
361000 -- (-1150.845) (-1151.149) [-1148.969] (-1152.402) * [-1150.691] (-1148.988) (-1149.801) (-1152.506) -- 0:00:42
361500 -- (-1150.641) [-1153.166] (-1153.807) (-1150.436) * (-1152.943) (-1150.253) (-1153.353) [-1150.934] -- 0:00:42
362000 -- [-1151.243] (-1150.284) (-1153.392) (-1150.348) * (-1152.012) (-1154.870) [-1152.752] (-1155.726) -- 0:00:42
362500 -- (-1151.594) (-1152.167) [-1152.012] (-1152.683) * (-1152.217) (-1151.988) [-1151.742] (-1151.156) -- 0:00:42
363000 -- [-1150.275] (-1151.825) (-1151.346) (-1148.953) * (-1150.105) [-1150.986] (-1150.689) (-1153.375) -- 0:00:42
363500 -- (-1148.999) (-1153.397) [-1148.387] (-1150.697) * [-1150.499] (-1154.508) (-1153.866) (-1152.422) -- 0:00:42
364000 -- [-1150.158] (-1154.254) (-1148.755) (-1150.697) * [-1149.882] (-1152.744) (-1153.413) (-1148.810) -- 0:00:41
364500 -- (-1154.656) [-1150.761] (-1149.611) (-1154.609) * (-1150.422) (-1151.437) [-1150.958] (-1150.085) -- 0:00:41
365000 -- (-1149.782) (-1150.213) (-1150.520) [-1151.377] * [-1152.625] (-1150.382) (-1152.619) (-1150.602) -- 0:00:41
Average standard deviation of split frequencies: 0.012960
365500 -- (-1150.147) (-1150.649) [-1152.313] (-1150.412) * (-1153.061) (-1149.307) (-1154.309) [-1149.888] -- 0:00:41
366000 -- (-1149.206) (-1151.000) (-1152.151) [-1151.010] * [-1150.616] (-1151.580) (-1151.470) (-1152.258) -- 0:00:41
366500 -- (-1153.485) (-1153.164) (-1152.315) [-1152.129] * (-1150.735) (-1152.002) [-1151.923] (-1150.907) -- 0:00:41
367000 -- (-1150.737) [-1152.685] (-1152.241) (-1150.794) * [-1151.184] (-1149.370) (-1149.730) (-1151.857) -- 0:00:41
367500 -- (-1149.028) (-1154.540) [-1150.012] (-1151.064) * (-1150.357) (-1150.418) [-1152.392] (-1153.663) -- 0:00:41
368000 -- (-1149.049) (-1150.994) [-1149.848] (-1151.328) * (-1149.865) (-1151.495) [-1150.362] (-1152.182) -- 0:00:41
368500 -- (-1149.078) (-1151.535) (-1148.349) [-1150.052] * [-1153.966] (-1155.076) (-1153.769) (-1151.693) -- 0:00:41
369000 -- (-1153.178) (-1151.235) (-1152.066) [-1150.247] * (-1154.423) [-1152.452] (-1154.483) (-1155.436) -- 0:00:41
369500 -- (-1150.724) (-1152.296) [-1149.419] (-1151.688) * [-1150.948] (-1153.216) (-1151.864) (-1152.225) -- 0:00:40
370000 -- (-1150.350) (-1151.523) [-1148.900] (-1154.528) * (-1154.380) [-1150.024] (-1152.728) (-1153.036) -- 0:00:40
Average standard deviation of split frequencies: 0.012718
370500 -- (-1151.659) (-1150.034) (-1150.855) [-1151.416] * [-1152.786] (-1154.991) (-1155.201) (-1152.516) -- 0:00:40
371000 -- [-1150.336] (-1152.022) (-1150.277) (-1151.122) * (-1150.159) (-1150.588) (-1153.251) [-1152.204] -- 0:00:40
371500 -- [-1148.328] (-1151.704) (-1156.946) (-1151.176) * [-1149.239] (-1151.441) (-1153.244) (-1153.652) -- 0:00:42
372000 -- [-1150.267] (-1153.764) (-1149.906) (-1153.634) * (-1152.875) (-1151.631) (-1152.814) [-1152.339] -- 0:00:42
372500 -- [-1150.191] (-1153.591) (-1152.177) (-1155.811) * (-1153.770) (-1149.104) (-1151.031) [-1150.983] -- 0:00:42
373000 -- (-1153.920) (-1149.986) [-1150.301] (-1152.417) * (-1152.122) (-1151.351) (-1153.053) [-1151.286] -- 0:00:42
373500 -- (-1151.992) (-1151.589) [-1151.372] (-1150.883) * (-1152.624) (-1150.487) [-1151.341] (-1155.420) -- 0:00:41
374000 -- (-1150.567) [-1151.008] (-1150.787) (-1150.775) * [-1150.707] (-1153.077) (-1152.170) (-1151.847) -- 0:00:41
374500 -- (-1150.853) [-1150.608] (-1151.305) (-1151.978) * (-1151.310) (-1155.612) (-1151.333) [-1151.643] -- 0:00:41
375000 -- [-1151.055] (-1152.100) (-1152.801) (-1149.507) * [-1150.747] (-1150.159) (-1151.945) (-1149.871) -- 0:00:41
Average standard deviation of split frequencies: 0.013164
375500 -- (-1152.392) [-1149.807] (-1151.136) (-1152.919) * (-1152.703) (-1153.202) (-1150.006) [-1149.512] -- 0:00:41
376000 -- (-1151.745) (-1149.868) [-1150.673] (-1154.774) * (-1156.175) (-1148.981) (-1150.526) [-1150.620] -- 0:00:41
376500 -- [-1152.615] (-1149.117) (-1153.057) (-1152.953) * [-1151.125] (-1151.553) (-1148.424) (-1152.350) -- 0:00:41
377000 -- (-1153.110) [-1148.135] (-1153.136) (-1154.093) * (-1152.131) (-1151.635) [-1148.944] (-1152.348) -- 0:00:41
377500 -- [-1153.012] (-1150.997) (-1151.599) (-1152.860) * (-1150.401) (-1150.616) [-1151.571] (-1151.766) -- 0:00:41
378000 -- (-1150.743) [-1150.886] (-1151.278) (-1151.847) * (-1151.028) (-1152.931) [-1150.294] (-1150.774) -- 0:00:41
378500 -- (-1152.354) [-1149.857] (-1151.005) (-1150.144) * [-1149.942] (-1154.003) (-1150.560) (-1151.438) -- 0:00:41
379000 -- (-1152.342) (-1150.894) [-1150.668] (-1150.408) * (-1149.334) (-1150.102) (-1149.589) [-1151.537] -- 0:00:40
379500 -- (-1151.776) (-1152.811) (-1151.750) [-1152.356] * (-1150.730) [-1150.280] (-1148.894) (-1151.846) -- 0:00:40
380000 -- (-1152.761) (-1151.539) (-1152.134) [-1151.639] * (-1150.597) (-1150.643) (-1154.391) [-1154.249] -- 0:00:40
Average standard deviation of split frequencies: 0.013080
380500 -- (-1150.623) (-1152.191) [-1151.459] (-1150.847) * (-1149.738) (-1150.657) (-1151.504) [-1153.072] -- 0:00:40
381000 -- (-1149.766) [-1151.592] (-1151.758) (-1151.979) * (-1149.585) (-1149.799) [-1150.418] (-1153.166) -- 0:00:40
381500 -- (-1152.540) (-1150.475) (-1150.880) [-1150.302] * (-1151.398) [-1149.447] (-1152.008) (-1151.215) -- 0:00:40
382000 -- [-1151.830] (-1153.766) (-1152.239) (-1151.778) * [-1155.343] (-1149.758) (-1150.101) (-1148.956) -- 0:00:40
382500 -- (-1151.684) [-1152.653] (-1151.249) (-1155.005) * (-1152.791) (-1149.201) [-1148.495] (-1152.485) -- 0:00:40
383000 -- (-1150.367) (-1154.050) [-1155.160] (-1152.920) * (-1151.717) (-1150.721) (-1150.598) [-1150.550] -- 0:00:40
383500 -- (-1150.243) (-1154.111) (-1151.897) [-1155.398] * [-1151.417] (-1150.406) (-1150.884) (-1154.023) -- 0:00:40
384000 -- (-1150.837) (-1153.559) (-1151.444) [-1150.599] * (-1153.971) (-1151.545) (-1152.120) [-1152.738] -- 0:00:40
384500 -- (-1152.177) (-1153.136) (-1152.148) [-1151.465] * (-1153.894) (-1148.887) (-1149.367) [-1150.954] -- 0:00:40
385000 -- (-1151.947) (-1153.826) [-1151.900] (-1150.285) * [-1150.786] (-1150.328) (-1148.331) (-1152.160) -- 0:00:39
Average standard deviation of split frequencies: 0.013281
385500 -- (-1152.038) (-1151.601) (-1151.859) [-1151.332] * (-1151.993) [-1149.594] (-1151.568) (-1151.070) -- 0:00:39
386000 -- [-1153.678] (-1151.408) (-1150.962) (-1150.604) * (-1153.381) [-1148.352] (-1152.645) (-1151.517) -- 0:00:39
386500 -- (-1152.689) (-1149.178) (-1154.293) [-1150.588] * (-1158.065) (-1154.627) [-1149.214] (-1152.651) -- 0:00:41
387000 -- (-1151.087) (-1149.089) (-1150.579) [-1151.064] * (-1150.546) (-1151.163) (-1152.040) [-1150.247] -- 0:00:41
387500 -- [-1150.722] (-1149.532) (-1151.746) (-1150.302) * (-1152.564) [-1151.506] (-1152.773) (-1150.627) -- 0:00:41
388000 -- [-1150.411] (-1152.107) (-1149.820) (-1149.589) * (-1152.158) [-1150.713] (-1155.192) (-1150.548) -- 0:00:41
388500 -- (-1150.618) [-1152.577] (-1148.976) (-1151.110) * (-1150.637) (-1150.177) (-1151.130) [-1151.591] -- 0:00:40
389000 -- (-1150.434) [-1151.140] (-1150.483) (-1155.056) * [-1151.359] (-1151.300) (-1152.633) (-1150.414) -- 0:00:40
389500 -- [-1153.409] (-1150.554) (-1151.085) (-1151.430) * (-1152.065) (-1150.812) (-1153.402) [-1152.052] -- 0:00:40
390000 -- (-1154.944) [-1149.124] (-1151.569) (-1150.854) * [-1151.285] (-1150.614) (-1154.313) (-1156.613) -- 0:00:40
Average standard deviation of split frequencies: 0.014028
390500 -- [-1151.800] (-1150.477) (-1152.344) (-1154.196) * [-1148.997] (-1151.383) (-1150.183) (-1151.617) -- 0:00:40
391000 -- (-1152.841) (-1151.885) (-1155.229) [-1150.707] * [-1149.848] (-1153.461) (-1149.970) (-1149.317) -- 0:00:40
391500 -- (-1153.417) [-1152.574] (-1153.694) (-1152.133) * [-1149.758] (-1154.612) (-1148.624) (-1149.836) -- 0:00:40
392000 -- (-1151.880) (-1150.296) (-1150.230) [-1154.575] * (-1151.106) (-1149.109) (-1149.242) [-1149.607] -- 0:00:40
392500 -- (-1151.241) (-1154.309) [-1152.770] (-1153.230) * [-1151.626] (-1156.828) (-1151.928) (-1152.144) -- 0:00:40
393000 -- (-1151.783) (-1148.747) [-1157.242] (-1151.470) * (-1151.478) [-1150.569] (-1149.620) (-1152.835) -- 0:00:40
393500 -- (-1150.573) (-1148.579) (-1157.258) [-1149.745] * (-1152.289) [-1152.165] (-1153.243) (-1152.001) -- 0:00:40
394000 -- (-1152.708) (-1150.401) [-1151.237] (-1153.184) * (-1152.822) [-1151.649] (-1150.818) (-1150.434) -- 0:00:39
394500 -- (-1150.676) [-1153.235] (-1150.107) (-1151.563) * [-1153.518] (-1153.926) (-1151.848) (-1154.970) -- 0:00:39
395000 -- (-1152.251) [-1152.285] (-1150.643) (-1151.808) * (-1153.134) (-1153.255) [-1149.268] (-1150.572) -- 0:00:39
Average standard deviation of split frequencies: 0.013987
395500 -- [-1151.516] (-1153.987) (-1150.476) (-1150.542) * (-1150.030) (-1152.503) [-1150.418] (-1154.246) -- 0:00:39
396000 -- (-1150.727) (-1152.456) [-1153.867] (-1151.136) * (-1150.601) (-1151.180) [-1149.619] (-1154.495) -- 0:00:39
396500 -- (-1152.780) [-1148.966] (-1151.898) (-1152.763) * (-1150.285) (-1150.357) [-1150.036] (-1149.873) -- 0:00:39
397000 -- (-1151.158) (-1149.770) [-1152.824] (-1152.071) * (-1154.603) (-1150.765) (-1153.328) [-1150.000] -- 0:00:39
397500 -- [-1150.725] (-1150.128) (-1150.413) (-1154.500) * (-1153.120) (-1154.601) [-1150.475] (-1152.725) -- 0:00:39
398000 -- (-1150.556) (-1152.177) (-1150.204) [-1152.956] * [-1148.159] (-1152.160) (-1149.724) (-1150.074) -- 0:00:39
398500 -- (-1150.070) (-1152.664) [-1150.510] (-1150.997) * (-1153.530) (-1152.750) (-1150.825) [-1150.830] -- 0:00:39
399000 -- (-1151.272) (-1152.760) [-1149.963] (-1152.410) * (-1150.231) [-1150.284] (-1152.297) (-1151.939) -- 0:00:39
399500 -- (-1152.424) (-1153.459) [-1151.868] (-1150.958) * (-1147.673) (-1148.760) [-1150.584] (-1152.437) -- 0:00:39
400000 -- (-1150.706) [-1151.812] (-1149.703) (-1151.533) * [-1147.747] (-1155.088) (-1151.231) (-1150.735) -- 0:00:39
Average standard deviation of split frequencies: 0.012942
400500 -- (-1151.831) (-1151.028) (-1151.054) [-1153.048] * (-1150.837) (-1155.687) (-1153.939) [-1152.039] -- 0:00:38
401000 -- (-1150.632) (-1150.343) (-1150.782) [-1150.103] * (-1150.476) (-1151.592) [-1148.022] (-1151.763) -- 0:00:38
401500 -- (-1152.352) [-1151.253] (-1150.346) (-1153.259) * (-1153.106) [-1149.898] (-1149.497) (-1150.869) -- 0:00:40
402000 -- (-1153.253) (-1151.527) (-1149.775) [-1151.533] * (-1150.750) [-1150.812] (-1150.513) (-1150.364) -- 0:00:40
402500 -- (-1151.490) [-1149.778] (-1152.464) (-1150.639) * [-1152.334] (-1151.541) (-1152.650) (-1159.226) -- 0:00:40
403000 -- (-1150.520) (-1149.899) (-1152.454) [-1150.497] * (-1148.453) (-1149.483) [-1150.858] (-1151.117) -- 0:00:39
403500 -- (-1150.911) [-1150.402] (-1155.105) (-1154.508) * (-1151.690) (-1161.527) [-1150.785] (-1150.405) -- 0:00:39
404000 -- (-1149.574) (-1148.787) [-1154.360] (-1152.107) * (-1153.430) (-1152.881) (-1150.115) [-1150.661] -- 0:00:39
404500 -- [-1150.933] (-1151.805) (-1153.809) (-1150.959) * (-1152.281) (-1151.632) (-1149.672) [-1150.212] -- 0:00:39
405000 -- (-1151.040) (-1151.867) (-1156.531) [-1153.664] * [-1151.853] (-1152.634) (-1148.192) (-1154.465) -- 0:00:39
Average standard deviation of split frequencies: 0.013353
405500 -- (-1151.208) (-1154.063) [-1150.166] (-1153.744) * (-1151.698) [-1155.015] (-1150.841) (-1153.209) -- 0:00:39
406000 -- [-1152.866] (-1154.754) (-1149.495) (-1151.308) * (-1154.518) (-1151.174) [-1152.400] (-1151.548) -- 0:00:39
406500 -- (-1153.339) (-1155.267) [-1148.993] (-1150.021) * (-1150.902) (-1150.849) [-1152.428] (-1152.296) -- 0:00:39
407000 -- [-1153.102] (-1152.876) (-1152.531) (-1154.070) * (-1150.208) (-1151.279) [-1152.474] (-1151.239) -- 0:00:39
407500 -- (-1151.211) (-1151.880) (-1150.216) [-1150.257] * (-1150.396) (-1151.476) (-1150.336) [-1151.428] -- 0:00:39
408000 -- (-1153.086) (-1151.005) [-1152.768] (-1150.453) * (-1151.152) (-1151.110) [-1150.508] (-1150.636) -- 0:00:39
408500 -- (-1149.879) (-1152.108) (-1150.613) [-1151.917] * (-1150.774) (-1153.775) [-1150.516] (-1152.290) -- 0:00:39
409000 -- (-1151.863) (-1152.344) (-1150.801) [-1150.449] * (-1152.794) (-1150.533) (-1150.303) [-1150.798] -- 0:00:39
409500 -- (-1149.907) (-1150.392) [-1150.152] (-1151.398) * (-1152.211) [-1149.926] (-1153.000) (-1149.672) -- 0:00:38
410000 -- (-1155.886) [-1150.757] (-1151.206) (-1152.615) * [-1150.187] (-1150.675) (-1150.647) (-1152.483) -- 0:00:38
Average standard deviation of split frequencies: 0.013703
410500 -- (-1150.822) [-1153.375] (-1150.912) (-1150.096) * (-1150.198) [-1149.776] (-1151.361) (-1150.625) -- 0:00:38
411000 -- (-1152.379) [-1150.774] (-1153.707) (-1152.953) * (-1150.511) (-1156.048) (-1150.666) [-1152.362] -- 0:00:38
411500 -- [-1151.679] (-1150.075) (-1154.105) (-1153.760) * [-1151.441] (-1153.356) (-1150.650) (-1150.502) -- 0:00:38
412000 -- (-1150.831) [-1150.447] (-1150.860) (-1156.504) * (-1152.198) (-1155.026) [-1149.456] (-1151.553) -- 0:00:38
412500 -- (-1150.645) [-1150.619] (-1151.404) (-1152.298) * (-1153.279) (-1154.514) (-1150.934) [-1154.166] -- 0:00:38
413000 -- (-1150.098) [-1149.763] (-1150.756) (-1151.001) * (-1151.170) [-1151.296] (-1149.440) (-1151.651) -- 0:00:38
413500 -- (-1151.212) (-1154.511) (-1149.693) [-1155.416] * (-1150.164) [-1149.790] (-1151.671) (-1151.333) -- 0:00:38
414000 -- (-1154.051) [-1150.655] (-1150.257) (-1155.170) * (-1150.448) (-1149.847) [-1152.590] (-1150.903) -- 0:00:38
414500 -- [-1151.722] (-1150.148) (-1149.436) (-1150.046) * (-1151.385) [-1151.884] (-1150.775) (-1153.247) -- 0:00:38
415000 -- (-1152.245) [-1150.902] (-1150.925) (-1151.373) * (-1154.539) [-1151.517] (-1150.667) (-1151.519) -- 0:00:38
Average standard deviation of split frequencies: 0.013598
415500 -- (-1152.921) (-1150.637) (-1152.093) [-1150.730] * (-1150.804) (-1150.658) (-1150.195) [-1150.087] -- 0:00:37
416000 -- (-1153.842) (-1151.055) [-1150.989] (-1151.408) * (-1153.302) (-1150.619) [-1152.577] (-1152.186) -- 0:00:37
416500 -- (-1150.964) (-1151.515) (-1152.614) [-1151.257] * (-1153.605) (-1152.612) (-1148.722) [-1150.859] -- 0:00:39
417000 -- (-1151.177) (-1153.482) [-1150.222] (-1149.765) * (-1154.842) (-1155.858) (-1149.190) [-1149.823] -- 0:00:39
417500 -- (-1153.932) (-1150.792) [-1148.678] (-1154.190) * (-1150.253) [-1150.955] (-1149.288) (-1150.959) -- 0:00:39
418000 -- [-1150.741] (-1152.167) (-1150.612) (-1153.753) * (-1149.891) (-1151.788) [-1150.995] (-1151.200) -- 0:00:38
418500 -- [-1150.127] (-1151.264) (-1151.495) (-1152.715) * (-1150.036) (-1156.311) [-1148.951] (-1155.599) -- 0:00:38
419000 -- [-1149.669] (-1152.639) (-1155.161) (-1153.928) * [-1149.153] (-1150.916) (-1154.961) (-1153.487) -- 0:00:38
419500 -- [-1150.451] (-1152.909) (-1149.116) (-1154.303) * [-1151.043] (-1151.398) (-1150.592) (-1149.694) -- 0:00:38
420000 -- [-1156.159] (-1150.971) (-1151.463) (-1155.107) * (-1150.495) (-1150.301) (-1149.902) [-1148.970] -- 0:00:38
Average standard deviation of split frequencies: 0.013377
420500 -- [-1150.554] (-1152.589) (-1149.952) (-1152.348) * (-1150.775) [-1150.800] (-1158.076) (-1150.797) -- 0:00:38
421000 -- (-1151.907) (-1151.394) [-1149.903] (-1150.665) * (-1150.295) (-1154.351) [-1151.220] (-1149.701) -- 0:00:38
421500 -- (-1154.848) (-1149.668) [-1154.161] (-1150.005) * (-1153.894) (-1157.132) [-1149.269] (-1150.964) -- 0:00:38
422000 -- (-1150.662) (-1155.164) [-1152.555] (-1149.984) * (-1151.087) (-1150.653) [-1149.160] (-1150.031) -- 0:00:38
422500 -- (-1155.167) [-1152.131] (-1148.029) (-1150.727) * [-1150.757] (-1153.585) (-1150.526) (-1152.579) -- 0:00:38
423000 -- (-1150.984) (-1151.113) [-1149.694] (-1151.191) * (-1153.727) (-1152.489) (-1150.796) [-1149.069] -- 0:00:38
423500 -- (-1152.388) [-1149.962] (-1153.004) (-1151.731) * [-1153.199] (-1154.012) (-1152.676) (-1151.610) -- 0:00:38
424000 -- (-1151.843) (-1153.018) [-1150.460] (-1149.714) * (-1157.694) (-1151.154) (-1152.567) [-1150.425] -- 0:00:38
424500 -- (-1151.400) [-1150.914] (-1151.852) (-1149.540) * (-1155.268) (-1153.828) [-1151.000] (-1150.571) -- 0:00:37
425000 -- [-1149.315] (-1150.430) (-1155.697) (-1151.872) * (-1153.515) [-1153.116] (-1160.279) (-1152.535) -- 0:00:37
Average standard deviation of split frequencies: 0.012518
425500 -- [-1149.801] (-1150.258) (-1153.276) (-1150.429) * (-1151.839) [-1150.747] (-1156.564) (-1152.105) -- 0:00:37
426000 -- (-1149.587) (-1149.123) (-1153.630) [-1149.438] * [-1150.165] (-1150.169) (-1157.319) (-1152.130) -- 0:00:37
426500 -- [-1151.085] (-1152.047) (-1156.119) (-1149.768) * (-1149.482) [-1153.640] (-1150.899) (-1151.439) -- 0:00:37
427000 -- (-1151.343) (-1151.401) (-1151.590) [-1150.924] * (-1153.869) [-1149.795] (-1150.555) (-1152.018) -- 0:00:37
427500 -- [-1151.495] (-1152.567) (-1150.694) (-1150.781) * (-1150.355) (-1150.848) [-1152.696] (-1151.901) -- 0:00:37
428000 -- (-1150.436) [-1150.800] (-1154.764) (-1149.302) * (-1152.500) [-1150.878] (-1151.223) (-1151.843) -- 0:00:37
428500 -- [-1150.940] (-1151.266) (-1150.634) (-1150.220) * (-1151.986) [-1152.052] (-1150.596) (-1151.516) -- 0:00:37
429000 -- (-1151.625) (-1150.848) (-1151.766) [-1150.564] * [-1152.153] (-1151.976) (-1151.859) (-1154.486) -- 0:00:37
429500 -- [-1150.075] (-1150.551) (-1150.301) (-1148.825) * (-1152.513) (-1154.015) (-1152.201) [-1148.849] -- 0:00:37
430000 -- (-1150.667) (-1152.381) (-1149.753) [-1150.367] * (-1152.771) [-1150.672] (-1152.055) (-1150.677) -- 0:00:37
Average standard deviation of split frequencies: 0.012109
430500 -- (-1150.322) (-1151.087) [-1151.792] (-1155.798) * (-1152.559) (-1154.608) [-1150.534] (-1149.759) -- 0:00:37
431000 -- (-1154.233) (-1151.422) [-1151.007] (-1150.476) * (-1153.476) (-1150.871) (-1150.060) [-1149.998] -- 0:00:36
431500 -- (-1150.239) (-1153.452) (-1152.832) [-1149.338] * (-1150.383) (-1151.825) (-1151.712) [-1148.434] -- 0:00:36
432000 -- (-1157.208) [-1151.327] (-1149.663) (-1149.280) * (-1150.079) (-1149.854) (-1154.698) [-1150.424] -- 0:00:38
432500 -- (-1155.532) [-1154.331] (-1154.006) (-1151.573) * (-1149.386) (-1148.934) [-1151.766] (-1148.932) -- 0:00:38
433000 -- (-1151.091) (-1154.797) (-1150.526) [-1150.370] * (-1150.345) (-1152.203) (-1150.778) [-1148.670] -- 0:00:37
433500 -- (-1151.031) (-1156.960) (-1152.065) [-1151.739] * [-1151.280] (-1152.598) (-1150.789) (-1150.019) -- 0:00:37
434000 -- (-1152.341) (-1156.396) [-1150.318] (-1151.488) * (-1151.091) [-1151.055] (-1152.695) (-1156.218) -- 0:00:37
434500 -- (-1152.281) (-1151.372) (-1148.653) [-1152.302] * [-1149.430] (-1150.488) (-1153.134) (-1152.619) -- 0:00:37
435000 -- (-1153.308) [-1150.591] (-1152.338) (-1151.885) * [-1149.120] (-1150.554) (-1152.720) (-1153.067) -- 0:00:37
Average standard deviation of split frequencies: 0.012028
435500 -- [-1151.350] (-1152.835) (-1151.979) (-1151.983) * [-1149.157] (-1150.782) (-1151.511) (-1152.014) -- 0:00:37
436000 -- (-1151.587) [-1155.181] (-1150.258) (-1150.633) * (-1150.264) (-1155.443) (-1151.354) [-1157.559] -- 0:00:37
436500 -- [-1154.131] (-1153.581) (-1149.698) (-1149.743) * [-1150.618] (-1150.972) (-1150.225) (-1154.070) -- 0:00:37
437000 -- (-1155.997) (-1154.648) (-1152.259) [-1152.357] * [-1151.446] (-1157.892) (-1153.156) (-1152.382) -- 0:00:37
437500 -- (-1151.964) [-1155.397] (-1153.596) (-1151.700) * (-1148.705) [-1153.947] (-1155.114) (-1153.826) -- 0:00:37
438000 -- (-1149.571) [-1151.278] (-1152.131) (-1150.940) * [-1148.643] (-1151.680) (-1151.670) (-1151.627) -- 0:00:37
438500 -- [-1151.748] (-1150.497) (-1151.801) (-1151.298) * [-1150.019] (-1150.294) (-1151.890) (-1154.406) -- 0:00:37
439000 -- (-1151.302) (-1152.255) [-1151.532] (-1150.763) * (-1149.635) [-1150.847] (-1149.965) (-1152.458) -- 0:00:37
439500 -- [-1151.296] (-1151.234) (-1153.451) (-1150.823) * (-1151.133) (-1154.061) [-1151.398] (-1150.806) -- 0:00:36
440000 -- (-1157.790) (-1153.574) (-1153.928) [-1149.964] * (-1156.001) (-1151.377) [-1150.020] (-1150.816) -- 0:00:36
Average standard deviation of split frequencies: 0.012369
440500 -- (-1150.237) (-1151.443) (-1150.523) [-1149.283] * (-1149.512) [-1150.717] (-1154.985) (-1153.150) -- 0:00:36
441000 -- (-1150.128) [-1150.100] (-1150.395) (-1149.878) * (-1152.832) [-1150.617] (-1151.214) (-1150.764) -- 0:00:36
441500 -- [-1151.267] (-1151.446) (-1149.056) (-1153.413) * (-1151.940) (-1150.957) (-1151.677) [-1149.422] -- 0:00:36
442000 -- (-1152.885) [-1152.119] (-1152.844) (-1150.974) * (-1149.353) [-1149.172] (-1151.049) (-1153.944) -- 0:00:36
442500 -- (-1152.342) [-1151.824] (-1150.158) (-1154.607) * [-1152.552] (-1149.655) (-1150.448) (-1152.042) -- 0:00:36
443000 -- [-1150.640] (-1152.553) (-1151.585) (-1148.316) * (-1154.111) [-1154.281] (-1151.268) (-1155.578) -- 0:00:36
443500 -- (-1152.972) [-1153.746] (-1149.370) (-1151.109) * [-1153.656] (-1153.214) (-1152.151) (-1150.684) -- 0:00:36
444000 -- [-1149.632] (-1150.299) (-1149.947) (-1151.548) * [-1149.566] (-1149.829) (-1151.589) (-1154.398) -- 0:00:36
444500 -- [-1149.261] (-1151.228) (-1148.897) (-1152.383) * [-1149.729] (-1155.582) (-1151.435) (-1154.644) -- 0:00:36
445000 -- (-1152.526) (-1151.021) (-1154.855) [-1149.987] * (-1150.552) [-1152.369] (-1151.033) (-1148.607) -- 0:00:36
Average standard deviation of split frequencies: 0.012485
445500 -- [-1149.745] (-1151.743) (-1150.623) (-1151.474) * (-1150.128) [-1155.463] (-1151.603) (-1150.332) -- 0:00:36
446000 -- [-1150.531] (-1149.790) (-1155.851) (-1151.679) * (-1152.050) (-1154.800) [-1149.946] (-1152.012) -- 0:00:36
446500 -- [-1152.499] (-1151.404) (-1156.245) (-1150.326) * (-1153.943) [-1151.357] (-1150.190) (-1155.788) -- 0:00:35
447000 -- (-1149.720) [-1153.077] (-1150.569) (-1151.543) * (-1150.749) [-1150.828] (-1151.393) (-1150.201) -- 0:00:37
447500 -- (-1150.956) (-1157.386) [-1153.539] (-1150.161) * (-1149.188) [-1151.308] (-1152.503) (-1151.732) -- 0:00:37
448000 -- (-1152.149) [-1150.741] (-1150.894) (-1155.418) * [-1149.951] (-1150.622) (-1152.238) (-1153.144) -- 0:00:36
448500 -- (-1151.848) [-1150.593] (-1152.590) (-1150.845) * [-1150.350] (-1151.754) (-1151.512) (-1150.441) -- 0:00:36
449000 -- (-1150.337) [-1150.558] (-1148.741) (-1150.242) * (-1150.470) (-1155.176) (-1157.014) [-1151.519] -- 0:00:36
449500 -- (-1151.910) [-1149.494] (-1149.383) (-1152.402) * (-1153.113) (-1149.846) (-1150.079) [-1151.071] -- 0:00:36
450000 -- (-1150.957) [-1149.923] (-1151.458) (-1153.617) * [-1149.269] (-1153.055) (-1150.954) (-1154.137) -- 0:00:36
Average standard deviation of split frequencies: 0.012291
450500 -- [-1149.968] (-1148.908) (-1151.229) (-1152.691) * [-1152.426] (-1151.781) (-1150.666) (-1150.949) -- 0:00:36
451000 -- [-1149.744] (-1153.436) (-1154.503) (-1152.194) * [-1153.089] (-1152.761) (-1152.520) (-1152.268) -- 0:00:36
451500 -- (-1149.687) (-1153.415) (-1154.843) [-1150.022] * (-1148.777) (-1150.799) (-1154.696) [-1148.269] -- 0:00:36
452000 -- (-1149.985) (-1151.942) [-1152.104] (-1155.355) * (-1151.185) (-1151.664) (-1153.593) [-1149.973] -- 0:00:36
452500 -- (-1150.867) [-1149.569] (-1152.253) (-1152.089) * (-1150.742) (-1151.851) (-1152.207) [-1152.747] -- 0:00:36
453000 -- (-1152.549) (-1150.027) [-1150.080] (-1151.195) * (-1151.651) (-1150.082) (-1151.588) [-1151.701] -- 0:00:36
453500 -- (-1152.857) [-1151.564] (-1149.648) (-1150.765) * (-1151.539) [-1153.250] (-1150.530) (-1153.304) -- 0:00:36
454000 -- (-1150.922) [-1151.366] (-1149.434) (-1160.590) * (-1151.383) (-1151.916) [-1149.534] (-1155.038) -- 0:00:36
454500 -- (-1150.680) [-1154.469] (-1152.358) (-1152.729) * (-1151.177) (-1152.818) (-1149.471) [-1148.844] -- 0:00:36
455000 -- (-1151.803) (-1151.421) [-1151.908] (-1151.215) * (-1150.496) [-1154.364] (-1152.516) (-1149.821) -- 0:00:35
Average standard deviation of split frequencies: 0.011992
455500 -- (-1151.883) (-1150.910) [-1149.650] (-1148.644) * [-1149.099] (-1151.530) (-1153.058) (-1149.051) -- 0:00:35
456000 -- (-1151.381) (-1150.941) [-1150.438] (-1150.469) * (-1152.146) (-1152.163) [-1149.984] (-1151.416) -- 0:00:35
456500 -- [-1151.993] (-1150.762) (-1151.335) (-1151.315) * (-1150.019) [-1154.996] (-1149.997) (-1153.878) -- 0:00:35
457000 -- [-1150.413] (-1152.081) (-1150.454) (-1150.795) * (-1148.493) [-1151.394] (-1150.373) (-1151.969) -- 0:00:35
457500 -- (-1150.912) (-1153.066) (-1151.876) [-1152.552] * [-1150.125] (-1152.687) (-1151.521) (-1152.998) -- 0:00:35
458000 -- [-1150.413] (-1151.278) (-1153.153) (-1151.435) * (-1152.036) (-1150.352) (-1150.776) [-1150.437] -- 0:00:35
458500 -- (-1150.703) (-1152.280) (-1151.230) [-1150.584] * (-1152.513) [-1151.219] (-1152.666) (-1151.992) -- 0:00:35
459000 -- (-1150.554) (-1154.233) [-1154.721] (-1150.633) * (-1152.296) (-1152.819) (-1155.348) [-1152.976] -- 0:00:35
459500 -- (-1150.695) [-1151.554] (-1154.466) (-1151.039) * (-1149.700) (-1152.128) (-1151.129) [-1150.641] -- 0:00:35
460000 -- (-1150.080) (-1150.112) (-1154.197) [-1150.799] * (-1148.819) (-1151.757) [-1151.944] (-1151.093) -- 0:00:35
Average standard deviation of split frequencies: 0.012075
460500 -- [-1153.663] (-1150.994) (-1156.554) (-1151.002) * (-1149.080) [-1149.290] (-1152.101) (-1150.423) -- 0:00:35
461000 -- (-1152.261) [-1150.170] (-1156.697) (-1151.106) * (-1154.594) [-1149.767] (-1154.889) (-1150.641) -- 0:00:35
461500 -- (-1149.352) (-1149.694) [-1152.209] (-1150.829) * (-1151.610) (-1150.611) [-1154.669] (-1150.754) -- 0:00:35
462000 -- (-1149.791) (-1153.012) (-1150.557) [-1151.942] * (-1153.937) (-1150.917) [-1158.377] (-1151.342) -- 0:00:34
462500 -- (-1151.407) [-1151.580] (-1150.442) (-1150.438) * (-1151.173) (-1156.220) (-1158.074) [-1152.071] -- 0:00:36
463000 -- [-1148.927] (-1155.629) (-1153.085) (-1152.125) * (-1149.378) (-1151.037) [-1154.444] (-1151.733) -- 0:00:35
463500 -- (-1153.895) (-1152.707) [-1151.897] (-1152.251) * [-1150.037] (-1150.822) (-1153.069) (-1150.957) -- 0:00:35
464000 -- (-1152.625) (-1154.945) [-1149.903] (-1152.554) * (-1153.007) (-1150.412) (-1151.635) [-1150.006] -- 0:00:35
464500 -- (-1152.928) (-1153.043) (-1151.171) [-1158.312] * (-1152.623) (-1150.657) [-1153.367] (-1150.349) -- 0:00:35
465000 -- (-1151.213) (-1151.526) (-1151.508) [-1150.122] * (-1150.681) [-1151.388] (-1152.479) (-1151.730) -- 0:00:35
Average standard deviation of split frequencies: 0.012409
465500 -- (-1151.005) (-1150.694) [-1151.629] (-1150.063) * (-1152.744) (-1150.851) [-1150.215] (-1153.212) -- 0:00:35
466000 -- (-1150.954) [-1150.093] (-1152.724) (-1150.556) * (-1153.936) [-1150.426] (-1151.897) (-1155.468) -- 0:00:35
466500 -- (-1150.551) [-1151.443] (-1149.234) (-1149.776) * (-1155.166) (-1154.014) (-1151.577) [-1151.282] -- 0:00:35
467000 -- (-1150.957) [-1148.461] (-1151.304) (-1150.862) * (-1155.407) (-1152.906) (-1149.687) [-1151.793] -- 0:00:35
467500 -- (-1151.551) (-1155.062) (-1151.243) [-1150.186] * (-1152.299) (-1149.739) (-1151.180) [-1150.635] -- 0:00:35
468000 -- (-1154.722) (-1154.038) (-1152.533) [-1151.672] * [-1148.432] (-1154.043) (-1151.899) (-1151.400) -- 0:00:35
468500 -- (-1151.701) (-1151.342) [-1149.622] (-1151.463) * (-1151.828) (-1151.580) (-1150.553) [-1150.168] -- 0:00:35
469000 -- [-1153.099] (-1152.184) (-1149.627) (-1151.920) * [-1151.297] (-1150.605) (-1151.744) (-1150.471) -- 0:00:35
469500 -- (-1151.847) [-1150.383] (-1152.724) (-1150.371) * (-1151.262) [-1149.201] (-1149.735) (-1151.855) -- 0:00:35
470000 -- (-1148.655) (-1149.487) [-1152.809] (-1151.529) * [-1149.517] (-1150.605) (-1149.712) (-1150.272) -- 0:00:34
Average standard deviation of split frequencies: 0.012019
470500 -- (-1149.925) [-1150.770] (-1149.795) (-1155.548) * [-1150.952] (-1148.906) (-1149.476) (-1150.592) -- 0:00:34
471000 -- (-1153.817) (-1152.685) (-1150.263) [-1152.601] * (-1149.940) [-1152.311] (-1151.877) (-1151.540) -- 0:00:34
471500 -- (-1150.532) (-1152.935) (-1150.494) [-1152.564] * (-1152.904) [-1151.829] (-1152.569) (-1152.137) -- 0:00:34
472000 -- (-1150.770) (-1152.497) [-1149.782] (-1151.565) * [-1151.132] (-1149.487) (-1152.954) (-1151.486) -- 0:00:34
472500 -- (-1152.463) (-1155.254) (-1154.230) [-1150.705] * (-1155.064) (-1151.728) [-1150.602] (-1153.111) -- 0:00:34
473000 -- (-1150.607) (-1153.445) [-1157.243] (-1152.432) * (-1149.423) [-1151.436] (-1153.615) (-1154.345) -- 0:00:34
473500 -- (-1149.117) (-1150.120) [-1151.817] (-1151.012) * (-1151.933) (-1153.155) (-1157.803) [-1149.554] -- 0:00:34
474000 -- (-1150.597) (-1151.517) (-1151.642) [-1152.302] * [-1153.040] (-1150.498) (-1156.209) (-1150.466) -- 0:00:34
474500 -- (-1151.457) (-1152.825) [-1149.848] (-1154.503) * (-1153.463) (-1149.674) [-1152.850] (-1149.911) -- 0:00:34
475000 -- (-1153.989) (-1151.077) [-1151.951] (-1154.207) * (-1152.267) (-1149.703) (-1154.412) [-1150.543] -- 0:00:34
Average standard deviation of split frequencies: 0.011554
475500 -- (-1151.795) (-1153.239) (-1152.844) [-1150.028] * [-1153.129] (-1151.479) (-1152.094) (-1154.082) -- 0:00:34
476000 -- (-1155.270) (-1156.970) (-1149.692) [-1150.346] * (-1151.773) (-1153.651) [-1153.105] (-1152.118) -- 0:00:34
476500 -- (-1157.329) (-1160.745) [-1149.037] (-1152.057) * (-1153.364) (-1152.625) (-1157.682) [-1152.639] -- 0:00:34
477000 -- (-1151.738) (-1153.084) (-1154.721) [-1150.975] * (-1150.577) (-1152.517) [-1151.741] (-1153.855) -- 0:00:33
477500 -- (-1150.746) [-1153.822] (-1151.154) (-1151.451) * (-1150.733) (-1152.679) [-1149.128] (-1159.730) -- 0:00:35
478000 -- (-1150.915) (-1152.760) [-1151.145] (-1151.571) * (-1151.304) (-1151.696) [-1151.782] (-1151.109) -- 0:00:34
478500 -- (-1153.121) (-1152.759) (-1149.488) [-1150.102] * (-1152.311) [-1150.056] (-1150.603) (-1151.719) -- 0:00:34
479000 -- [-1151.401] (-1151.509) (-1154.648) (-1151.218) * (-1152.119) [-1148.760] (-1152.873) (-1151.302) -- 0:00:34
479500 -- (-1153.230) (-1149.690) (-1151.091) [-1150.308] * [-1153.265] (-1152.031) (-1151.064) (-1151.798) -- 0:00:34
480000 -- (-1150.401) (-1151.366) [-1149.485] (-1150.214) * [-1153.190] (-1149.920) (-1153.525) (-1150.278) -- 0:00:34
Average standard deviation of split frequencies: 0.011573
480500 -- (-1151.494) (-1151.338) [-1150.451] (-1154.357) * (-1151.735) (-1150.627) [-1153.843] (-1152.276) -- 0:00:34
481000 -- (-1150.422) (-1152.972) (-1149.356) [-1148.861] * [-1150.219] (-1150.248) (-1152.049) (-1151.426) -- 0:00:34
481500 -- (-1151.860) (-1152.101) [-1149.553] (-1149.432) * (-1150.893) (-1150.329) (-1149.300) [-1152.457] -- 0:00:34
482000 -- (-1150.342) (-1149.712) [-1150.439] (-1153.872) * (-1150.929) [-1151.007] (-1151.472) (-1153.778) -- 0:00:34
482500 -- (-1153.262) [-1151.532] (-1149.917) (-1151.810) * [-1149.153] (-1152.332) (-1151.553) (-1154.933) -- 0:00:34
483000 -- [-1151.241] (-1150.999) (-1152.211) (-1150.544) * (-1149.339) (-1153.192) [-1149.484] (-1153.152) -- 0:00:34
483500 -- (-1151.684) (-1149.967) [-1149.549] (-1152.834) * [-1150.842] (-1152.554) (-1151.599) (-1152.016) -- 0:00:34
484000 -- (-1151.946) [-1152.238] (-1151.068) (-1153.550) * (-1150.687) (-1154.838) (-1150.176) [-1150.840] -- 0:00:34
484500 -- (-1154.124) [-1150.086] (-1151.678) (-1152.423) * (-1149.706) (-1151.057) (-1150.769) [-1150.077] -- 0:00:34
485000 -- [-1152.062] (-1155.398) (-1152.249) (-1157.224) * (-1151.324) (-1150.376) (-1153.065) [-1150.652] -- 0:00:33
Average standard deviation of split frequencies: 0.010993
485500 -- [-1150.251] (-1153.545) (-1151.125) (-1150.929) * (-1153.507) (-1152.851) [-1148.994] (-1150.023) -- 0:00:33
486000 -- [-1151.011] (-1153.058) (-1150.132) (-1150.550) * [-1151.588] (-1151.074) (-1151.217) (-1151.157) -- 0:00:33
486500 -- (-1154.262) (-1154.365) (-1150.200) [-1151.090] * (-1150.992) [-1149.397] (-1151.378) (-1152.315) -- 0:00:33
487000 -- (-1152.702) [-1150.653] (-1150.089) (-1150.545) * (-1152.026) (-1154.811) (-1149.538) [-1151.990] -- 0:00:33
487500 -- (-1152.715) [-1150.476] (-1151.915) (-1152.019) * [-1149.591] (-1156.003) (-1149.986) (-1152.406) -- 0:00:33
488000 -- (-1155.112) (-1149.740) (-1150.534) [-1152.017] * (-1150.600) (-1152.701) (-1150.868) [-1151.213] -- 0:00:33
488500 -- (-1151.122) (-1154.340) (-1150.131) [-1150.244] * (-1150.467) [-1154.961] (-1153.633) (-1151.840) -- 0:00:33
489000 -- (-1151.423) (-1155.783) (-1150.157) [-1154.652] * (-1152.584) [-1154.240] (-1155.233) (-1151.133) -- 0:00:33
489500 -- (-1150.947) [-1151.512] (-1151.062) (-1153.877) * (-1152.728) (-1152.916) [-1151.510] (-1150.755) -- 0:00:33
490000 -- (-1152.258) (-1149.911) (-1149.372) [-1153.486] * [-1152.081] (-1150.672) (-1149.942) (-1152.945) -- 0:00:33
Average standard deviation of split frequencies: 0.010952
490500 -- [-1154.136] (-1150.466) (-1151.235) (-1150.448) * (-1150.948) [-1151.055] (-1150.591) (-1151.400) -- 0:00:33
491000 -- (-1150.887) (-1150.697) (-1150.320) [-1152.164] * (-1150.625) (-1154.814) [-1150.433] (-1151.102) -- 0:00:33
491500 -- (-1151.919) [-1151.063] (-1149.716) (-1151.284) * (-1153.663) (-1151.145) (-1151.109) [-1150.139] -- 0:00:33
492000 -- (-1151.954) (-1150.036) (-1150.546) [-1149.960] * [-1149.015] (-1150.540) (-1151.317) (-1153.175) -- 0:00:33
492500 -- (-1153.097) [-1152.412] (-1148.886) (-1151.254) * (-1148.694) (-1153.146) [-1151.418] (-1149.225) -- 0:00:34
493000 -- (-1151.062) (-1151.460) [-1148.984] (-1149.776) * (-1151.471) (-1153.623) [-1150.225] (-1150.260) -- 0:00:33
493500 -- (-1150.632) (-1153.655) [-1153.826] (-1151.900) * [-1150.920] (-1154.222) (-1155.481) (-1151.892) -- 0:00:33
494000 -- (-1152.188) (-1156.126) [-1149.191] (-1150.850) * (-1151.779) (-1153.709) [-1150.062] (-1150.853) -- 0:00:33
494500 -- (-1154.536) (-1151.985) (-1148.229) [-1149.895] * (-1149.332) (-1153.519) (-1154.245) [-1151.167] -- 0:00:33
495000 -- [-1150.103] (-1152.574) (-1149.601) (-1150.212) * [-1152.628] (-1153.842) (-1153.344) (-1149.976) -- 0:00:33
Average standard deviation of split frequencies: 0.011468
495500 -- (-1151.921) (-1152.077) (-1149.153) [-1150.039] * (-1151.107) [-1149.542] (-1151.213) (-1155.631) -- 0:00:33
496000 -- [-1152.176] (-1152.072) (-1149.697) (-1151.347) * (-1150.495) [-1149.506] (-1151.779) (-1154.133) -- 0:00:33
496500 -- [-1151.384] (-1153.931) (-1150.171) (-1151.481) * (-1150.627) [-1149.070] (-1155.007) (-1150.792) -- 0:00:33
497000 -- (-1151.039) [-1150.946] (-1150.103) (-1153.148) * (-1150.237) (-1151.688) (-1151.626) [-1151.483] -- 0:00:33
497500 -- (-1151.749) (-1152.860) [-1149.823] (-1151.092) * (-1148.853) [-1152.466] (-1153.070) (-1152.607) -- 0:00:33
498000 -- (-1151.891) [-1150.022] (-1151.195) (-1151.458) * (-1149.342) [-1150.124] (-1150.711) (-1150.925) -- 0:00:33
498500 -- [-1156.428] (-1149.936) (-1150.665) (-1151.086) * (-1149.093) (-1151.059) [-1150.362] (-1149.631) -- 0:00:33
499000 -- (-1155.536) (-1151.241) (-1151.690) [-1149.964] * (-1150.095) (-1150.231) [-1149.893] (-1150.854) -- 0:00:33
499500 -- (-1153.567) (-1151.392) (-1149.377) [-1150.666] * (-1154.886) (-1151.153) [-1151.640] (-1153.064) -- 0:00:33
500000 -- (-1150.068) (-1151.259) (-1152.447) [-1150.583] * (-1150.892) [-1153.408] (-1151.984) (-1151.218) -- 0:00:33
Average standard deviation of split frequencies: 0.011926
500500 -- [-1151.765] (-1151.793) (-1152.341) (-1150.604) * (-1149.217) (-1154.380) (-1150.153) [-1151.285] -- 0:00:32
501000 -- (-1153.920) [-1149.509] (-1152.935) (-1151.176) * (-1151.861) (-1150.865) (-1149.665) [-1152.384] -- 0:00:32
501500 -- (-1152.098) (-1152.711) (-1151.382) [-1151.036] * (-1151.152) (-1151.355) [-1150.131] (-1149.364) -- 0:00:32
502000 -- (-1150.636) [-1151.396] (-1153.328) (-1151.674) * (-1151.202) [-1149.497] (-1151.543) (-1150.143) -- 0:00:32
502500 -- (-1152.133) (-1151.934) (-1152.313) [-1150.172] * (-1149.937) [-1150.957] (-1149.885) (-1154.539) -- 0:00:32
503000 -- [-1152.333] (-1150.354) (-1152.297) (-1150.043) * (-1149.471) [-1148.938] (-1153.151) (-1148.667) -- 0:00:32
503500 -- [-1147.691] (-1151.749) (-1155.084) (-1150.446) * (-1149.661) [-1149.893] (-1149.560) (-1149.269) -- 0:00:32
504000 -- (-1151.618) (-1151.407) [-1151.580] (-1150.310) * (-1150.612) (-1152.157) (-1149.640) [-1150.379] -- 0:00:32
504500 -- [-1151.483] (-1151.856) (-1158.707) (-1149.287) * [-1148.951] (-1151.171) (-1151.323) (-1151.520) -- 0:00:32
505000 -- (-1149.644) (-1150.726) (-1154.521) [-1149.452] * (-1150.811) (-1150.397) (-1151.676) [-1151.651] -- 0:00:32
Average standard deviation of split frequencies: 0.011428
505500 -- [-1152.302] (-1151.011) (-1149.866) (-1149.262) * (-1150.654) (-1153.029) [-1149.917] (-1153.570) -- 0:00:32
506000 -- (-1152.700) (-1151.315) (-1150.400) [-1151.011] * [-1150.885] (-1152.032) (-1150.708) (-1151.500) -- 0:00:32
506500 -- (-1150.251) [-1148.737] (-1150.578) (-1151.414) * (-1153.059) (-1155.483) (-1151.965) [-1150.743] -- 0:00:32
507000 -- [-1149.616] (-1149.952) (-1151.075) (-1156.447) * (-1153.087) [-1150.598] (-1154.841) (-1151.352) -- 0:00:32
507500 -- (-1153.059) (-1151.164) [-1150.207] (-1150.829) * (-1150.644) [-1150.606] (-1153.601) (-1154.150) -- 0:00:32
508000 -- (-1149.986) (-1149.291) [-1150.075] (-1150.115) * (-1150.582) [-1150.992] (-1150.374) (-1156.096) -- 0:00:32
508500 -- [-1151.030] (-1150.860) (-1150.997) (-1150.562) * (-1150.201) (-1152.368) [-1151.145] (-1152.952) -- 0:00:32
509000 -- (-1150.379) (-1150.945) (-1153.761) [-1150.734] * (-1149.201) (-1150.327) [-1149.456] (-1151.437) -- 0:00:32
509500 -- (-1149.655) [-1150.718] (-1151.561) (-1153.297) * (-1149.640) [-1155.311] (-1150.730) (-1148.666) -- 0:00:32
510000 -- (-1150.778) [-1154.690] (-1152.101) (-1153.973) * (-1150.958) (-1153.533) [-1149.349] (-1150.815) -- 0:00:32
Average standard deviation of split frequencies: 0.011508
510500 -- [-1150.007] (-1149.311) (-1151.636) (-1151.716) * [-1150.902] (-1151.514) (-1153.597) (-1148.707) -- 0:00:32
511000 -- (-1153.268) [-1150.588] (-1153.291) (-1153.449) * [-1150.646] (-1151.574) (-1152.213) (-1151.814) -- 0:00:32
511500 -- [-1151.841] (-1148.760) (-1152.931) (-1152.645) * (-1151.191) (-1153.615) (-1157.762) [-1151.033] -- 0:00:32
512000 -- (-1151.035) (-1153.837) [-1151.308] (-1154.240) * [-1149.278] (-1154.608) (-1152.570) (-1150.867) -- 0:00:32
512500 -- (-1151.279) [-1152.430] (-1151.934) (-1152.236) * (-1150.479) [-1150.042] (-1151.287) (-1149.898) -- 0:00:32
513000 -- [-1152.719] (-1154.528) (-1152.320) (-1155.451) * [-1150.497] (-1151.833) (-1150.244) (-1151.292) -- 0:00:32
513500 -- (-1151.349) (-1152.778) [-1150.355] (-1150.996) * (-1150.041) (-1149.979) (-1150.494) [-1154.347] -- 0:00:32
514000 -- (-1150.984) (-1150.797) (-1149.822) [-1151.446] * (-1152.526) (-1150.687) [-1150.227] (-1150.436) -- 0:00:32
514500 -- (-1149.452) (-1153.353) [-1151.952] (-1154.482) * (-1151.730) (-1149.895) (-1150.911) [-1150.529] -- 0:00:32
515000 -- [-1153.057] (-1153.034) (-1149.054) (-1151.833) * (-1150.801) (-1151.003) (-1151.375) [-1150.557] -- 0:00:32
Average standard deviation of split frequencies: 0.011511
515500 -- (-1153.175) (-1156.125) [-1150.255] (-1152.754) * (-1154.903) (-1150.097) (-1148.988) [-1151.289] -- 0:00:31
516000 -- (-1153.809) (-1156.787) (-1153.462) [-1152.041] * (-1149.151) (-1149.906) [-1151.224] (-1163.775) -- 0:00:31
516500 -- (-1156.403) (-1157.134) [-1149.721] (-1150.745) * (-1153.951) (-1153.234) [-1150.748] (-1152.986) -- 0:00:31
517000 -- (-1150.410) (-1155.046) [-1152.507] (-1151.593) * (-1152.990) (-1151.354) (-1152.859) [-1156.696] -- 0:00:31
517500 -- [-1150.917] (-1154.139) (-1150.774) (-1150.546) * (-1153.646) [-1152.181] (-1151.260) (-1151.658) -- 0:00:31
518000 -- (-1149.861) [-1150.858] (-1151.820) (-1150.962) * (-1152.885) [-1149.295] (-1150.452) (-1153.445) -- 0:00:31
518500 -- (-1152.586) [-1150.175] (-1150.872) (-1150.904) * (-1150.333) (-1149.995) (-1148.906) [-1154.276] -- 0:00:31
519000 -- (-1152.656) (-1150.815) [-1150.293] (-1150.902) * (-1150.321) [-1150.934] (-1150.102) (-1151.595) -- 0:00:31
519500 -- (-1156.917) (-1151.264) (-1150.492) [-1152.057] * [-1150.465] (-1152.340) (-1149.200) (-1151.832) -- 0:00:31
520000 -- (-1151.345) (-1150.184) [-1150.577] (-1151.728) * (-1151.181) (-1150.413) [-1151.668] (-1150.312) -- 0:00:31
Average standard deviation of split frequencies: 0.010865
520500 -- (-1152.576) [-1150.900] (-1152.163) (-1154.332) * (-1152.495) (-1150.359) (-1154.626) [-1150.537] -- 0:00:31
521000 -- (-1149.231) (-1151.600) (-1151.165) [-1153.818] * (-1152.690) [-1149.489] (-1153.107) (-1151.306) -- 0:00:31
521500 -- (-1153.694) [-1153.154] (-1149.566) (-1148.125) * (-1151.900) (-1154.071) (-1152.010) [-1148.910] -- 0:00:31
522000 -- (-1148.703) (-1152.192) [-1150.074] (-1149.674) * [-1151.631] (-1150.805) (-1151.274) (-1149.057) -- 0:00:32
522500 -- (-1151.245) (-1154.504) (-1154.093) [-1150.941] * (-1154.282) [-1152.582] (-1153.396) (-1150.120) -- 0:00:31
523000 -- (-1152.067) (-1149.470) (-1152.446) [-1152.339] * [-1152.570] (-1149.105) (-1156.291) (-1150.916) -- 0:00:31
523500 -- [-1154.200] (-1150.983) (-1150.463) (-1150.589) * (-1154.789) (-1152.018) (-1154.980) [-1148.898] -- 0:00:31
524000 -- (-1150.225) (-1150.281) (-1152.635) [-1151.843] * [-1153.170] (-1150.481) (-1151.620) (-1150.646) -- 0:00:31
524500 -- (-1152.049) (-1151.487) [-1151.430] (-1155.120) * (-1152.989) (-1149.597) (-1150.648) [-1150.506] -- 0:00:31
525000 -- (-1149.678) [-1149.951] (-1151.953) (-1154.790) * (-1152.016) (-1151.465) [-1151.937] (-1149.405) -- 0:00:31
Average standard deviation of split frequencies: 0.011113
525500 -- [-1155.065] (-1150.970) (-1148.226) (-1154.398) * (-1154.531) [-1153.047] (-1149.862) (-1153.824) -- 0:00:31
526000 -- (-1151.139) [-1151.098] (-1161.229) (-1152.726) * (-1154.130) (-1152.033) (-1150.425) [-1151.786] -- 0:00:31
526500 -- (-1150.915) (-1150.062) (-1157.670) [-1152.568] * (-1150.851) [-1150.594] (-1150.770) (-1151.198) -- 0:00:31
527000 -- [-1150.633] (-1149.823) (-1150.057) (-1150.174) * (-1151.595) [-1150.625] (-1151.055) (-1150.946) -- 0:00:31
527500 -- [-1148.873] (-1150.787) (-1150.755) (-1149.036) * (-1151.941) (-1151.246) [-1150.501] (-1151.707) -- 0:00:31
528000 -- (-1150.037) [-1148.313] (-1150.383) (-1152.883) * (-1153.171) [-1149.573] (-1149.861) (-1154.027) -- 0:00:31
528500 -- [-1151.648] (-1149.293) (-1150.806) (-1151.378) * (-1154.643) (-1150.012) (-1152.162) [-1150.625] -- 0:00:31
529000 -- (-1150.348) (-1149.975) (-1151.206) [-1150.793] * [-1150.814] (-1150.479) (-1151.188) (-1152.439) -- 0:00:31
529500 -- (-1151.831) (-1149.866) [-1149.799] (-1153.396) * (-1152.597) [-1151.661] (-1151.093) (-1151.790) -- 0:00:31
530000 -- (-1148.823) (-1151.197) [-1149.001] (-1150.730) * [-1156.705] (-1150.519) (-1148.633) (-1157.198) -- 0:00:31
Average standard deviation of split frequencies: 0.011015
530500 -- [-1149.395] (-1151.808) (-1151.233) (-1151.103) * (-1158.625) (-1152.728) (-1153.027) [-1150.685] -- 0:00:30
531000 -- (-1150.413) [-1148.710] (-1151.095) (-1151.142) * (-1155.582) [-1150.201] (-1157.572) (-1152.476) -- 0:00:30
531500 -- (-1149.839) (-1150.069) [-1151.709] (-1150.222) * (-1153.000) (-1153.034) (-1157.573) [-1150.480] -- 0:00:30
532000 -- (-1148.844) [-1148.608] (-1149.923) (-1151.899) * (-1148.923) [-1152.346] (-1155.432) (-1150.511) -- 0:00:30
532500 -- (-1148.583) [-1151.244] (-1150.147) (-1154.503) * (-1153.662) (-1151.943) (-1152.007) [-1152.048] -- 0:00:30
533000 -- [-1151.370] (-1151.157) (-1150.700) (-1150.970) * (-1151.679) [-1150.746] (-1149.567) (-1156.009) -- 0:00:30
533500 -- (-1152.207) (-1155.060) (-1150.320) [-1149.166] * (-1152.370) [-1150.406] (-1154.375) (-1154.201) -- 0:00:31
534000 -- (-1152.048) (-1149.493) (-1153.188) [-1150.464] * [-1149.718] (-1151.742) (-1151.868) (-1150.326) -- 0:00:31
534500 -- (-1152.017) [-1149.943] (-1149.913) (-1150.384) * (-1149.317) (-1150.655) (-1153.884) [-1150.903] -- 0:00:31
535000 -- [-1152.798] (-1150.641) (-1154.093) (-1150.285) * (-1151.118) [-1150.559] (-1149.594) (-1152.227) -- 0:00:31
Average standard deviation of split frequencies: 0.011902
535500 -- (-1151.516) (-1152.188) [-1155.723] (-1151.763) * (-1150.658) (-1152.111) (-1155.221) [-1148.853] -- 0:00:31
536000 -- (-1150.998) (-1153.421) [-1149.842] (-1151.905) * (-1153.442) [-1152.341] (-1150.391) (-1154.159) -- 0:00:31
536500 -- (-1151.122) (-1152.097) [-1149.702] (-1150.768) * [-1153.909] (-1150.660) (-1150.432) (-1151.010) -- 0:00:31
537000 -- (-1151.914) (-1153.585) [-1152.469] (-1151.143) * (-1153.523) [-1151.273] (-1151.578) (-1150.409) -- 0:00:31
537500 -- (-1151.429) (-1154.082) [-1151.764] (-1149.577) * (-1149.901) (-1151.966) (-1153.062) [-1152.114] -- 0:00:30
538000 -- [-1152.604] (-1151.781) (-1149.093) (-1152.214) * (-1152.046) [-1150.103] (-1152.328) (-1150.146) -- 0:00:30
538500 -- [-1150.539] (-1149.541) (-1151.120) (-1150.985) * (-1152.004) (-1149.802) [-1152.242] (-1150.607) -- 0:00:30
539000 -- (-1151.664) [-1150.374] (-1153.423) (-1151.283) * [-1150.840] (-1152.011) (-1152.119) (-1150.529) -- 0:00:30
539500 -- (-1150.875) (-1150.347) (-1150.355) [-1152.749] * (-1152.053) (-1151.051) (-1151.001) [-1149.455] -- 0:00:30
540000 -- (-1150.518) (-1151.549) (-1152.879) [-1152.932] * [-1150.550] (-1151.295) (-1150.131) (-1152.788) -- 0:00:30
Average standard deviation of split frequencies: 0.012265
540500 -- (-1151.344) (-1150.602) [-1148.350] (-1152.390) * (-1152.360) (-1159.642) (-1151.430) [-1149.789] -- 0:00:30
541000 -- (-1152.116) (-1150.727) [-1154.975] (-1155.283) * [-1152.406] (-1150.989) (-1153.531) (-1156.372) -- 0:00:30
541500 -- (-1151.145) (-1151.691) [-1150.240] (-1149.880) * (-1154.591) (-1151.532) (-1151.750) [-1149.386] -- 0:00:30
542000 -- (-1151.049) (-1150.989) [-1150.115] (-1152.198) * (-1152.715) (-1153.111) [-1150.835] (-1150.761) -- 0:00:30
542500 -- [-1150.804] (-1153.061) (-1148.988) (-1154.091) * [-1151.384] (-1152.422) (-1149.988) (-1151.651) -- 0:00:30
543000 -- [-1150.049] (-1151.575) (-1150.954) (-1157.691) * (-1153.214) (-1151.109) (-1153.471) [-1150.562] -- 0:00:30
543500 -- (-1149.877) (-1151.176) [-1150.066] (-1148.603) * (-1150.543) (-1151.285) (-1148.307) [-1150.806] -- 0:00:30
544000 -- (-1152.212) (-1151.202) [-1151.116] (-1150.375) * (-1154.265) (-1150.684) (-1150.916) [-1150.826] -- 0:00:30
544500 -- (-1151.551) [-1150.794] (-1153.967) (-1153.168) * [-1150.353] (-1150.671) (-1149.202) (-1151.065) -- 0:00:30
545000 -- [-1152.555] (-1150.156) (-1154.174) (-1150.537) * [-1152.035] (-1152.953) (-1151.751) (-1150.836) -- 0:00:30
Average standard deviation of split frequencies: 0.011857
545500 -- (-1155.802) (-1150.188) [-1151.075] (-1149.879) * (-1152.175) [-1151.041] (-1152.111) (-1151.564) -- 0:00:29
546000 -- (-1152.156) (-1154.835) [-1149.650] (-1158.417) * (-1151.783) (-1150.397) [-1152.946] (-1151.048) -- 0:00:29
546500 -- (-1150.770) (-1149.434) (-1150.746) [-1149.869] * (-1150.546) [-1153.654] (-1152.473) (-1150.005) -- 0:00:29
547000 -- (-1153.941) (-1150.082) (-1150.127) [-1150.208] * (-1150.821) [-1152.512] (-1152.235) (-1150.604) -- 0:00:29
547500 -- (-1150.628) [-1149.206] (-1150.449) (-1150.285) * (-1150.250) (-1154.209) (-1151.249) [-1150.437] -- 0:00:30
548000 -- (-1150.131) (-1149.326) [-1152.437] (-1152.641) * [-1151.476] (-1154.288) (-1152.905) (-1152.717) -- 0:00:30
548500 -- (-1148.685) [-1148.477] (-1151.948) (-1151.440) * (-1152.859) (-1150.440) (-1150.373) [-1152.965] -- 0:00:30
549000 -- (-1151.901) (-1149.422) [-1155.961] (-1150.791) * [-1150.459] (-1150.608) (-1150.030) (-1150.981) -- 0:00:30
549500 -- (-1151.857) [-1148.003] (-1151.687) (-1149.318) * (-1152.901) (-1151.973) (-1149.574) [-1150.437] -- 0:00:30
550000 -- (-1150.295) [-1151.388] (-1151.225) (-1150.053) * (-1151.505) (-1155.577) [-1149.728] (-1150.780) -- 0:00:30
Average standard deviation of split frequencies: 0.012156
550500 -- (-1151.476) (-1153.188) (-1150.402) [-1149.339] * (-1151.249) (-1151.916) [-1151.404] (-1151.922) -- 0:00:30
551000 -- (-1150.462) (-1150.766) (-1149.578) [-1152.564] * (-1148.183) (-1152.393) [-1150.906] (-1151.059) -- 0:00:30
551500 -- (-1151.109) [-1153.043] (-1152.417) (-1154.899) * (-1155.788) (-1152.136) [-1152.842] (-1151.521) -- 0:00:30
552000 -- (-1150.382) (-1151.773) (-1151.434) [-1149.890] * (-1148.888) [-1150.721] (-1153.202) (-1150.729) -- 0:00:30
552500 -- (-1152.820) [-1152.402] (-1153.092) (-1152.417) * (-1149.832) [-1152.136] (-1150.507) (-1152.100) -- 0:00:29
553000 -- [-1153.021] (-1153.000) (-1155.797) (-1152.701) * [-1150.198] (-1151.887) (-1152.298) (-1150.032) -- 0:00:29
553500 -- (-1151.177) [-1158.071] (-1150.961) (-1152.278) * (-1151.618) (-1153.280) [-1150.474] (-1148.359) -- 0:00:29
554000 -- (-1149.572) (-1154.382) (-1153.962) [-1149.919] * (-1151.158) (-1148.944) (-1150.329) [-1149.803] -- 0:00:29
554500 -- (-1152.034) (-1152.752) (-1151.657) [-1152.813] * (-1151.841) [-1154.310] (-1150.779) (-1149.850) -- 0:00:29
555000 -- (-1153.066) (-1150.737) (-1151.795) [-1150.416] * (-1151.035) (-1154.100) [-1153.059] (-1150.680) -- 0:00:29
Average standard deviation of split frequencies: 0.011813
555500 -- (-1151.762) [-1149.244] (-1150.828) (-1151.593) * (-1151.110) (-1150.935) (-1152.299) [-1149.848] -- 0:00:29
556000 -- (-1150.514) (-1148.797) (-1152.113) [-1150.793] * [-1151.952] (-1150.745) (-1150.026) (-1151.583) -- 0:00:29
556500 -- (-1150.231) (-1150.582) (-1150.095) [-1150.569] * (-1151.614) (-1151.451) [-1149.685] (-1151.118) -- 0:00:29
557000 -- (-1148.289) (-1151.887) (-1155.449) [-1149.703] * [-1151.941] (-1151.099) (-1151.813) (-1150.412) -- 0:00:29
557500 -- (-1148.510) (-1148.900) (-1149.801) [-1151.826] * (-1149.938) (-1150.930) [-1150.100] (-1151.402) -- 0:00:29
558000 -- (-1151.125) (-1149.997) (-1153.053) [-1151.094] * (-1153.282) (-1150.623) [-1149.768] (-1151.399) -- 0:00:29
558500 -- (-1151.142) (-1149.985) (-1152.449) [-1152.697] * (-1151.442) (-1151.534) (-1151.094) [-1148.163] -- 0:00:29
559000 -- (-1151.991) [-1148.358] (-1149.074) (-1149.625) * [-1149.327] (-1154.209) (-1153.781) (-1150.798) -- 0:00:29
559500 -- (-1153.639) (-1149.506) [-1152.562] (-1150.115) * (-1150.856) (-1152.285) [-1151.036] (-1150.692) -- 0:00:29
560000 -- [-1150.354] (-1150.248) (-1153.491) (-1152.455) * (-1150.884) [-1151.217] (-1153.399) (-1151.994) -- 0:00:29
Average standard deviation of split frequencies: 0.012051
560500 -- (-1151.186) [-1148.561] (-1151.085) (-1152.355) * [-1151.076] (-1151.655) (-1152.448) (-1151.888) -- 0:00:29
561000 -- (-1151.038) (-1150.881) (-1152.131) [-1152.694] * [-1150.526] (-1153.167) (-1151.679) (-1155.322) -- 0:00:28
561500 -- (-1152.596) (-1151.135) [-1152.952] (-1150.349) * (-1150.553) [-1151.127] (-1151.539) (-1151.189) -- 0:00:29
562000 -- (-1154.535) (-1151.199) [-1152.486] (-1152.192) * (-1150.304) (-1150.493) (-1154.190) [-1152.150] -- 0:00:29
562500 -- [-1152.126] (-1150.908) (-1148.960) (-1151.297) * [-1149.663] (-1152.504) (-1152.163) (-1152.000) -- 0:00:29
563000 -- (-1148.742) [-1149.918] (-1151.545) (-1150.294) * (-1150.242) [-1150.467] (-1149.911) (-1151.102) -- 0:00:29
563500 -- (-1149.685) [-1151.556] (-1151.741) (-1150.430) * (-1154.842) (-1150.316) [-1150.153] (-1150.658) -- 0:00:29
564000 -- (-1152.837) (-1150.882) (-1149.555) [-1150.247] * (-1149.376) [-1153.460] (-1150.092) (-1150.255) -- 0:00:29
564500 -- (-1150.221) (-1150.811) [-1148.562] (-1152.090) * [-1149.400] (-1149.890) (-1150.875) (-1150.615) -- 0:00:29
565000 -- (-1152.715) (-1152.406) [-1149.794] (-1152.785) * (-1151.200) (-1151.107) [-1151.613] (-1153.871) -- 0:00:29
Average standard deviation of split frequencies: 0.011327
565500 -- (-1153.167) [-1151.743] (-1150.837) (-1152.691) * (-1149.668) (-1149.629) (-1149.450) [-1150.038] -- 0:00:29
566000 -- (-1151.468) (-1152.835) (-1149.364) [-1149.994] * (-1150.612) [-1152.692] (-1151.380) (-1150.199) -- 0:00:29
566500 -- (-1153.789) (-1151.544) (-1150.283) [-1151.763] * (-1151.845) (-1151.719) (-1150.036) [-1151.968] -- 0:00:29
567000 -- (-1156.767) (-1152.747) [-1150.284] (-1150.442) * (-1152.347) (-1151.790) [-1149.421] (-1150.222) -- 0:00:29
567500 -- (-1152.689) (-1149.560) (-1153.192) [-1150.302] * [-1152.625] (-1149.141) (-1158.385) (-1149.987) -- 0:00:28
568000 -- (-1150.687) (-1151.804) (-1152.102) [-1149.847] * [-1152.460] (-1150.392) (-1152.293) (-1155.348) -- 0:00:28
568500 -- (-1151.557) (-1151.240) (-1154.504) [-1148.658] * (-1154.623) [-1150.629] (-1150.441) (-1153.034) -- 0:00:28
569000 -- (-1150.844) (-1150.119) (-1151.226) [-1150.386] * [-1149.683] (-1153.535) (-1154.295) (-1149.789) -- 0:00:28
569500 -- (-1152.149) (-1149.600) (-1149.752) [-1155.907] * (-1151.374) (-1150.311) [-1151.376] (-1154.480) -- 0:00:28
570000 -- (-1151.464) (-1150.554) (-1150.937) [-1151.869] * (-1151.222) [-1151.364] (-1151.043) (-1151.914) -- 0:00:28
Average standard deviation of split frequencies: 0.010849
570500 -- (-1150.188) [-1151.047] (-1151.574) (-1149.423) * (-1150.447) [-1149.975] (-1149.592) (-1151.232) -- 0:00:28
571000 -- [-1150.611] (-1154.024) (-1154.060) (-1152.040) * (-1150.670) [-1148.894] (-1150.839) (-1149.074) -- 0:00:28
571500 -- (-1150.563) [-1151.402] (-1152.536) (-1151.614) * (-1151.479) (-1154.404) [-1151.863] (-1150.579) -- 0:00:28
572000 -- (-1150.715) (-1149.838) (-1150.401) [-1156.182] * (-1153.907) (-1151.196) [-1149.537] (-1151.119) -- 0:00:28
572500 -- (-1153.266) (-1151.830) (-1149.630) [-1150.503] * (-1153.247) (-1151.665) (-1149.372) [-1149.331] -- 0:00:28
573000 -- (-1151.540) [-1154.033] (-1152.363) (-1150.411) * (-1149.933) [-1152.123] (-1150.290) (-1151.072) -- 0:00:28
573500 -- (-1152.018) (-1154.444) (-1151.788) [-1151.617] * (-1150.076) (-1149.877) (-1151.003) [-1151.563] -- 0:00:28
574000 -- (-1150.074) [-1153.009] (-1150.875) (-1151.181) * (-1153.337) (-1152.845) (-1156.012) [-1150.662] -- 0:00:28
574500 -- [-1149.806] (-1152.613) (-1150.120) (-1151.725) * [-1151.370] (-1151.076) (-1154.187) (-1151.133) -- 0:00:28
575000 -- (-1150.441) [-1154.357] (-1150.987) (-1151.761) * [-1151.825] (-1150.792) (-1150.912) (-1152.529) -- 0:00:28
Average standard deviation of split frequencies: 0.011130
575500 -- (-1153.543) [-1153.891] (-1152.143) (-1150.523) * (-1150.039) (-1154.255) (-1154.859) [-1150.442] -- 0:00:28
576000 -- (-1152.423) [-1153.591] (-1152.427) (-1150.840) * (-1153.584) (-1155.373) [-1150.065] (-1151.670) -- 0:00:28
576500 -- (-1153.339) [-1150.105] (-1154.228) (-1153.266) * (-1153.811) (-1154.651) [-1151.066] (-1155.318) -- 0:00:28
577000 -- (-1150.838) [-1149.494] (-1152.173) (-1150.952) * (-1153.356) (-1154.490) [-1150.118] (-1150.755) -- 0:00:28
577500 -- (-1151.205) (-1152.472) (-1152.389) [-1149.458] * (-1151.709) (-1151.373) (-1152.478) [-1151.525] -- 0:00:28
578000 -- (-1152.843) (-1150.740) [-1153.465] (-1150.170) * (-1152.134) [-1150.818] (-1150.581) (-1150.874) -- 0:00:28
578500 -- (-1151.712) (-1150.925) [-1150.908] (-1151.018) * (-1153.832) [-1150.997] (-1148.822) (-1151.911) -- 0:00:28
579000 -- [-1149.901] (-1152.137) (-1151.693) (-1151.159) * (-1153.390) (-1150.042) [-1148.731] (-1151.920) -- 0:00:28
579500 -- (-1156.889) (-1151.338) [-1152.261] (-1150.655) * (-1153.577) (-1151.470) [-1150.271] (-1151.613) -- 0:00:28
580000 -- (-1154.257) (-1150.999) (-1151.911) [-1149.584] * (-1150.922) [-1150.081] (-1150.204) (-1151.851) -- 0:00:28
Average standard deviation of split frequencies: 0.010716
580500 -- (-1155.815) [-1157.104] (-1150.345) (-1150.081) * (-1149.260) (-1152.965) [-1149.616] (-1151.149) -- 0:00:28
581000 -- (-1152.783) [-1151.390] (-1150.623) (-1150.432) * (-1155.224) [-1152.579] (-1150.532) (-1152.006) -- 0:00:28
581500 -- (-1151.527) (-1151.856) [-1150.814] (-1152.017) * [-1151.429] (-1152.911) (-1152.853) (-1151.216) -- 0:00:28
582000 -- (-1154.923) (-1150.603) (-1153.508) [-1155.175] * (-1151.312) (-1152.698) (-1151.403) [-1154.098] -- 0:00:28
582500 -- (-1150.831) (-1152.405) [-1153.278] (-1151.815) * (-1148.894) [-1155.023] (-1148.955) (-1154.489) -- 0:00:27
583000 -- (-1151.733) (-1151.262) (-1152.848) [-1151.128] * (-1149.450) (-1153.907) (-1152.061) [-1151.972] -- 0:00:27
583500 -- [-1151.742] (-1151.230) (-1155.706) (-1151.571) * [-1149.035] (-1153.169) (-1153.830) (-1150.374) -- 0:00:27
584000 -- (-1151.411) (-1151.875) [-1151.599] (-1152.057) * (-1150.325) (-1151.910) [-1150.707] (-1151.381) -- 0:00:27
584500 -- (-1152.061) (-1152.839) [-1150.455] (-1151.201) * (-1153.943) (-1153.053) [-1153.423] (-1153.436) -- 0:00:27
585000 -- [-1151.146] (-1152.196) (-1150.391) (-1150.020) * (-1149.889) [-1150.501] (-1153.701) (-1151.384) -- 0:00:27
Average standard deviation of split frequencies: 0.010351
585500 -- (-1148.301) [-1153.208] (-1149.793) (-1154.724) * [-1148.894] (-1151.410) (-1151.619) (-1152.514) -- 0:00:27
586000 -- (-1151.597) (-1152.001) (-1150.673) [-1152.420] * (-1151.718) (-1152.799) (-1150.806) [-1150.050] -- 0:00:27
586500 -- [-1150.727] (-1155.138) (-1149.684) (-1151.106) * (-1150.085) [-1151.449] (-1152.533) (-1152.180) -- 0:00:27
587000 -- [-1151.284] (-1152.257) (-1151.761) (-1151.301) * (-1150.448) (-1151.443) (-1150.820) [-1154.359] -- 0:00:27
587500 -- (-1157.068) [-1149.298] (-1151.546) (-1151.751) * [-1148.934] (-1151.150) (-1153.272) (-1151.644) -- 0:00:27
588000 -- (-1150.640) [-1153.523] (-1153.510) (-1150.668) * (-1148.563) (-1152.810) [-1148.403] (-1150.535) -- 0:00:27
588500 -- (-1149.462) (-1153.296) [-1149.814] (-1149.185) * (-1152.354) (-1152.233) [-1151.381] (-1150.377) -- 0:00:27
589000 -- (-1156.528) (-1151.490) (-1149.409) [-1150.670] * (-1152.298) (-1151.769) (-1151.259) [-1149.962] -- 0:00:27
589500 -- [-1153.725] (-1150.735) (-1150.974) (-1151.685) * (-1147.714) (-1150.536) [-1150.099] (-1150.008) -- 0:00:27
590000 -- (-1152.091) [-1150.097] (-1150.155) (-1151.902) * (-1155.038) [-1150.402] (-1149.870) (-1150.073) -- 0:00:27
Average standard deviation of split frequencies: 0.010535
590500 -- (-1153.139) [-1150.479] (-1151.179) (-1152.576) * (-1152.349) (-1150.336) [-1151.623] (-1151.842) -- 0:00:27
591000 -- (-1152.360) (-1151.045) (-1151.892) [-1152.386] * (-1149.769) (-1151.052) (-1153.473) [-1151.075] -- 0:00:27
591500 -- (-1151.383) (-1150.118) [-1150.931] (-1152.709) * (-1148.082) [-1150.639] (-1152.029) (-1152.398) -- 0:00:27
592000 -- (-1155.142) (-1151.351) [-1151.013] (-1152.413) * [-1149.929] (-1153.294) (-1150.853) (-1150.991) -- 0:00:27
592500 -- (-1154.430) [-1150.024] (-1150.472) (-1152.816) * (-1150.111) [-1151.141] (-1152.955) (-1151.290) -- 0:00:27
593000 -- (-1151.356) (-1155.082) (-1151.470) [-1152.609] * (-1153.806) (-1152.139) (-1150.238) [-1151.634] -- 0:00:27
593500 -- [-1149.970] (-1151.039) (-1149.963) (-1150.064) * (-1151.652) [-1154.098] (-1151.095) (-1150.341) -- 0:00:27
594000 -- (-1154.131) (-1153.900) (-1149.479) [-1150.902] * (-1151.081) (-1152.754) [-1150.616] (-1151.402) -- 0:00:27
594500 -- [-1150.487] (-1152.813) (-1150.372) (-1152.304) * (-1152.610) [-1153.199] (-1151.245) (-1150.694) -- 0:00:27
595000 -- (-1150.056) [-1158.863] (-1152.015) (-1151.534) * (-1154.240) [-1150.141] (-1150.207) (-1149.835) -- 0:00:27
Average standard deviation of split frequencies: 0.010546
595500 -- (-1154.869) (-1158.907) (-1151.891) [-1150.891] * (-1150.975) (-1152.524) [-1150.174] (-1153.644) -- 0:00:27
596000 -- (-1153.669) (-1151.612) (-1150.958) [-1154.046] * (-1151.242) (-1151.530) (-1149.739) [-1151.011] -- 0:00:27
596500 -- (-1154.619) (-1151.363) (-1155.600) [-1150.199] * [-1149.165] (-1152.793) (-1149.239) (-1152.140) -- 0:00:27
597000 -- (-1151.934) [-1150.391] (-1153.789) (-1151.232) * (-1150.112) (-1153.239) [-1151.023] (-1152.887) -- 0:00:27
597500 -- (-1152.872) (-1152.530) (-1152.345) [-1153.624] * (-1151.964) [-1150.626] (-1150.796) (-1152.685) -- 0:00:26
598000 -- (-1153.263) [-1151.006] (-1149.747) (-1151.440) * [-1149.876] (-1150.265) (-1150.203) (-1152.140) -- 0:00:26
598500 -- (-1153.794) (-1150.679) [-1155.163] (-1148.964) * (-1151.976) [-1151.810] (-1151.951) (-1152.800) -- 0:00:26
599000 -- [-1149.759] (-1153.881) (-1155.337) (-1149.976) * (-1150.772) (-1151.115) [-1151.547] (-1149.281) -- 0:00:26
599500 -- [-1150.234] (-1150.325) (-1154.567) (-1151.170) * (-1149.479) (-1151.205) (-1151.005) [-1151.242] -- 0:00:26
600000 -- [-1149.767] (-1150.093) (-1151.977) (-1148.979) * (-1153.394) (-1149.844) [-1149.538] (-1150.686) -- 0:00:26
Average standard deviation of split frequencies: 0.010883
600500 -- (-1150.166) [-1151.411] (-1152.669) (-1150.906) * (-1152.936) [-1150.224] (-1150.769) (-1151.148) -- 0:00:26
601000 -- (-1152.226) (-1154.189) (-1155.298) [-1149.643] * (-1151.446) [-1150.713] (-1150.872) (-1151.329) -- 0:00:26
601500 -- (-1150.941) (-1151.120) [-1148.913] (-1154.217) * (-1150.024) (-1153.751) (-1149.755) [-1151.391] -- 0:00:26
602000 -- (-1151.499) (-1149.976) (-1150.463) [-1149.517] * (-1151.279) (-1150.364) [-1152.284] (-1150.075) -- 0:00:26
602500 -- (-1150.578) (-1152.098) (-1150.422) [-1150.547] * (-1150.677) (-1149.798) (-1152.572) [-1149.948] -- 0:00:26
603000 -- [-1151.385] (-1151.147) (-1150.688) (-1149.394) * (-1152.991) (-1149.978) [-1150.459] (-1151.454) -- 0:00:26
603500 -- [-1152.298] (-1152.397) (-1152.929) (-1150.790) * (-1151.508) (-1150.991) (-1150.000) [-1150.924] -- 0:00:26
604000 -- [-1152.287] (-1151.038) (-1150.454) (-1148.674) * [-1150.632] (-1150.811) (-1148.556) (-1155.484) -- 0:00:26
604500 -- (-1154.217) (-1151.747) [-1149.904] (-1153.820) * [-1150.632] (-1152.888) (-1151.353) (-1155.327) -- 0:00:26
605000 -- (-1149.551) (-1152.682) (-1149.599) [-1151.428] * (-1150.731) (-1153.995) [-1151.920] (-1153.138) -- 0:00:26
Average standard deviation of split frequencies: 0.010579
605500 -- (-1150.818) (-1152.566) [-1150.592] (-1150.080) * (-1151.172) (-1156.277) (-1149.337) [-1153.633] -- 0:00:26
606000 -- (-1154.839) (-1151.376) (-1150.844) [-1151.136] * (-1150.931) (-1152.018) [-1151.227] (-1151.111) -- 0:00:26
606500 -- (-1151.274) (-1151.620) (-1153.794) [-1151.749] * [-1152.126] (-1152.596) (-1150.163) (-1150.760) -- 0:00:26
607000 -- [-1151.023] (-1152.506) (-1152.301) (-1149.625) * [-1151.282] (-1152.817) (-1149.191) (-1153.042) -- 0:00:26
607500 -- (-1154.527) [-1151.201] (-1152.828) (-1153.243) * (-1149.542) (-1156.896) (-1149.329) [-1149.180] -- 0:00:26
608000 -- (-1152.612) (-1151.417) (-1150.965) [-1150.529] * [-1148.865] (-1150.962) (-1155.013) (-1151.629) -- 0:00:26
608500 -- [-1152.754] (-1157.094) (-1150.491) (-1151.023) * (-1149.205) [-1150.560] (-1152.028) (-1154.019) -- 0:00:26
609000 -- (-1152.145) [-1152.793] (-1150.558) (-1151.988) * (-1149.851) (-1151.002) (-1150.729) [-1149.056] -- 0:00:26
609500 -- [-1152.263] (-1149.925) (-1151.650) (-1150.546) * (-1150.728) (-1153.190) (-1150.070) [-1149.739] -- 0:00:26
610000 -- [-1151.734] (-1152.018) (-1152.541) (-1150.998) * (-1150.928) (-1153.541) (-1153.095) [-1150.451] -- 0:00:26
Average standard deviation of split frequencies: 0.011116
610500 -- (-1150.747) (-1151.684) (-1153.388) [-1150.619] * [-1148.909] (-1150.981) (-1149.400) (-1153.722) -- 0:00:26
611000 -- (-1150.044) (-1150.961) [-1150.947] (-1152.599) * [-1149.228] (-1154.622) (-1153.560) (-1150.434) -- 0:00:26
611500 -- (-1151.147) [-1151.172] (-1151.396) (-1151.627) * (-1150.716) [-1152.572] (-1152.559) (-1149.190) -- 0:00:26
612000 -- (-1150.657) (-1149.046) [-1161.624] (-1150.352) * (-1150.729) (-1150.270) [-1150.553] (-1151.354) -- 0:00:25
612500 -- (-1150.645) (-1150.406) (-1153.168) [-1149.911] * (-1153.851) [-1152.061] (-1152.518) (-1151.065) -- 0:00:25
613000 -- (-1150.873) [-1149.192] (-1150.633) (-1149.578) * [-1153.623] (-1150.096) (-1150.827) (-1152.363) -- 0:00:25
613500 -- [-1151.976] (-1152.979) (-1150.213) (-1154.678) * (-1148.911) [-1150.947] (-1149.710) (-1159.662) -- 0:00:25
614000 -- (-1153.314) (-1152.259) (-1150.479) [-1149.982] * (-1149.785) (-1152.655) (-1151.426) [-1151.543] -- 0:00:25
614500 -- (-1152.420) (-1150.858) [-1154.414] (-1151.231) * (-1152.970) [-1152.569] (-1151.033) (-1154.523) -- 0:00:25
615000 -- (-1152.358) (-1151.873) (-1154.264) [-1150.139] * [-1151.211] (-1153.364) (-1154.532) (-1155.001) -- 0:00:25
Average standard deviation of split frequencies: 0.011122
615500 -- (-1151.767) [-1151.574] (-1151.156) (-1151.355) * (-1149.241) [-1150.338] (-1152.730) (-1150.971) -- 0:00:25
616000 -- (-1152.226) (-1150.283) [-1150.450] (-1153.850) * (-1150.034) (-1155.589) [-1151.431] (-1153.474) -- 0:00:25
616500 -- [-1150.357] (-1151.017) (-1152.275) (-1154.765) * [-1151.071] (-1154.321) (-1151.621) (-1155.447) -- 0:00:25
617000 -- [-1153.134] (-1150.493) (-1150.833) (-1154.218) * [-1151.926] (-1151.081) (-1151.697) (-1151.869) -- 0:00:25
617500 -- (-1152.373) [-1149.426] (-1150.577) (-1151.568) * (-1150.305) (-1152.754) [-1156.299] (-1151.156) -- 0:00:25
618000 -- (-1151.627) (-1150.373) (-1150.948) [-1150.518] * (-1151.218) [-1150.056] (-1151.611) (-1153.393) -- 0:00:25
618500 -- [-1150.523] (-1149.376) (-1151.468) (-1149.429) * (-1154.292) (-1149.408) (-1149.814) [-1153.039] -- 0:00:25
619000 -- (-1152.947) (-1149.129) (-1151.758) [-1152.591] * (-1149.681) (-1149.742) (-1150.176) [-1152.976] -- 0:00:25
619500 -- (-1150.095) (-1151.128) (-1154.059) [-1150.483] * [-1151.034] (-1150.876) (-1150.055) (-1150.153) -- 0:00:25
620000 -- (-1151.708) (-1150.685) (-1150.802) [-1149.275] * (-1152.607) (-1152.360) (-1149.885) [-1150.599] -- 0:00:25
Average standard deviation of split frequencies: 0.010734
620500 -- [-1152.226] (-1151.839) (-1155.761) (-1150.020) * (-1154.863) [-1149.750] (-1150.509) (-1151.422) -- 0:00:25
621000 -- [-1150.579] (-1151.880) (-1151.949) (-1151.954) * (-1151.423) [-1152.604] (-1150.211) (-1153.058) -- 0:00:25
621500 -- (-1149.750) (-1150.412) (-1151.215) [-1154.292] * [-1150.827] (-1149.686) (-1151.655) (-1149.946) -- 0:00:25
622000 -- (-1150.310) [-1150.669] (-1150.795) (-1159.007) * [-1151.500] (-1152.431) (-1152.953) (-1150.143) -- 0:00:25
622500 -- (-1151.633) (-1152.162) (-1151.404) [-1149.576] * [-1151.353] (-1153.334) (-1151.702) (-1151.604) -- 0:00:25
623000 -- (-1150.892) (-1153.519) [-1149.970] (-1148.680) * (-1152.884) (-1153.400) (-1151.910) [-1153.283] -- 0:00:25
623500 -- [-1151.408] (-1151.648) (-1153.655) (-1152.814) * (-1153.596) [-1151.104] (-1152.503) (-1150.649) -- 0:00:25
624000 -- (-1149.549) (-1152.097) (-1149.501) [-1152.707] * (-1155.154) [-1149.148] (-1151.684) (-1151.213) -- 0:00:25
624500 -- [-1149.058] (-1154.481) (-1150.328) (-1151.288) * (-1150.028) (-1153.548) (-1151.686) [-1150.164] -- 0:00:25
625000 -- (-1151.814) (-1151.379) (-1150.727) [-1151.552] * (-1150.526) (-1150.738) (-1152.379) [-1149.731] -- 0:00:25
Average standard deviation of split frequencies: 0.010191
625500 -- (-1150.165) (-1151.915) (-1151.277) [-1153.705] * (-1154.164) [-1150.852] (-1152.910) (-1152.609) -- 0:00:25
626000 -- [-1149.907] (-1151.569) (-1151.721) (-1150.618) * (-1151.385) [-1150.642] (-1154.577) (-1157.289) -- 0:00:25
626500 -- (-1150.246) [-1152.450] (-1153.366) (-1150.448) * (-1151.172) (-1153.122) [-1149.977] (-1151.543) -- 0:00:25
627000 -- (-1150.709) (-1153.927) [-1151.858] (-1150.220) * (-1149.725) [-1152.657] (-1151.264) (-1152.376) -- 0:00:24
627500 -- (-1153.286) (-1153.592) (-1151.647) [-1150.313] * (-1150.074) (-1152.431) (-1152.289) [-1151.013] -- 0:00:24
628000 -- (-1154.168) (-1151.601) [-1154.762] (-1152.774) * (-1151.230) (-1151.617) [-1151.237] (-1151.412) -- 0:00:24
628500 -- (-1150.862) (-1151.155) (-1153.260) [-1153.495] * [-1150.406] (-1153.680) (-1150.531) (-1150.579) -- 0:00:24
629000 -- (-1152.023) (-1150.518) [-1150.030] (-1150.872) * [-1150.724] (-1149.003) (-1150.895) (-1151.250) -- 0:00:24
629500 -- (-1151.254) (-1151.036) (-1149.629) [-1152.245] * (-1152.362) (-1148.187) [-1150.606] (-1156.495) -- 0:00:24
630000 -- [-1150.383] (-1150.612) (-1150.630) (-1152.435) * (-1151.016) (-1148.468) [-1152.385] (-1149.756) -- 0:00:24
Average standard deviation of split frequencies: 0.010315
630500 -- (-1152.356) (-1152.458) [-1150.298] (-1153.883) * (-1151.593) (-1158.056) [-1149.940] (-1150.052) -- 0:00:24
631000 -- (-1150.039) [-1151.109] (-1148.405) (-1155.072) * (-1151.832) [-1150.168] (-1152.410) (-1153.223) -- 0:00:24
631500 -- (-1152.885) [-1153.300] (-1152.796) (-1150.782) * [-1151.089] (-1150.877) (-1152.118) (-1152.543) -- 0:00:24
632000 -- [-1149.803] (-1151.332) (-1155.666) (-1150.523) * [-1152.244] (-1151.320) (-1152.074) (-1150.755) -- 0:00:24
632500 -- [-1152.710] (-1149.887) (-1154.272) (-1150.199) * (-1150.099) (-1153.648) [-1151.595] (-1152.870) -- 0:00:24
633000 -- [-1151.797] (-1153.559) (-1151.106) (-1151.041) * (-1151.104) (-1154.212) (-1150.861) [-1149.589] -- 0:00:24
633500 -- (-1152.421) (-1149.655) [-1152.973] (-1150.055) * (-1152.745) (-1149.815) (-1149.541) [-1148.917] -- 0:00:24
634000 -- [-1151.053] (-1151.923) (-1153.109) (-1151.522) * (-1151.601) (-1152.744) (-1153.631) [-1150.830] -- 0:00:24
634500 -- [-1151.997] (-1150.649) (-1152.355) (-1150.759) * (-1151.006) (-1153.130) [-1151.965] (-1151.306) -- 0:00:24
635000 -- (-1152.577) (-1150.003) [-1152.369] (-1150.640) * (-1150.186) (-1150.128) [-1152.490] (-1149.986) -- 0:00:24
Average standard deviation of split frequencies: 0.010723
635500 -- (-1158.208) (-1152.125) (-1153.941) [-1150.014] * (-1150.918) (-1149.742) (-1151.158) [-1151.076] -- 0:00:24
636000 -- [-1148.253] (-1152.961) (-1153.346) (-1151.836) * (-1153.365) (-1150.918) [-1150.705] (-1150.694) -- 0:00:24
636500 -- [-1152.634] (-1151.591) (-1151.234) (-1152.138) * [-1156.127] (-1151.845) (-1151.375) (-1148.462) -- 0:00:24
637000 -- (-1154.504) [-1152.001] (-1153.166) (-1152.243) * (-1151.486) [-1149.998] (-1155.064) (-1148.138) -- 0:00:24
637500 -- [-1151.487] (-1151.486) (-1149.959) (-1150.322) * [-1150.541] (-1150.107) (-1151.873) (-1149.709) -- 0:00:24
638000 -- (-1155.504) [-1150.921] (-1152.337) (-1152.966) * (-1151.655) [-1150.278] (-1150.293) (-1150.758) -- 0:00:24
638500 -- (-1157.458) (-1150.995) [-1151.578] (-1149.822) * (-1151.186) [-1150.580] (-1151.969) (-1150.875) -- 0:00:24
639000 -- (-1150.900) (-1149.193) [-1149.542] (-1150.089) * (-1151.827) [-1148.450] (-1151.764) (-1150.614) -- 0:00:24
639500 -- (-1150.938) (-1150.246) [-1151.593] (-1150.167) * (-1149.613) (-1152.842) [-1151.019] (-1150.675) -- 0:00:24
640000 -- (-1150.157) (-1151.659) (-1150.650) [-1150.697] * (-1153.880) (-1154.019) [-1154.388] (-1155.612) -- 0:00:24
Average standard deviation of split frequencies: 0.010301
640500 -- (-1152.204) (-1152.606) [-1151.142] (-1151.331) * (-1153.518) [-1150.122] (-1154.009) (-1150.139) -- 0:00:24
641000 -- (-1152.005) (-1155.180) (-1149.996) [-1151.693] * [-1150.758] (-1151.024) (-1153.583) (-1151.597) -- 0:00:24
641500 -- (-1151.916) (-1151.284) (-1149.724) [-1149.769] * [-1150.202] (-1150.356) (-1151.376) (-1150.333) -- 0:00:24
642000 -- (-1159.628) (-1152.254) (-1152.301) [-1150.815] * (-1152.281) (-1153.630) (-1151.734) [-1150.485] -- 0:00:23
642500 -- (-1150.328) [-1150.615] (-1152.661) (-1154.337) * (-1152.503) (-1149.442) [-1152.329] (-1151.448) -- 0:00:23
643000 -- (-1150.066) [-1151.614] (-1150.545) (-1151.180) * [-1150.582] (-1153.506) (-1150.389) (-1153.283) -- 0:00:23
643500 -- (-1150.952) (-1151.644) [-1150.447] (-1152.251) * (-1149.807) [-1149.747] (-1153.433) (-1153.619) -- 0:00:23
644000 -- [-1152.448] (-1153.052) (-1150.259) (-1150.772) * (-1151.142) (-1151.347) (-1150.966) [-1152.630] -- 0:00:23
644500 -- (-1148.933) (-1153.251) (-1153.193) [-1149.188] * [-1152.880] (-1155.649) (-1153.114) (-1151.089) -- 0:00:23
645000 -- (-1150.073) [-1150.708] (-1152.345) (-1149.402) * (-1150.224) (-1158.557) (-1149.915) [-1151.558] -- 0:00:23
Average standard deviation of split frequencies: 0.010022
645500 -- (-1149.807) (-1153.212) (-1150.016) [-1149.208] * (-1151.424) [-1152.318] (-1153.264) (-1152.328) -- 0:00:23
646000 -- (-1151.282) (-1153.134) [-1150.690] (-1151.031) * (-1154.682) (-1150.834) (-1154.638) [-1150.347] -- 0:00:23
646500 -- (-1156.535) (-1150.332) [-1150.044] (-1150.590) * (-1150.323) [-1152.979] (-1154.512) (-1150.062) -- 0:00:23
647000 -- [-1151.791] (-1149.863) (-1152.668) (-1150.417) * [-1150.661] (-1153.363) (-1151.801) (-1148.441) -- 0:00:23
647500 -- (-1150.214) (-1149.934) [-1151.350] (-1150.307) * (-1151.696) [-1151.469] (-1151.155) (-1151.077) -- 0:00:23
648000 -- [-1150.694] (-1151.759) (-1151.049) (-1150.610) * (-1151.858) (-1150.418) [-1150.766] (-1150.610) -- 0:00:23
648500 -- (-1149.481) (-1150.814) (-1151.297) [-1150.839] * (-1151.655) (-1154.250) [-1154.989] (-1150.483) -- 0:00:23
649000 -- [-1149.909] (-1148.441) (-1150.366) (-1151.485) * (-1149.929) [-1150.850] (-1152.429) (-1150.210) -- 0:00:23
649500 -- (-1152.329) (-1150.375) (-1150.183) [-1149.301] * [-1149.754] (-1150.016) (-1152.672) (-1156.876) -- 0:00:23
650000 -- (-1152.798) [-1149.456] (-1153.593) (-1149.779) * (-1154.481) [-1151.742] (-1155.626) (-1152.330) -- 0:00:23
Average standard deviation of split frequencies: 0.009563
650500 -- (-1150.928) (-1151.947) (-1151.837) [-1147.906] * (-1150.070) (-1150.956) (-1156.334) [-1151.882] -- 0:00:23
651000 -- (-1150.125) (-1150.990) (-1152.029) [-1151.152] * (-1149.991) (-1152.045) [-1150.863] (-1151.055) -- 0:00:23
651500 -- (-1152.251) [-1151.951] (-1151.970) (-1149.856) * (-1150.578) (-1149.136) (-1151.164) [-1150.435] -- 0:00:23
652000 -- [-1152.164] (-1155.419) (-1149.875) (-1150.908) * (-1151.484) (-1155.492) [-1150.931] (-1150.976) -- 0:00:23
652500 -- (-1151.066) (-1150.994) [-1150.246] (-1150.825) * (-1149.799) [-1152.695] (-1151.128) (-1155.833) -- 0:00:23
653000 -- [-1152.331] (-1148.276) (-1151.033) (-1149.539) * (-1151.193) (-1150.226) (-1150.254) [-1148.925] -- 0:00:23
653500 -- (-1150.314) [-1147.636] (-1152.186) (-1149.758) * (-1153.797) (-1151.654) (-1152.120) [-1150.041] -- 0:00:23
654000 -- [-1150.439] (-1149.754) (-1157.315) (-1152.223) * [-1151.515] (-1149.564) (-1151.782) (-1151.030) -- 0:00:23
654500 -- [-1152.167] (-1149.316) (-1159.960) (-1150.269) * (-1155.209) [-1150.296] (-1152.604) (-1151.630) -- 0:00:23
655000 -- (-1152.706) (-1149.694) (-1163.921) [-1154.134] * (-1151.770) [-1149.383] (-1154.408) (-1151.751) -- 0:00:23
Average standard deviation of split frequencies: 0.009246
655500 -- (-1149.908) [-1150.304] (-1161.222) (-1152.311) * (-1150.395) (-1150.135) [-1153.934] (-1151.333) -- 0:00:23
656000 -- [-1149.290] (-1149.830) (-1158.147) (-1151.487) * (-1149.698) [-1153.229] (-1154.201) (-1153.883) -- 0:00:23
656500 -- (-1150.015) (-1149.567) (-1150.329) [-1150.323] * (-1149.722) (-1151.623) (-1152.318) [-1149.954] -- 0:00:23
657000 -- (-1151.742) (-1151.036) (-1155.891) [-1152.500] * [-1151.499] (-1152.336) (-1152.112) (-1149.727) -- 0:00:22
657500 -- [-1151.610] (-1151.529) (-1151.236) (-1152.323) * (-1152.208) (-1150.139) (-1154.306) [-1152.294] -- 0:00:22
658000 -- (-1152.399) [-1152.968] (-1150.125) (-1151.189) * [-1152.112] (-1153.067) (-1151.806) (-1149.343) -- 0:00:22
658500 -- (-1155.172) [-1151.314] (-1151.530) (-1153.142) * (-1149.860) (-1155.682) (-1154.918) [-1149.457] -- 0:00:22
659000 -- (-1150.564) (-1149.715) (-1149.643) [-1149.934] * (-1150.706) (-1150.220) [-1153.032] (-1149.418) -- 0:00:22
659500 -- [-1151.881] (-1152.233) (-1148.395) (-1150.771) * (-1151.516) [-1148.925] (-1152.369) (-1151.864) -- 0:00:22
660000 -- (-1152.883) (-1151.670) (-1155.736) [-1151.668] * (-1150.405) (-1149.400) [-1149.279] (-1153.404) -- 0:00:22
Average standard deviation of split frequencies: 0.009514
660500 -- (-1150.788) (-1150.867) (-1151.110) [-1150.963] * (-1150.787) (-1149.453) [-1150.086] (-1149.797) -- 0:00:22
661000 -- (-1149.951) (-1151.222) [-1150.835] (-1150.776) * (-1154.527) (-1152.218) (-1149.269) [-1151.396] -- 0:00:22
661500 -- (-1152.443) (-1155.342) (-1150.493) [-1149.262] * (-1153.156) [-1149.028] (-1150.441) (-1151.205) -- 0:00:22
662000 -- (-1151.054) (-1157.727) (-1152.644) [-1149.982] * (-1152.761) (-1150.660) (-1157.817) [-1149.727] -- 0:00:22
662500 -- (-1151.529) [-1152.521] (-1151.435) (-1154.527) * (-1149.825) (-1149.786) (-1154.717) [-1149.780] -- 0:00:22
663000 -- (-1150.247) (-1151.267) [-1152.752] (-1151.825) * (-1152.780) [-1151.661] (-1151.965) (-1153.028) -- 0:00:22
663500 -- (-1151.331) [-1150.472] (-1153.384) (-1150.650) * [-1149.350] (-1150.762) (-1152.721) (-1148.165) -- 0:00:22
664000 -- [-1150.517] (-1152.802) (-1152.044) (-1152.263) * (-1151.576) [-1150.143] (-1149.849) (-1150.912) -- 0:00:22
664500 -- (-1153.947) (-1152.240) (-1151.657) [-1152.993] * (-1151.991) [-1151.430] (-1150.936) (-1152.495) -- 0:00:22
665000 -- (-1152.377) (-1150.518) (-1150.272) [-1152.953] * (-1151.332) [-1150.259] (-1154.575) (-1151.942) -- 0:00:22
Average standard deviation of split frequencies: 0.009626
665500 -- (-1151.169) [-1149.277] (-1149.548) (-1155.290) * (-1149.928) [-1149.954] (-1154.229) (-1150.851) -- 0:00:22
666000 -- [-1150.064] (-1151.298) (-1153.176) (-1153.949) * (-1150.273) (-1154.612) [-1151.595] (-1151.847) -- 0:00:22
666500 -- (-1153.983) [-1149.573] (-1149.579) (-1152.009) * [-1152.327] (-1151.769) (-1152.079) (-1153.394) -- 0:00:22
667000 -- (-1153.706) [-1151.488] (-1151.062) (-1150.090) * (-1152.340) [-1150.841] (-1149.043) (-1151.449) -- 0:00:22
667500 -- (-1148.926) (-1153.735) (-1152.424) [-1152.597] * [-1152.096] (-1151.690) (-1153.059) (-1153.930) -- 0:00:22
668000 -- (-1152.311) (-1152.867) [-1152.449] (-1149.806) * (-1149.326) (-1154.696) (-1152.938) [-1151.261] -- 0:00:22
668500 -- (-1151.980) (-1154.094) [-1148.977] (-1154.989) * (-1151.001) (-1150.553) [-1151.122] (-1153.364) -- 0:00:22
669000 -- (-1150.370) (-1149.982) (-1156.514) [-1155.358] * (-1151.672) [-1150.218] (-1153.122) (-1151.572) -- 0:00:22
669500 -- [-1149.453] (-1152.168) (-1150.823) (-1150.363) * (-1148.658) (-1153.068) (-1156.624) [-1150.237] -- 0:00:22
670000 -- (-1151.103) [-1150.247] (-1151.494) (-1152.333) * (-1152.490) (-1154.867) (-1153.925) [-1149.695] -- 0:00:22
Average standard deviation of split frequencies: 0.009840
670500 -- (-1151.022) [-1151.916] (-1151.061) (-1149.121) * (-1151.421) [-1152.116] (-1150.696) (-1152.198) -- 0:00:22
671000 -- [-1150.619] (-1152.737) (-1152.325) (-1151.584) * (-1151.589) (-1152.375) (-1150.452) [-1150.253] -- 0:00:22
671500 -- (-1152.259) [-1156.248] (-1151.029) (-1151.487) * [-1151.126] (-1150.001) (-1149.674) (-1151.539) -- 0:00:22
672000 -- (-1151.676) (-1148.520) [-1151.237] (-1152.083) * [-1150.627] (-1147.853) (-1150.438) (-1151.096) -- 0:00:21
672500 -- (-1149.016) [-1149.346] (-1149.131) (-1154.239) * (-1149.481) (-1150.478) (-1149.965) [-1150.977] -- 0:00:21
673000 -- (-1148.411) (-1151.848) (-1152.978) [-1152.385] * [-1149.889] (-1150.898) (-1152.722) (-1153.052) -- 0:00:21
673500 -- (-1151.122) [-1151.440] (-1150.430) (-1150.719) * (-1150.888) [-1153.050] (-1152.532) (-1150.088) -- 0:00:21
674000 -- (-1150.474) (-1151.604) (-1152.988) [-1150.653] * [-1150.760] (-1149.582) (-1155.288) (-1149.887) -- 0:00:21
674500 -- (-1155.333) (-1150.525) [-1150.448] (-1150.445) * (-1151.377) (-1151.786) [-1151.053] (-1150.446) -- 0:00:21
675000 -- (-1149.855) [-1151.479] (-1151.669) (-1154.476) * (-1151.793) [-1153.959] (-1150.497) (-1153.344) -- 0:00:21
Average standard deviation of split frequencies: 0.009437
675500 -- (-1151.667) (-1150.037) (-1150.388) [-1152.059] * [-1150.915] (-1154.683) (-1151.639) (-1149.505) -- 0:00:21
676000 -- [-1150.598] (-1152.092) (-1151.999) (-1153.266) * (-1150.531) [-1151.523] (-1152.951) (-1150.911) -- 0:00:21
676500 -- (-1151.386) [-1153.975] (-1151.712) (-1154.964) * [-1151.921] (-1151.868) (-1153.691) (-1154.294) -- 0:00:21
677000 -- [-1150.776] (-1151.382) (-1150.305) (-1151.789) * (-1153.198) [-1151.139] (-1150.806) (-1152.161) -- 0:00:21
677500 -- [-1153.416] (-1150.875) (-1155.317) (-1149.523) * (-1150.828) (-1150.059) [-1151.629] (-1150.460) -- 0:00:21
678000 -- (-1152.435) (-1154.437) (-1153.775) [-1151.865] * (-1150.704) (-1149.050) (-1151.711) [-1148.919] -- 0:00:21
678500 -- (-1152.325) (-1153.403) [-1150.955] (-1153.399) * (-1154.474) [-1149.391] (-1152.579) (-1152.460) -- 0:00:21
679000 -- (-1150.523) (-1152.161) [-1149.958] (-1158.163) * (-1153.892) (-1154.967) [-1155.153] (-1153.296) -- 0:00:21
679500 -- (-1155.634) (-1153.430) [-1148.825] (-1150.236) * (-1152.107) [-1152.177] (-1152.032) (-1152.139) -- 0:00:21
680000 -- (-1152.235) (-1151.379) (-1149.094) [-1151.800] * [-1151.382] (-1150.895) (-1154.888) (-1151.069) -- 0:00:21
Average standard deviation of split frequencies: 0.009234
680500 -- [-1150.939] (-1149.530) (-1149.577) (-1153.470) * [-1150.216] (-1150.547) (-1151.086) (-1149.528) -- 0:00:21
681000 -- [-1151.162] (-1150.794) (-1150.075) (-1151.069) * (-1150.045) (-1150.465) (-1149.653) [-1150.423] -- 0:00:21
681500 -- [-1150.184] (-1151.122) (-1149.479) (-1151.584) * (-1152.428) (-1150.349) [-1149.366] (-1151.208) -- 0:00:21
682000 -- (-1150.954) (-1152.552) (-1151.916) [-1151.061] * (-1151.361) (-1154.974) (-1156.009) [-1152.279] -- 0:00:21
682500 -- (-1149.059) (-1150.683) [-1149.885] (-1151.165) * (-1151.491) (-1153.768) [-1156.255] (-1150.433) -- 0:00:21
683000 -- (-1151.916) (-1150.030) [-1149.875] (-1149.422) * (-1155.679) (-1152.415) [-1150.973] (-1152.520) -- 0:00:21
683500 -- [-1150.744] (-1152.040) (-1151.445) (-1151.156) * (-1151.016) (-1157.376) [-1150.688] (-1149.708) -- 0:00:21
684000 -- [-1153.151] (-1151.105) (-1153.508) (-1152.174) * [-1150.320] (-1150.322) (-1150.857) (-1156.514) -- 0:00:21
684500 -- (-1153.466) (-1148.788) [-1150.631] (-1151.469) * (-1149.942) [-1149.238] (-1148.958) (-1150.246) -- 0:00:21
685000 -- [-1150.716] (-1150.291) (-1148.755) (-1152.879) * (-1152.657) [-1152.053] (-1152.675) (-1150.834) -- 0:00:21
Average standard deviation of split frequencies: 0.009162
685500 -- [-1149.841] (-1151.920) (-1149.079) (-1152.691) * [-1150.753] (-1151.218) (-1152.065) (-1153.570) -- 0:00:21
686000 -- (-1151.975) (-1152.994) (-1152.250) [-1152.459] * (-1150.696) [-1149.440] (-1150.308) (-1150.490) -- 0:00:21
686500 -- [-1150.476] (-1151.410) (-1148.951) (-1153.623) * (-1151.170) (-1150.045) (-1154.471) [-1150.871] -- 0:00:21
687000 -- (-1150.803) [-1151.358] (-1149.571) (-1151.374) * (-1150.834) [-1149.989] (-1151.812) (-1150.447) -- 0:00:20
687500 -- (-1149.430) (-1154.373) (-1150.495) [-1150.581] * [-1150.152] (-1151.133) (-1149.753) (-1151.991) -- 0:00:20
688000 -- (-1150.463) (-1153.396) (-1150.973) [-1152.274] * (-1150.677) [-1150.251] (-1149.947) (-1153.053) -- 0:00:20
688500 -- (-1150.655) (-1152.591) (-1150.008) [-1150.481] * (-1151.908) [-1152.195] (-1150.118) (-1149.939) -- 0:00:20
689000 -- (-1151.256) (-1150.662) (-1151.418) [-1149.935] * (-1151.299) (-1155.403) (-1151.147) [-1152.186] -- 0:00:20
689500 -- [-1151.597] (-1148.688) (-1149.586) (-1151.328) * (-1150.734) [-1151.758] (-1156.433) (-1150.664) -- 0:00:20
690000 -- [-1149.896] (-1153.355) (-1150.157) (-1152.569) * [-1154.118] (-1148.935) (-1157.933) (-1152.039) -- 0:00:20
Average standard deviation of split frequencies: 0.009146
690500 -- (-1149.288) (-1153.710) (-1150.830) [-1151.076] * [-1150.651] (-1151.927) (-1151.250) (-1150.749) -- 0:00:20
691000 -- (-1151.704) (-1150.995) [-1151.445] (-1152.326) * (-1152.998) [-1149.512] (-1149.558) (-1152.180) -- 0:00:21
691500 -- [-1150.706] (-1154.088) (-1151.783) (-1151.434) * [-1152.682] (-1151.533) (-1151.450) (-1152.531) -- 0:00:20
692000 -- (-1150.886) [-1152.232] (-1152.222) (-1152.288) * (-1151.980) (-1150.474) (-1149.836) [-1150.726] -- 0:00:20
692500 -- (-1151.529) [-1153.648] (-1153.296) (-1154.155) * [-1151.083] (-1152.097) (-1151.057) (-1150.828) -- 0:00:20
693000 -- (-1152.231) (-1150.031) (-1152.406) [-1151.209] * (-1151.012) (-1149.872) (-1152.215) [-1152.248] -- 0:00:20
693500 -- (-1154.214) (-1151.294) [-1153.907] (-1153.558) * [-1153.550] (-1151.207) (-1148.388) (-1150.191) -- 0:00:20
694000 -- (-1150.388) (-1150.762) [-1154.396] (-1152.365) * [-1152.050] (-1154.769) (-1152.488) (-1151.525) -- 0:00:20
694500 -- (-1148.991) (-1153.759) (-1154.570) [-1150.395] * (-1148.851) (-1150.961) (-1150.023) [-1151.526] -- 0:00:20
695000 -- (-1155.400) (-1152.538) [-1150.604] (-1152.010) * (-1153.018) [-1152.227] (-1153.803) (-1152.625) -- 0:00:20
Average standard deviation of split frequencies: 0.009076
695500 -- (-1159.606) [-1151.502] (-1152.852) (-1151.534) * (-1148.084) (-1149.190) [-1152.407] (-1152.248) -- 0:00:20
696000 -- (-1150.094) (-1150.989) [-1150.953] (-1150.665) * (-1156.854) [-1150.021] (-1154.774) (-1149.713) -- 0:00:20
696500 -- (-1153.006) (-1157.140) [-1149.181] (-1154.719) * (-1151.208) [-1149.804] (-1150.421) (-1150.029) -- 0:00:20
697000 -- (-1150.883) [-1151.352] (-1158.284) (-1152.750) * (-1151.390) (-1150.074) [-1149.110] (-1150.587) -- 0:00:20
697500 -- [-1151.079] (-1157.824) (-1149.340) (-1150.125) * (-1148.885) [-1153.161] (-1151.129) (-1152.735) -- 0:00:20
698000 -- (-1152.350) (-1152.160) (-1152.545) [-1152.191] * (-1153.137) (-1150.366) [-1150.208] (-1151.709) -- 0:00:20
698500 -- (-1153.669) (-1150.515) (-1151.147) [-1153.535] * [-1150.045] (-1151.249) (-1149.982) (-1152.254) -- 0:00:20
699000 -- (-1152.380) (-1151.368) (-1150.968) [-1150.602] * (-1151.247) [-1150.207] (-1156.521) (-1152.242) -- 0:00:20
699500 -- (-1150.053) (-1150.444) (-1152.538) [-1150.637] * (-1149.204) [-1150.848] (-1150.307) (-1150.563) -- 0:00:20
700000 -- (-1152.632) [-1150.375] (-1152.888) (-1150.261) * [-1155.798] (-1150.368) (-1151.377) (-1150.040) -- 0:00:20
Average standard deviation of split frequencies: 0.008791
700500 -- [-1151.805] (-1153.775) (-1153.363) (-1151.948) * (-1149.703) (-1149.577) (-1149.662) [-1149.903] -- 0:00:20
701000 -- (-1152.499) (-1148.402) [-1152.784] (-1150.235) * (-1152.925) [-1150.108] (-1150.027) (-1156.155) -- 0:00:20
701500 -- [-1149.199] (-1150.332) (-1151.841) (-1150.536) * (-1154.208) (-1151.374) [-1150.100] (-1148.731) -- 0:00:19
702000 -- (-1151.253) (-1151.071) (-1153.163) [-1150.277] * [-1150.848] (-1155.828) (-1152.262) (-1153.403) -- 0:00:19
702500 -- [-1150.642] (-1151.665) (-1150.417) (-1148.794) * [-1150.630] (-1151.671) (-1150.224) (-1156.046) -- 0:00:19
703000 -- [-1148.734] (-1149.939) (-1150.034) (-1150.281) * [-1150.278] (-1156.086) (-1150.497) (-1154.107) -- 0:00:19
703500 -- (-1153.594) [-1150.877] (-1150.104) (-1152.084) * (-1149.462) (-1153.624) [-1150.806] (-1149.818) -- 0:00:19
704000 -- (-1150.126) (-1150.503) (-1151.904) [-1149.812] * (-1150.381) (-1150.823) [-1151.192] (-1150.888) -- 0:00:19
704500 -- [-1155.388] (-1150.999) (-1151.223) (-1151.256) * (-1150.693) [-1150.743] (-1149.469) (-1151.595) -- 0:00:19
705000 -- (-1151.205) (-1149.996) (-1152.112) [-1151.697] * (-1151.048) [-1150.308] (-1149.476) (-1153.448) -- 0:00:19
Average standard deviation of split frequencies: 0.009170
705500 -- (-1150.352) (-1150.968) (-1150.283) [-1151.638] * (-1149.169) [-1151.723] (-1149.841) (-1153.556) -- 0:00:20
706000 -- (-1150.667) [-1150.805] (-1151.874) (-1150.267) * (-1152.963) [-1150.823] (-1155.059) (-1150.496) -- 0:00:19
706500 -- (-1151.985) [-1153.592] (-1150.893) (-1150.078) * (-1151.522) (-1156.240) [-1147.543] (-1152.704) -- 0:00:19
707000 -- (-1151.871) (-1152.552) (-1151.562) [-1149.432] * (-1150.447) (-1153.573) [-1151.182] (-1159.063) -- 0:00:19
707500 -- [-1151.019] (-1155.017) (-1158.531) (-1150.757) * [-1150.582] (-1152.607) (-1150.920) (-1150.420) -- 0:00:19
708000 -- (-1152.485) (-1152.457) [-1150.549] (-1150.101) * (-1150.363) (-1151.236) (-1152.080) [-1151.900] -- 0:00:19
708500 -- (-1152.325) [-1152.610] (-1151.439) (-1148.788) * (-1152.440) (-1151.063) [-1151.490] (-1152.142) -- 0:00:19
709000 -- (-1154.486) [-1151.014] (-1151.870) (-1150.914) * (-1162.931) [-1151.393] (-1152.049) (-1150.954) -- 0:00:19
709500 -- (-1151.603) [-1149.964] (-1152.346) (-1151.840) * (-1152.805) (-1150.960) (-1151.827) [-1152.076] -- 0:00:19
710000 -- (-1150.142) (-1151.300) [-1152.695] (-1152.201) * [-1156.265] (-1151.196) (-1151.010) (-1150.849) -- 0:00:19
Average standard deviation of split frequencies: 0.008933
710500 -- (-1151.483) [-1151.855] (-1151.030) (-1151.704) * (-1154.320) (-1152.753) (-1152.344) [-1150.449] -- 0:00:19
711000 -- (-1151.064) (-1151.945) (-1149.401) [-1153.933] * [-1149.439] (-1151.761) (-1151.896) (-1153.183) -- 0:00:19
711500 -- (-1151.855) (-1151.964) (-1151.848) [-1153.058] * [-1150.742] (-1151.328) (-1151.264) (-1153.591) -- 0:00:19
712000 -- (-1153.157) (-1149.640) [-1150.485] (-1155.338) * (-1151.057) (-1151.677) (-1152.787) [-1152.712] -- 0:00:19
712500 -- [-1151.293] (-1151.284) (-1151.510) (-1155.235) * (-1149.597) (-1153.597) [-1151.821] (-1151.032) -- 0:00:19
713000 -- [-1152.205] (-1153.912) (-1152.319) (-1156.531) * (-1151.860) (-1158.651) (-1152.180) [-1149.859] -- 0:00:19
713500 -- [-1151.049] (-1149.349) (-1151.238) (-1153.285) * (-1152.562) [-1151.806] (-1150.067) (-1151.006) -- 0:00:19
714000 -- (-1149.508) (-1149.823) (-1153.021) [-1152.996] * [-1151.892] (-1153.932) (-1150.893) (-1154.828) -- 0:00:19
714500 -- (-1152.429) (-1154.864) [-1153.210] (-1152.426) * (-1151.430) (-1154.850) (-1150.785) [-1150.908] -- 0:00:19
715000 -- (-1149.768) (-1155.071) [-1150.133] (-1151.148) * (-1153.677) [-1153.861] (-1151.495) (-1150.560) -- 0:00:19
Average standard deviation of split frequencies: 0.009042
715500 -- (-1151.670) (-1149.782) (-1150.787) [-1150.948] * (-1151.610) (-1152.746) [-1152.164] (-1148.639) -- 0:00:19
716000 -- (-1150.279) (-1149.718) [-1150.290] (-1151.560) * (-1150.868) (-1150.838) (-1153.746) [-1150.870] -- 0:00:19
716500 -- (-1151.642) (-1153.850) (-1149.491) [-1149.698] * [-1150.259] (-1151.159) (-1153.256) (-1151.719) -- 0:00:18
717000 -- (-1149.911) [-1151.162] (-1152.868) (-1151.180) * (-1153.881) [-1151.146] (-1152.265) (-1151.642) -- 0:00:18
717500 -- (-1150.364) (-1151.333) [-1149.693] (-1149.768) * [-1153.883] (-1150.844) (-1152.787) (-1153.434) -- 0:00:18
718000 -- (-1149.502) (-1150.340) [-1152.159] (-1152.108) * (-1150.654) (-1153.092) (-1150.860) [-1152.019] -- 0:00:18
718500 -- [-1149.116] (-1151.169) (-1151.446) (-1148.751) * (-1152.183) [-1150.438] (-1152.798) (-1151.675) -- 0:00:18
719000 -- [-1150.677] (-1153.651) (-1155.372) (-1151.051) * [-1152.390] (-1152.017) (-1156.320) (-1151.086) -- 0:00:18
719500 -- [-1150.789] (-1149.291) (-1150.475) (-1151.174) * (-1150.679) (-1151.802) (-1150.956) [-1151.299] -- 0:00:18
720000 -- (-1151.698) (-1151.374) [-1151.297] (-1151.937) * (-1150.796) (-1154.457) (-1152.441) [-1151.059] -- 0:00:19
Average standard deviation of split frequencies: 0.009201
720500 -- (-1151.109) (-1149.447) (-1150.409) [-1150.197] * (-1154.912) [-1150.976] (-1151.316) (-1154.667) -- 0:00:19
721000 -- [-1150.652] (-1151.121) (-1152.107) (-1155.037) * (-1153.604) [-1151.054] (-1151.701) (-1155.720) -- 0:00:18
721500 -- [-1154.029] (-1152.448) (-1151.410) (-1150.576) * (-1151.669) (-1150.131) [-1151.920] (-1152.190) -- 0:00:18
722000 -- (-1152.217) [-1151.495] (-1151.949) (-1151.631) * (-1151.002) (-1150.327) (-1152.674) [-1153.860] -- 0:00:18
722500 -- [-1149.195] (-1151.472) (-1151.139) (-1153.315) * (-1149.474) (-1152.559) (-1152.326) [-1152.406] -- 0:00:18
723000 -- (-1150.644) [-1152.672] (-1151.812) (-1154.351) * (-1150.842) (-1151.076) (-1150.061) [-1150.013] -- 0:00:18
723500 -- (-1149.527) [-1150.240] (-1151.055) (-1152.023) * (-1152.953) [-1150.336] (-1150.314) (-1151.984) -- 0:00:18
724000 -- (-1149.495) (-1151.351) [-1151.495] (-1156.264) * (-1154.281) [-1148.983] (-1154.817) (-1154.328) -- 0:00:18
724500 -- (-1151.415) (-1150.204) [-1150.416] (-1155.535) * [-1151.790] (-1151.606) (-1152.611) (-1153.505) -- 0:00:18
725000 -- [-1151.372] (-1150.936) (-1149.732) (-1153.703) * (-1154.589) (-1152.033) (-1151.153) [-1153.208] -- 0:00:18
Average standard deviation of split frequencies: 0.009220
725500 -- [-1152.031] (-1150.367) (-1150.439) (-1152.353) * [-1154.798] (-1153.180) (-1148.276) (-1152.939) -- 0:00:18
726000 -- (-1150.177) [-1149.830] (-1151.477) (-1150.073) * (-1154.421) (-1152.442) (-1150.943) [-1150.401] -- 0:00:18
726500 -- (-1150.280) [-1149.410] (-1150.888) (-1150.428) * (-1150.658) (-1150.193) [-1152.191] (-1150.790) -- 0:00:18
727000 -- (-1151.483) (-1151.507) [-1150.753] (-1153.192) * (-1151.106) (-1149.953) (-1153.470) [-1152.023] -- 0:00:18
727500 -- (-1151.653) (-1151.228) [-1152.332] (-1151.671) * (-1151.942) (-1153.449) (-1154.795) [-1153.037] -- 0:00:18
728000 -- [-1151.175] (-1151.440) (-1151.194) (-1152.494) * (-1150.609) (-1151.481) (-1151.979) [-1150.350] -- 0:00:18
728500 -- (-1152.710) (-1151.335) (-1155.458) [-1149.142] * (-1154.369) (-1152.515) [-1151.380] (-1150.116) -- 0:00:18
729000 -- (-1152.302) (-1148.775) [-1154.260] (-1160.473) * [-1150.188] (-1151.025) (-1155.083) (-1151.687) -- 0:00:18
729500 -- (-1152.841) [-1149.607] (-1152.452) (-1151.470) * (-1155.871) (-1151.858) (-1153.852) [-1151.109] -- 0:00:18
730000 -- (-1151.426) [-1152.792] (-1151.640) (-1150.474) * (-1152.392) (-1150.916) [-1148.953] (-1151.999) -- 0:00:18
Average standard deviation of split frequencies: 0.008860
730500 -- (-1149.413) [-1151.803] (-1151.823) (-1155.349) * (-1155.178) [-1152.483] (-1151.467) (-1152.369) -- 0:00:18
731000 -- (-1151.986) (-1149.309) [-1149.750] (-1155.982) * (-1150.739) (-1152.389) [-1150.524] (-1151.242) -- 0:00:18
731500 -- (-1151.043) [-1152.583] (-1149.596) (-1154.284) * (-1151.784) [-1153.149] (-1149.424) (-1149.801) -- 0:00:17
732000 -- [-1151.676] (-1150.788) (-1151.927) (-1151.346) * [-1154.989] (-1153.169) (-1149.509) (-1151.799) -- 0:00:17
732500 -- (-1152.925) [-1150.327] (-1150.312) (-1150.493) * (-1151.074) (-1149.977) (-1152.655) [-1150.551] -- 0:00:17
733000 -- (-1151.770) (-1150.275) (-1150.108) [-1149.871] * (-1150.504) (-1150.527) (-1151.900) [-1150.261] -- 0:00:17
733500 -- [-1153.426] (-1150.208) (-1155.190) (-1149.746) * (-1152.288) (-1151.131) (-1149.791) [-1155.336] -- 0:00:17
734000 -- (-1153.406) [-1153.045] (-1154.894) (-1151.931) * (-1151.153) [-1150.927] (-1153.227) (-1152.939) -- 0:00:17
734500 -- [-1150.156] (-1150.469) (-1152.345) (-1151.248) * (-1150.597) (-1149.995) (-1151.790) [-1155.294] -- 0:00:18
735000 -- (-1153.494) [-1150.886] (-1149.750) (-1150.406) * [-1149.398] (-1151.445) (-1151.339) (-1152.618) -- 0:00:18
Average standard deviation of split frequencies: 0.008497
735500 -- (-1152.056) (-1153.584) (-1150.614) [-1152.390] * [-1151.307] (-1151.621) (-1152.321) (-1151.449) -- 0:00:17
736000 -- (-1150.504) [-1149.117] (-1149.812) (-1150.633) * (-1151.073) (-1151.319) (-1149.993) [-1149.608] -- 0:00:17
736500 -- (-1152.577) (-1151.825) (-1148.645) [-1151.018] * (-1151.994) [-1149.810] (-1149.835) (-1150.644) -- 0:00:17
737000 -- [-1150.715] (-1154.206) (-1148.746) (-1155.567) * (-1151.102) (-1152.999) (-1150.044) [-1151.584] -- 0:00:17
737500 -- (-1151.031) (-1151.121) [-1150.347] (-1149.662) * (-1149.627) (-1151.370) [-1149.901] (-1156.652) -- 0:00:17
738000 -- (-1152.487) (-1151.260) [-1150.625] (-1150.795) * [-1150.961] (-1150.948) (-1151.492) (-1151.199) -- 0:00:17
738500 -- (-1150.372) (-1150.047) (-1150.588) [-1153.179] * (-1149.710) (-1152.255) [-1151.045] (-1150.633) -- 0:00:17
739000 -- (-1149.710) (-1149.268) [-1149.246] (-1150.229) * [-1150.156] (-1151.940) (-1153.704) (-1151.453) -- 0:00:17
739500 -- [-1152.161] (-1151.366) (-1150.723) (-1152.758) * [-1151.865] (-1152.013) (-1156.796) (-1152.783) -- 0:00:17
740000 -- (-1151.000) (-1148.440) (-1151.100) [-1151.768] * (-1151.543) (-1150.156) [-1154.279] (-1157.336) -- 0:00:17
Average standard deviation of split frequencies: 0.008274
740500 -- (-1152.916) [-1150.404] (-1149.477) (-1151.193) * (-1151.848) [-1149.643] (-1157.413) (-1151.466) -- 0:00:17
741000 -- (-1149.998) (-1152.635) [-1149.868] (-1149.616) * (-1150.576) (-1150.243) [-1151.339] (-1153.291) -- 0:00:17
741500 -- (-1150.161) (-1152.623) (-1150.392) [-1151.333] * (-1151.178) (-1149.132) [-1152.540] (-1152.232) -- 0:00:17
742000 -- (-1153.195) (-1150.115) (-1150.985) [-1152.279] * [-1150.930] (-1148.043) (-1150.550) (-1153.191) -- 0:00:17
742500 -- (-1152.564) (-1151.482) (-1151.959) [-1151.426] * (-1154.925) [-1150.982] (-1149.970) (-1149.538) -- 0:00:17
743000 -- (-1152.334) [-1152.781] (-1149.793) (-1151.722) * (-1152.559) (-1152.096) (-1150.392) [-1152.056] -- 0:00:17
743500 -- (-1152.754) [-1149.256] (-1152.795) (-1153.403) * (-1149.009) [-1150.533] (-1150.947) (-1151.062) -- 0:00:17
744000 -- (-1148.202) (-1153.843) (-1148.944) [-1151.645] * [-1150.257] (-1152.210) (-1152.274) (-1151.699) -- 0:00:17
744500 -- (-1153.419) (-1150.550) [-1149.932] (-1150.154) * (-1148.554) [-1153.177] (-1151.163) (-1151.368) -- 0:00:17
745000 -- (-1149.144) [-1151.761] (-1151.420) (-1153.503) * (-1152.638) (-1150.909) (-1151.813) [-1151.099] -- 0:00:17
Average standard deviation of split frequencies: 0.008046
745500 -- (-1152.109) (-1151.321) (-1149.381) [-1150.473] * (-1152.058) (-1153.819) [-1148.837] (-1154.341) -- 0:00:17
746000 -- (-1153.314) (-1150.629) [-1150.568] (-1149.972) * (-1155.327) (-1153.947) (-1151.376) [-1151.148] -- 0:00:17
746500 -- (-1154.454) [-1154.892] (-1151.335) (-1150.380) * (-1152.599) (-1150.464) [-1148.989] (-1152.530) -- 0:00:16
747000 -- (-1151.580) [-1153.275] (-1150.807) (-1150.747) * (-1153.391) [-1151.740] (-1150.042) (-1153.645) -- 0:00:16
747500 -- (-1155.816) [-1154.260] (-1151.800) (-1153.264) * (-1155.080) (-1154.968) [-1150.243] (-1154.666) -- 0:00:16
748000 -- [-1151.204] (-1153.666) (-1150.274) (-1149.857) * [-1149.793] (-1154.454) (-1150.539) (-1156.831) -- 0:00:16
748500 -- (-1148.546) (-1153.471) (-1154.358) [-1149.843] * (-1150.303) (-1154.064) (-1151.161) [-1152.022] -- 0:00:16
749000 -- [-1151.240] (-1151.511) (-1152.859) (-1152.182) * [-1154.869] (-1152.873) (-1151.616) (-1152.154) -- 0:00:17
749500 -- (-1150.673) (-1149.314) (-1150.088) [-1151.193] * [-1151.752] (-1153.801) (-1152.220) (-1150.342) -- 0:00:17
750000 -- (-1155.930) (-1149.480) [-1151.943] (-1150.460) * (-1153.919) [-1154.718] (-1150.200) (-1152.217) -- 0:00:17
Average standard deviation of split frequencies: 0.008206
750500 -- [-1152.831] (-1150.220) (-1150.296) (-1150.223) * [-1150.587] (-1155.078) (-1153.219) (-1151.909) -- 0:00:16
751000 -- (-1153.663) (-1151.658) [-1150.559] (-1151.275) * (-1151.057) [-1152.566] (-1151.780) (-1151.564) -- 0:00:16
751500 -- (-1152.909) [-1150.580] (-1150.593) (-1152.677) * (-1150.730) (-1150.172) (-1151.377) [-1157.156] -- 0:00:16
752000 -- (-1152.221) (-1155.076) (-1152.438) [-1151.414] * [-1150.677] (-1151.033) (-1154.825) (-1149.376) -- 0:00:16
752500 -- (-1153.497) [-1150.013] (-1150.611) (-1151.531) * [-1149.411] (-1150.185) (-1156.110) (-1151.650) -- 0:00:16
753000 -- (-1151.237) (-1149.663) [-1150.929] (-1151.024) * [-1150.853] (-1150.777) (-1149.195) (-1151.614) -- 0:00:16
753500 -- (-1151.319) [-1148.965] (-1151.829) (-1150.821) * [-1150.519] (-1150.136) (-1151.651) (-1151.855) -- 0:00:16
754000 -- [-1151.557] (-1150.921) (-1149.631) (-1152.055) * [-1151.245] (-1151.086) (-1157.818) (-1152.011) -- 0:00:16
754500 -- (-1151.838) (-1149.929) (-1148.343) [-1150.031] * (-1153.938) [-1148.251] (-1152.000) (-1149.914) -- 0:00:16
755000 -- (-1154.395) (-1150.208) [-1152.196] (-1150.029) * (-1152.836) [-1150.932] (-1151.013) (-1150.725) -- 0:00:16
Average standard deviation of split frequencies: 0.008023
755500 -- (-1151.755) (-1152.786) [-1148.591] (-1152.694) * [-1149.554] (-1152.281) (-1155.736) (-1150.175) -- 0:00:16
756000 -- (-1152.221) (-1153.190) (-1151.406) [-1150.310] * [-1155.433] (-1153.514) (-1152.619) (-1151.968) -- 0:00:16
756500 -- (-1150.684) (-1153.350) [-1150.483] (-1149.663) * [-1151.585] (-1150.701) (-1153.195) (-1154.455) -- 0:00:16
757000 -- [-1152.343] (-1153.567) (-1153.841) (-1153.787) * (-1152.758) [-1151.407] (-1152.831) (-1149.774) -- 0:00:16
757500 -- (-1153.540) [-1151.576] (-1151.831) (-1153.425) * [-1153.291] (-1149.565) (-1149.991) (-1151.495) -- 0:00:16
758000 -- (-1151.858) [-1148.894] (-1154.516) (-1150.855) * (-1150.246) (-1150.074) [-1150.542] (-1147.775) -- 0:00:16
758500 -- [-1149.611] (-1149.882) (-1155.569) (-1151.057) * (-1152.757) (-1151.790) [-1151.145] (-1151.741) -- 0:00:16
759000 -- [-1149.719] (-1151.809) (-1150.883) (-1152.035) * (-1154.394) (-1149.816) (-1150.881) [-1150.677] -- 0:00:16
759500 -- (-1155.047) (-1151.164) (-1151.990) [-1151.195] * (-1150.342) (-1150.093) (-1149.258) [-1148.445] -- 0:00:16
760000 -- [-1148.874] (-1153.680) (-1151.849) (-1149.882) * (-1154.745) (-1152.337) [-1153.477] (-1150.565) -- 0:00:16
Average standard deviation of split frequencies: 0.008346
760500 -- [-1151.488] (-1151.726) (-1153.100) (-1150.905) * [-1151.664] (-1151.028) (-1155.616) (-1150.441) -- 0:00:16
761000 -- (-1151.963) [-1152.897] (-1153.320) (-1150.905) * (-1150.943) [-1152.102] (-1150.155) (-1150.944) -- 0:00:16
761500 -- [-1149.491] (-1152.470) (-1155.557) (-1151.600) * [-1148.593] (-1152.902) (-1153.613) (-1151.892) -- 0:00:15
762000 -- (-1151.576) (-1155.907) (-1152.161) [-1149.396] * (-1150.121) (-1152.483) (-1152.638) [-1148.649] -- 0:00:15
762500 -- [-1151.878] (-1151.501) (-1153.363) (-1149.310) * (-1150.840) (-1149.337) [-1152.329] (-1149.681) -- 0:00:15
763000 -- (-1150.045) (-1150.986) [-1151.662] (-1151.627) * (-1155.107) [-1148.336] (-1151.306) (-1151.280) -- 0:00:16
763500 -- (-1150.955) [-1150.855] (-1151.694) (-1155.024) * [-1151.911] (-1150.819) (-1154.007) (-1150.812) -- 0:00:16
764000 -- (-1150.024) (-1150.928) (-1160.756) [-1151.129] * (-1150.863) (-1148.976) (-1154.336) [-1150.978] -- 0:00:16
764500 -- (-1151.877) (-1150.824) (-1155.995) [-1148.817] * (-1151.345) (-1155.934) [-1153.126] (-1151.213) -- 0:00:16
765000 -- (-1150.819) (-1150.845) [-1150.261] (-1149.488) * [-1154.176] (-1151.701) (-1153.440) (-1149.594) -- 0:00:15
Average standard deviation of split frequencies: 0.007836
765500 -- [-1152.791] (-1151.052) (-1150.776) (-1149.571) * [-1148.390] (-1152.529) (-1152.461) (-1151.720) -- 0:00:15
766000 -- (-1150.941) (-1150.056) [-1150.970] (-1150.910) * (-1150.243) (-1151.134) (-1155.783) [-1150.169] -- 0:00:15
766500 -- (-1151.649) (-1150.688) (-1152.473) [-1155.233] * (-1154.475) (-1152.665) (-1153.433) [-1150.513] -- 0:00:15
767000 -- (-1150.737) (-1150.027) [-1153.978] (-1150.591) * (-1152.089) (-1154.202) (-1153.288) [-1150.312] -- 0:00:15
767500 -- (-1150.552) (-1149.715) [-1152.695] (-1152.271) * [-1152.233] (-1150.904) (-1152.809) (-1150.087) -- 0:00:15
768000 -- (-1152.412) (-1151.830) [-1151.074] (-1150.595) * (-1151.026) (-1150.632) (-1148.644) [-1148.838] -- 0:00:15
768500 -- [-1151.437] (-1154.666) (-1152.205) (-1150.683) * (-1150.472) [-1150.251] (-1156.169) (-1150.300) -- 0:00:15
769000 -- (-1151.430) (-1151.120) (-1150.201) [-1152.290] * (-1155.992) (-1149.272) [-1148.957] (-1150.228) -- 0:00:15
769500 -- (-1151.665) [-1153.169] (-1150.652) (-1152.076) * (-1153.147) [-1150.468] (-1153.027) (-1150.562) -- 0:00:15
770000 -- [-1151.656] (-1152.369) (-1151.364) (-1150.412) * (-1153.125) (-1155.707) (-1149.039) [-1151.883] -- 0:00:15
Average standard deviation of split frequencies: 0.008645
770500 -- [-1151.854] (-1152.633) (-1152.870) (-1154.313) * [-1151.294] (-1150.831) (-1151.515) (-1151.372) -- 0:00:15
771000 -- (-1151.969) (-1151.282) [-1151.963] (-1151.204) * [-1150.029] (-1151.739) (-1152.897) (-1151.426) -- 0:00:15
771500 -- (-1150.306) [-1150.069] (-1151.316) (-1154.026) * (-1150.533) [-1156.679] (-1150.611) (-1155.667) -- 0:00:15
772000 -- [-1150.170] (-1151.235) (-1148.839) (-1151.411) * (-1149.399) (-1154.142) [-1149.595] (-1152.387) -- 0:00:15
772500 -- [-1156.178] (-1150.347) (-1150.044) (-1151.056) * [-1150.806] (-1151.488) (-1151.094) (-1150.974) -- 0:00:15
773000 -- [-1151.455] (-1152.496) (-1150.289) (-1152.502) * (-1150.147) (-1149.788) (-1150.661) [-1150.570] -- 0:00:15
773500 -- (-1150.292) (-1151.341) (-1151.254) [-1151.085] * [-1149.700] (-1151.920) (-1150.219) (-1150.156) -- 0:00:15
774000 -- [-1149.158] (-1152.036) (-1150.180) (-1150.429) * (-1150.963) [-1148.276] (-1149.747) (-1154.372) -- 0:00:15
774500 -- (-1149.221) [-1151.483] (-1151.225) (-1151.516) * (-1152.031) (-1150.476) (-1151.041) [-1154.091] -- 0:00:15
775000 -- [-1151.201] (-1151.061) (-1157.598) (-1150.838) * [-1152.327] (-1151.225) (-1150.415) (-1151.828) -- 0:00:15
Average standard deviation of split frequencies: 0.008545
775500 -- (-1149.926) (-1151.741) (-1152.548) [-1156.372] * (-1149.361) [-1152.458] (-1150.771) (-1152.612) -- 0:00:15
776000 -- [-1151.088] (-1151.782) (-1150.053) (-1155.004) * (-1149.699) (-1149.662) [-1150.052] (-1149.961) -- 0:00:15
776500 -- (-1150.557) (-1153.804) (-1154.410) [-1150.749] * (-1151.500) [-1151.580] (-1150.617) (-1151.502) -- 0:00:14
777000 -- (-1152.804) [-1150.152] (-1149.953) (-1151.728) * (-1152.314) (-1151.601) (-1153.101) [-1150.217] -- 0:00:14
777500 -- (-1152.937) (-1151.701) [-1153.223] (-1150.114) * (-1152.357) (-1152.171) (-1152.461) [-1150.589] -- 0:00:15
778000 -- (-1153.279) [-1151.967] (-1151.798) (-1150.219) * (-1149.430) (-1150.601) [-1152.115] (-1150.182) -- 0:00:15
778500 -- (-1152.230) (-1148.802) [-1152.085] (-1152.390) * (-1154.144) (-1150.679) (-1155.002) [-1153.078] -- 0:00:15
779000 -- (-1154.114) (-1151.547) (-1153.464) [-1150.873] * (-1150.282) [-1150.665] (-1151.030) (-1150.452) -- 0:00:15
779500 -- [-1150.584] (-1151.626) (-1151.755) (-1153.825) * [-1149.657] (-1151.385) (-1149.409) (-1148.803) -- 0:00:14
780000 -- (-1149.811) (-1149.655) (-1151.492) [-1151.382] * (-1150.913) (-1151.474) (-1150.472) [-1149.955] -- 0:00:14
Average standard deviation of split frequencies: 0.008414
780500 -- (-1150.305) (-1151.446) [-1149.991] (-1150.896) * (-1151.482) [-1149.836] (-1149.323) (-1152.072) -- 0:00:14
781000 -- (-1151.416) [-1152.550] (-1155.237) (-1151.036) * (-1149.513) [-1150.489] (-1150.010) (-1150.855) -- 0:00:14
781500 -- (-1151.651) (-1152.658) (-1150.373) [-1151.800] * [-1151.441] (-1151.250) (-1151.516) (-1153.667) -- 0:00:14
782000 -- (-1150.146) (-1151.855) (-1152.334) [-1152.342] * (-1150.787) (-1150.642) (-1151.460) [-1153.813] -- 0:00:14
782500 -- [-1154.556] (-1152.754) (-1150.765) (-1153.305) * (-1151.070) (-1150.198) [-1154.149] (-1151.198) -- 0:00:14
783000 -- (-1160.713) (-1152.066) (-1148.787) [-1152.577] * (-1150.145) [-1150.022] (-1151.537) (-1150.876) -- 0:00:14
783500 -- (-1150.676) (-1153.283) [-1150.016] (-1152.834) * (-1149.712) (-1152.562) (-1150.677) [-1150.078] -- 0:00:14
784000 -- (-1151.384) (-1151.984) [-1150.836] (-1153.324) * (-1151.640) [-1150.993] (-1150.439) (-1151.066) -- 0:00:14
784500 -- (-1150.722) [-1150.066] (-1151.478) (-1149.173) * (-1154.278) (-1153.342) [-1153.365] (-1150.554) -- 0:00:14
785000 -- (-1158.038) [-1152.513] (-1150.653) (-1150.210) * (-1153.481) (-1150.487) (-1153.507) [-1153.633] -- 0:00:14
Average standard deviation of split frequencies: 0.007957
785500 -- (-1158.007) [-1150.599] (-1153.564) (-1152.570) * [-1153.008] (-1149.930) (-1151.110) (-1153.535) -- 0:00:14
786000 -- (-1150.992) (-1153.487) [-1150.296] (-1151.259) * (-1154.829) [-1150.292] (-1156.159) (-1150.459) -- 0:00:14
786500 -- (-1151.887) (-1150.100) [-1150.678] (-1151.989) * (-1151.339) (-1151.052) [-1154.981] (-1150.627) -- 0:00:14
787000 -- (-1153.942) (-1151.073) [-1153.963] (-1153.009) * (-1153.363) (-1149.392) [-1152.640] (-1152.150) -- 0:00:14
787500 -- (-1151.658) [-1150.479] (-1151.187) (-1151.726) * (-1152.078) [-1151.266] (-1149.289) (-1154.287) -- 0:00:14
788000 -- (-1156.309) [-1150.740] (-1150.414) (-1149.410) * [-1152.529] (-1152.638) (-1149.179) (-1157.940) -- 0:00:14
788500 -- (-1152.640) [-1150.724] (-1150.919) (-1152.557) * [-1151.091] (-1151.171) (-1149.835) (-1150.097) -- 0:00:14
789000 -- (-1151.977) (-1151.375) (-1151.232) [-1150.467] * [-1151.034] (-1151.799) (-1150.295) (-1151.241) -- 0:00:14
789500 -- (-1159.905) (-1149.947) (-1149.147) [-1151.082] * (-1150.568) (-1152.361) [-1150.193] (-1150.651) -- 0:00:14
790000 -- (-1150.390) (-1150.257) [-1149.117] (-1153.695) * (-1150.615) [-1150.729] (-1151.366) (-1150.416) -- 0:00:14
Average standard deviation of split frequencies: 0.008466
790500 -- (-1152.306) (-1149.774) [-1150.660] (-1150.742) * (-1151.842) [-1153.354] (-1151.925) (-1151.554) -- 0:00:14
791000 -- (-1157.274) [-1150.722] (-1150.675) (-1152.111) * (-1152.204) (-1154.213) (-1156.975) [-1152.280] -- 0:00:14
791500 -- [-1151.438] (-1150.432) (-1151.279) (-1152.213) * (-1152.148) (-1152.770) (-1149.613) [-1150.467] -- 0:00:13
792000 -- [-1151.413] (-1158.215) (-1152.744) (-1150.571) * (-1149.394) [-1153.267] (-1150.971) (-1151.829) -- 0:00:14
792500 -- (-1153.754) (-1154.798) [-1149.948] (-1154.907) * (-1154.583) [-1150.900] (-1150.377) (-1154.094) -- 0:00:14
793000 -- [-1148.529] (-1157.459) (-1150.695) (-1150.286) * (-1153.472) [-1151.643] (-1157.476) (-1150.684) -- 0:00:14
793500 -- (-1148.649) (-1151.634) [-1148.693] (-1150.464) * (-1151.174) (-1150.621) (-1151.502) [-1153.122] -- 0:00:14
794000 -- (-1153.502) (-1152.409) (-1148.409) [-1150.238] * (-1151.907) [-1150.819] (-1151.953) (-1152.457) -- 0:00:14
794500 -- [-1150.757] (-1151.008) (-1151.526) (-1152.523) * (-1150.099) (-1151.480) (-1149.842) [-1154.241] -- 0:00:13
795000 -- (-1152.536) (-1152.328) (-1151.774) [-1149.790] * (-1152.283) [-1150.425] (-1148.632) (-1149.585) -- 0:00:13
Average standard deviation of split frequencies: 0.008646
795500 -- (-1150.029) (-1152.824) (-1150.180) [-1150.232] * [-1155.165] (-1151.519) (-1148.798) (-1153.162) -- 0:00:13
796000 -- (-1149.013) (-1153.691) (-1152.211) [-1153.218] * (-1151.698) (-1149.847) (-1148.788) [-1151.297] -- 0:00:13
796500 -- (-1149.816) (-1150.349) (-1151.702) [-1150.144] * (-1151.633) [-1150.554] (-1151.932) (-1153.353) -- 0:00:13
797000 -- (-1152.153) (-1153.444) [-1150.971] (-1152.124) * (-1151.639) [-1151.924] (-1152.205) (-1149.836) -- 0:00:13
797500 -- (-1148.447) (-1150.494) (-1148.593) [-1152.779] * [-1152.064] (-1152.108) (-1152.888) (-1161.543) -- 0:00:13
798000 -- (-1150.538) (-1151.211) [-1148.863] (-1151.271) * (-1148.716) [-1154.350] (-1150.596) (-1157.816) -- 0:00:13
798500 -- (-1151.735) (-1151.433) (-1150.476) [-1150.906] * (-1152.122) (-1155.556) [-1151.236] (-1160.389) -- 0:00:13
799000 -- (-1150.460) (-1151.618) (-1149.509) [-1149.534] * [-1151.185] (-1155.757) (-1152.618) (-1149.301) -- 0:00:13
799500 -- (-1151.636) (-1151.095) [-1153.449] (-1149.811) * (-1151.791) (-1153.654) [-1148.747] (-1150.429) -- 0:00:13
800000 -- (-1153.215) [-1150.461] (-1150.368) (-1151.865) * (-1151.143) (-1153.432) (-1149.853) [-1151.970] -- 0:00:13
Average standard deviation of split frequencies: 0.008596
800500 -- (-1150.058) (-1151.650) (-1150.960) [-1152.248] * (-1151.116) (-1149.771) [-1151.654] (-1150.838) -- 0:00:13
801000 -- [-1153.741] (-1150.996) (-1155.671) (-1150.758) * (-1151.989) [-1150.292] (-1152.095) (-1152.122) -- 0:00:13
801500 -- (-1153.550) (-1150.145) (-1154.608) [-1151.594] * (-1150.811) (-1150.281) (-1151.167) [-1151.082] -- 0:00:13
802000 -- [-1151.283] (-1150.943) (-1150.904) (-1150.244) * (-1157.225) [-1149.786] (-1149.872) (-1152.256) -- 0:00:13
802500 -- (-1156.888) (-1154.439) (-1151.388) [-1149.880] * [-1152.378] (-1150.511) (-1149.638) (-1152.878) -- 0:00:13
803000 -- [-1153.977] (-1150.849) (-1151.821) (-1154.004) * [-1149.678] (-1151.914) (-1151.384) (-1155.434) -- 0:00:13
803500 -- (-1150.175) [-1149.027] (-1150.225) (-1151.615) * [-1149.919] (-1164.929) (-1153.517) (-1153.457) -- 0:00:13
804000 -- (-1153.517) (-1149.868) (-1150.315) [-1150.329] * (-1149.470) (-1160.073) (-1154.265) [-1155.783] -- 0:00:13
804500 -- (-1150.841) [-1150.950] (-1153.480) (-1150.711) * [-1151.713] (-1151.514) (-1154.027) (-1153.474) -- 0:00:13
805000 -- (-1154.250) (-1148.675) (-1154.986) [-1150.994] * [-1151.921] (-1150.819) (-1152.155) (-1149.950) -- 0:00:13
Average standard deviation of split frequencies: 0.008929
805500 -- (-1154.872) (-1152.870) (-1155.526) [-1151.762] * (-1151.296) (-1151.820) (-1153.951) [-1149.726] -- 0:00:13
806000 -- (-1151.535) (-1151.486) (-1159.089) [-1151.777] * (-1150.792) [-1150.707] (-1149.148) (-1150.052) -- 0:00:12
806500 -- (-1151.035) (-1153.495) [-1151.418] (-1149.748) * (-1152.008) (-1150.448) [-1153.073] (-1154.821) -- 0:00:13
807000 -- (-1151.054) (-1150.153) (-1150.678) [-1151.499] * [-1152.662] (-1154.609) (-1151.896) (-1152.092) -- 0:00:13
807500 -- (-1151.132) [-1149.725] (-1153.894) (-1152.044) * (-1152.586) (-1153.993) [-1152.071] (-1150.878) -- 0:00:13
808000 -- (-1152.138) (-1154.111) [-1149.372] (-1153.570) * (-1151.594) [-1151.803] (-1148.701) (-1154.346) -- 0:00:13
808500 -- (-1150.126) (-1155.631) (-1152.415) [-1151.924] * (-1152.028) (-1150.769) [-1149.778] (-1155.065) -- 0:00:13
809000 -- (-1150.837) (-1151.743) [-1153.395] (-1149.835) * (-1150.167) (-1150.576) [-1152.538] (-1154.527) -- 0:00:12
809500 -- (-1149.359) (-1150.878) [-1153.178] (-1151.401) * (-1151.177) [-1150.835] (-1150.899) (-1153.836) -- 0:00:12
810000 -- (-1151.613) [-1151.798] (-1151.780) (-1151.387) * (-1151.362) [-1150.261] (-1150.464) (-1152.816) -- 0:00:12
Average standard deviation of split frequencies: 0.008723
810500 -- (-1151.734) [-1149.709] (-1152.254) (-1152.266) * (-1153.140) (-1151.999) [-1148.127] (-1158.416) -- 0:00:12
811000 -- (-1151.374) (-1153.101) [-1150.749] (-1154.924) * (-1151.776) (-1155.420) [-1150.595] (-1153.378) -- 0:00:12
811500 -- (-1151.979) [-1150.757] (-1147.543) (-1153.744) * (-1152.410) (-1148.845) [-1149.691] (-1151.061) -- 0:00:12
812000 -- (-1151.764) [-1148.254] (-1152.973) (-1151.717) * (-1153.259) [-1150.811] (-1150.370) (-1153.674) -- 0:00:12
812500 -- (-1151.509) (-1150.030) (-1150.800) [-1151.325] * (-1153.335) (-1151.547) (-1150.044) [-1151.413] -- 0:00:12
813000 -- (-1154.951) [-1149.276] (-1149.978) (-1151.255) * [-1152.286] (-1150.780) (-1148.666) (-1151.045) -- 0:00:12
813500 -- (-1149.921) [-1150.721] (-1150.005) (-1151.597) * (-1155.403) [-1149.674] (-1149.453) (-1152.780) -- 0:00:12
814000 -- (-1150.866) (-1150.583) (-1151.296) [-1149.510] * (-1154.026) [-1150.365] (-1150.177) (-1153.529) -- 0:00:12
814500 -- (-1150.803) (-1152.249) (-1152.304) [-1151.038] * (-1150.138) (-1153.427) [-1149.756] (-1150.490) -- 0:00:12
815000 -- (-1153.283) (-1152.215) (-1153.547) [-1149.990] * [-1150.884] (-1155.421) (-1148.484) (-1150.036) -- 0:00:12
Average standard deviation of split frequencies: 0.008511
815500 -- [-1149.723] (-1150.596) (-1149.126) (-1153.098) * (-1152.891) [-1153.774] (-1150.831) (-1150.342) -- 0:00:12
816000 -- (-1148.439) (-1152.724) (-1149.443) [-1151.286] * (-1151.269) (-1150.589) [-1151.439] (-1151.132) -- 0:00:12
816500 -- (-1150.035) (-1150.458) [-1149.948] (-1151.457) * (-1154.467) (-1150.779) [-1149.330] (-1153.226) -- 0:00:12
817000 -- [-1149.210] (-1148.309) (-1151.868) (-1150.800) * [-1151.337] (-1155.078) (-1149.805) (-1152.703) -- 0:00:12
817500 -- (-1151.762) (-1156.457) [-1148.985] (-1150.052) * [-1151.116] (-1151.982) (-1150.855) (-1154.032) -- 0:00:12
818000 -- (-1150.152) (-1151.416) (-1148.631) [-1154.005] * (-1151.485) [-1150.391] (-1150.139) (-1150.108) -- 0:00:12
818500 -- [-1151.566] (-1152.745) (-1152.508) (-1151.386) * (-1154.394) (-1150.786) [-1150.162] (-1149.952) -- 0:00:12
819000 -- (-1154.271) (-1149.496) (-1151.034) [-1150.619] * (-1154.567) (-1150.244) (-1150.166) [-1150.485] -- 0:00:12
819500 -- [-1150.790] (-1154.166) (-1148.421) (-1150.228) * [-1150.382] (-1150.110) (-1150.808) (-1151.519) -- 0:00:12
820000 -- (-1150.234) [-1153.148] (-1152.709) (-1152.777) * [-1150.334] (-1152.394) (-1150.318) (-1151.721) -- 0:00:12
Average standard deviation of split frequencies: 0.008425
820500 -- (-1149.630) (-1151.368) [-1149.663] (-1151.714) * (-1150.637) [-1149.790] (-1149.930) (-1151.230) -- 0:00:12
821000 -- (-1151.232) (-1151.702) [-1150.376] (-1150.885) * (-1153.188) (-1150.589) [-1153.271] (-1151.989) -- 0:00:12
821500 -- [-1150.242] (-1150.468) (-1152.158) (-1151.423) * (-1152.505) (-1150.471) (-1150.679) [-1151.323] -- 0:00:12
822000 -- (-1150.367) [-1150.253] (-1152.475) (-1156.741) * (-1150.854) (-1151.206) (-1152.082) [-1151.353] -- 0:00:12
822500 -- [-1150.101] (-1152.046) (-1151.237) (-1150.411) * [-1151.707] (-1154.392) (-1153.682) (-1149.393) -- 0:00:12
823000 -- (-1154.716) (-1153.223) (-1152.645) [-1153.145] * [-1152.759] (-1154.152) (-1150.646) (-1150.563) -- 0:00:12
823500 -- (-1152.320) [-1150.112] (-1155.726) (-1151.170) * (-1153.805) (-1151.112) [-1149.300] (-1152.358) -- 0:00:12
824000 -- (-1150.653) [-1151.912] (-1151.227) (-1150.511) * (-1150.082) (-1152.116) (-1150.241) [-1152.549] -- 0:00:11
824500 -- [-1151.574] (-1148.543) (-1150.484) (-1153.523) * [-1150.937] (-1152.518) (-1155.636) (-1152.344) -- 0:00:11
825000 -- (-1150.355) [-1149.736] (-1150.508) (-1149.425) * (-1149.037) (-1153.211) (-1151.977) [-1154.559] -- 0:00:11
Average standard deviation of split frequencies: 0.008523
825500 -- (-1151.216) (-1148.960) (-1153.337) [-1150.121] * (-1151.758) (-1154.004) [-1151.769] (-1153.644) -- 0:00:11
826000 -- (-1156.536) (-1149.457) [-1151.078] (-1150.203) * (-1150.968) [-1148.508] (-1150.608) (-1151.889) -- 0:00:11
826500 -- (-1152.844) (-1152.686) (-1150.567) [-1149.405] * (-1153.622) (-1150.394) [-1148.619] (-1151.106) -- 0:00:11
827000 -- (-1148.635) (-1154.123) (-1152.308) [-1154.028] * (-1152.410) (-1151.086) (-1150.325) [-1150.471] -- 0:00:11
827500 -- [-1150.478] (-1150.315) (-1151.872) (-1150.112) * (-1155.427) [-1150.747] (-1160.226) (-1154.390) -- 0:00:11
828000 -- (-1151.581) [-1152.449] (-1150.494) (-1150.843) * (-1157.633) (-1151.245) (-1152.473) [-1151.393] -- 0:00:11
828500 -- (-1152.146) (-1152.185) [-1151.342] (-1151.605) * (-1152.502) [-1149.447] (-1154.735) (-1151.905) -- 0:00:11
829000 -- (-1149.400) (-1152.942) [-1152.688] (-1150.696) * (-1152.790) (-1150.321) (-1152.066) [-1152.662] -- 0:00:11
829500 -- [-1150.154] (-1151.471) (-1151.612) (-1151.627) * (-1151.964) (-1149.618) [-1150.769] (-1152.474) -- 0:00:11
830000 -- (-1153.786) (-1150.122) (-1150.381) [-1154.626] * (-1155.747) [-1150.824] (-1151.449) (-1152.514) -- 0:00:11
Average standard deviation of split frequencies: 0.008777
830500 -- (-1152.356) (-1151.279) (-1151.581) [-1153.999] * [-1150.964] (-1151.500) (-1150.375) (-1154.472) -- 0:00:11
831000 -- (-1150.378) (-1150.655) [-1152.009] (-1151.606) * (-1151.405) (-1156.135) [-1150.805] (-1152.921) -- 0:00:11
831500 -- (-1149.966) (-1149.399) [-1150.457] (-1152.995) * [-1150.153] (-1148.722) (-1150.169) (-1156.297) -- 0:00:11
832000 -- (-1150.640) (-1149.866) [-1151.474] (-1156.622) * (-1153.657) [-1148.710] (-1150.717) (-1156.962) -- 0:00:11
832500 -- (-1150.649) [-1152.333] (-1149.979) (-1154.880) * (-1154.367) (-1150.656) [-1153.220] (-1153.214) -- 0:00:11
833000 -- (-1149.036) (-1150.140) (-1151.300) [-1150.464] * (-1149.743) [-1151.690] (-1151.844) (-1150.563) -- 0:00:11
833500 -- (-1148.343) (-1152.508) (-1152.732) [-1153.169] * [-1150.119] (-1150.871) (-1151.658) (-1150.691) -- 0:00:11
834000 -- (-1149.906) (-1154.177) (-1155.537) [-1150.414] * (-1150.579) (-1154.454) (-1151.996) [-1153.426] -- 0:00:11
834500 -- (-1150.631) (-1151.973) [-1152.496] (-1153.228) * (-1149.771) (-1150.645) [-1153.252] (-1156.619) -- 0:00:11
835000 -- [-1148.263] (-1153.988) (-1151.314) (-1152.169) * [-1150.710] (-1148.918) (-1154.526) (-1157.049) -- 0:00:11
Average standard deviation of split frequencies: 0.008646
835500 -- (-1150.757) (-1151.937) (-1151.956) [-1149.738] * [-1151.697] (-1150.348) (-1154.401) (-1152.326) -- 0:00:11
836000 -- (-1152.719) [-1152.483] (-1150.452) (-1148.890) * (-1151.809) [-1152.250] (-1150.884) (-1151.018) -- 0:00:11
836500 -- (-1152.096) (-1151.058) (-1150.281) [-1150.289] * (-1151.436) (-1151.561) (-1154.559) [-1149.564] -- 0:00:11
837000 -- [-1149.663] (-1150.903) (-1151.394) (-1153.870) * (-1156.732) (-1150.596) [-1151.069] (-1151.697) -- 0:00:11
837500 -- [-1148.242] (-1150.885) (-1151.132) (-1153.774) * [-1151.136] (-1151.376) (-1150.882) (-1149.707) -- 0:00:11
838000 -- (-1151.610) (-1151.681) (-1150.419) [-1154.265] * (-1151.686) (-1153.365) [-1150.396] (-1151.043) -- 0:00:11
838500 -- (-1149.751) [-1150.112] (-1149.211) (-1154.427) * (-1150.200) (-1153.731) [-1150.443] (-1149.900) -- 0:00:10
839000 -- [-1151.562] (-1151.478) (-1149.766) (-1150.753) * (-1152.661) (-1154.676) (-1151.406) [-1151.810] -- 0:00:10
839500 -- [-1153.300] (-1150.450) (-1151.040) (-1154.696) * (-1150.170) (-1148.681) [-1151.012] (-1151.052) -- 0:00:10
840000 -- [-1152.139] (-1151.689) (-1157.247) (-1151.963) * (-1148.200) (-1152.120) (-1157.943) [-1150.201] -- 0:00:10
Average standard deviation of split frequencies: 0.008748
840500 -- (-1151.159) [-1150.414] (-1153.210) (-1152.578) * (-1154.926) (-1150.729) [-1153.556] (-1151.591) -- 0:00:10
841000 -- [-1150.400] (-1149.807) (-1155.508) (-1149.704) * (-1160.035) (-1150.422) [-1151.214] (-1153.372) -- 0:00:10
841500 -- (-1151.433) (-1151.548) (-1149.229) [-1151.342] * (-1152.963) [-1149.860] (-1150.169) (-1151.986) -- 0:00:10
842000 -- (-1152.080) (-1155.285) [-1148.555] (-1152.296) * [-1153.741] (-1152.831) (-1151.086) (-1151.205) -- 0:00:10
842500 -- (-1150.988) (-1152.339) [-1149.393] (-1154.690) * (-1150.150) (-1151.796) [-1152.566] (-1154.695) -- 0:00:10
843000 -- (-1159.088) [-1151.766] (-1148.898) (-1154.693) * (-1151.664) (-1151.437) (-1151.978) [-1150.475] -- 0:00:10
843500 -- (-1150.345) [-1149.776] (-1150.575) (-1150.400) * (-1151.221) (-1150.141) (-1150.755) [-1150.533] -- 0:00:10
844000 -- (-1150.319) (-1152.827) (-1148.099) [-1150.896] * [-1151.918] (-1148.820) (-1153.695) (-1148.897) -- 0:00:10
844500 -- (-1152.675) (-1155.726) (-1152.361) [-1150.263] * (-1151.198) [-1150.016] (-1151.765) (-1149.966) -- 0:00:10
845000 -- (-1154.669) [-1156.401] (-1148.274) (-1152.656) * [-1149.379] (-1151.377) (-1152.273) (-1149.677) -- 0:00:10
Average standard deviation of split frequencies: 0.008953
845500 -- [-1150.581] (-1151.348) (-1156.992) (-1152.780) * (-1153.729) (-1150.936) [-1150.531] (-1149.870) -- 0:00:10
846000 -- (-1150.963) (-1152.892) (-1152.314) [-1150.849] * (-1153.569) (-1153.555) (-1151.326) [-1152.166] -- 0:00:10
846500 -- (-1152.737) [-1151.364] (-1153.012) (-1150.636) * [-1149.648] (-1148.521) (-1152.910) (-1153.967) -- 0:00:10
847000 -- (-1150.409) [-1151.623] (-1154.948) (-1152.048) * (-1152.282) (-1152.167) [-1150.747] (-1150.716) -- 0:00:10
847500 -- (-1150.985) [-1153.016] (-1150.327) (-1150.025) * [-1152.025] (-1153.099) (-1151.829) (-1150.636) -- 0:00:10
848000 -- (-1152.022) (-1153.885) (-1150.171) [-1149.274] * (-1150.701) [-1151.154] (-1152.747) (-1150.468) -- 0:00:10
848500 -- (-1150.465) (-1153.990) (-1151.694) [-1148.667] * (-1152.225) (-1153.995) [-1150.737] (-1149.085) -- 0:00:10
849000 -- [-1150.510] (-1157.310) (-1149.933) (-1151.807) * (-1152.707) (-1154.591) (-1157.138) [-1149.198] -- 0:00:10
849500 -- (-1152.486) (-1151.661) (-1154.480) [-1151.207] * (-1156.161) (-1154.206) (-1155.201) [-1149.683] -- 0:00:10
850000 -- [-1148.984] (-1153.465) (-1151.757) (-1149.856) * (-1152.321) (-1155.268) (-1153.365) [-1151.427] -- 0:00:10
Average standard deviation of split frequencies: 0.009088
850500 -- [-1153.158] (-1151.010) (-1151.365) (-1150.836) * (-1152.655) (-1153.599) (-1154.034) [-1149.006] -- 0:00:10
851000 -- [-1148.648] (-1151.688) (-1151.247) (-1150.666) * (-1149.802) [-1149.955] (-1151.881) (-1150.601) -- 0:00:10
851500 -- [-1152.501] (-1152.162) (-1155.156) (-1152.304) * [-1150.828] (-1151.735) (-1152.738) (-1149.150) -- 0:00:10
852000 -- [-1149.594] (-1152.234) (-1150.862) (-1152.641) * (-1150.065) [-1149.273] (-1154.163) (-1150.434) -- 0:00:10
852500 -- (-1156.774) (-1154.897) [-1155.116] (-1152.573) * (-1151.261) [-1150.850] (-1155.925) (-1150.474) -- 0:00:10
853000 -- (-1148.893) [-1153.852] (-1150.724) (-1151.905) * (-1153.954) (-1151.733) (-1153.279) [-1149.479] -- 0:00:09
853500 -- (-1151.569) (-1151.449) (-1150.457) [-1149.228] * (-1151.580) (-1150.646) [-1150.538] (-1151.184) -- 0:00:09
854000 -- (-1151.565) (-1151.327) [-1151.328] (-1154.698) * (-1151.086) [-1151.333] (-1154.120) (-1155.571) -- 0:00:09
854500 -- (-1151.696) (-1153.558) (-1151.719) [-1151.346] * (-1148.808) (-1152.053) (-1153.986) [-1150.730] -- 0:00:09
855000 -- [-1149.758] (-1152.740) (-1152.492) (-1152.085) * [-1149.934] (-1155.397) (-1151.045) (-1151.425) -- 0:00:09
Average standard deviation of split frequencies: 0.009178
855500 -- (-1150.567) [-1149.916] (-1153.188) (-1153.855) * (-1151.200) [-1150.578] (-1155.692) (-1152.199) -- 0:00:09
856000 -- (-1150.885) (-1151.424) (-1150.117) [-1151.736] * (-1150.913) (-1150.399) [-1153.235] (-1151.662) -- 0:00:09
856500 -- (-1149.314) [-1152.343] (-1151.612) (-1152.632) * (-1150.796) (-1152.310) [-1150.084] (-1152.710) -- 0:00:09
857000 -- [-1151.230] (-1154.631) (-1150.580) (-1154.819) * [-1150.745] (-1150.773) (-1151.994) (-1150.312) -- 0:00:09
857500 -- (-1150.972) (-1151.206) (-1150.891) [-1150.289] * [-1150.188] (-1154.317) (-1150.403) (-1148.937) -- 0:00:09
858000 -- (-1149.067) (-1154.183) [-1151.272] (-1154.050) * [-1148.238] (-1148.187) (-1149.968) (-1150.546) -- 0:00:09
858500 -- (-1151.404) (-1154.117) [-1152.240] (-1150.968) * (-1152.484) [-1149.055] (-1152.249) (-1150.282) -- 0:00:09
859000 -- [-1151.517] (-1154.158) (-1151.217) (-1151.793) * (-1149.176) (-1150.854) [-1151.470] (-1150.285) -- 0:00:09
859500 -- [-1151.072] (-1151.987) (-1151.353) (-1151.839) * (-1155.062) (-1153.015) (-1151.536) [-1149.279] -- 0:00:09
860000 -- [-1150.441] (-1152.911) (-1149.555) (-1151.690) * (-1150.541) (-1151.663) [-1154.896] (-1150.813) -- 0:00:09
Average standard deviation of split frequencies: 0.009129
860500 -- [-1152.161] (-1150.066) (-1151.360) (-1149.907) * (-1149.497) (-1150.472) [-1150.490] (-1153.827) -- 0:00:09
861000 -- (-1150.802) [-1150.464] (-1151.331) (-1151.530) * (-1151.079) (-1151.316) [-1150.839] (-1152.738) -- 0:00:09
861500 -- [-1149.064] (-1151.439) (-1150.190) (-1150.515) * (-1149.178) (-1150.949) (-1150.036) [-1152.103] -- 0:00:09
862000 -- (-1154.296) (-1154.633) (-1152.583) [-1151.350] * (-1151.050) (-1153.756) (-1150.625) [-1150.299] -- 0:00:09
862500 -- [-1153.048] (-1150.081) (-1151.648) (-1153.225) * [-1155.518] (-1152.005) (-1152.458) (-1151.116) -- 0:00:09
863000 -- (-1152.667) [-1149.137] (-1156.366) (-1152.126) * (-1151.638) [-1150.608] (-1151.493) (-1149.640) -- 0:00:09
863500 -- (-1155.568) (-1149.139) (-1157.406) [-1152.301] * [-1151.706] (-1151.749) (-1152.018) (-1150.586) -- 0:00:09
864000 -- (-1153.042) (-1154.898) (-1150.624) [-1153.412] * (-1151.283) (-1152.141) (-1155.935) [-1151.135] -- 0:00:09
864500 -- (-1150.948) (-1150.231) [-1149.018] (-1151.930) * (-1150.744) (-1150.975) [-1155.641] (-1148.742) -- 0:00:09
865000 -- (-1152.021) [-1150.195] (-1151.551) (-1152.580) * (-1151.702) (-1151.721) (-1150.386) [-1150.935] -- 0:00:09
Average standard deviation of split frequencies: 0.009254
865500 -- (-1151.045) (-1148.853) [-1150.066] (-1151.444) * (-1149.937) [-1153.193] (-1149.984) (-1152.987) -- 0:00:09
866000 -- (-1150.811) (-1151.445) [-1149.920] (-1152.967) * [-1150.601] (-1153.075) (-1151.776) (-1150.638) -- 0:00:09
866500 -- (-1153.361) (-1153.354) [-1149.606] (-1149.852) * [-1149.930] (-1152.886) (-1153.404) (-1152.329) -- 0:00:09
867000 -- (-1155.968) [-1153.737] (-1151.654) (-1150.158) * [-1151.622] (-1152.785) (-1154.730) (-1155.667) -- 0:00:09
867500 -- [-1156.110] (-1150.044) (-1150.634) (-1149.851) * (-1155.600) [-1149.344] (-1149.813) (-1151.809) -- 0:00:09
868000 -- [-1153.931] (-1155.570) (-1154.228) (-1151.233) * (-1150.143) [-1149.996] (-1151.931) (-1149.435) -- 0:00:08
868500 -- [-1150.119] (-1150.483) (-1155.441) (-1149.597) * (-1152.342) [-1151.960] (-1152.395) (-1149.765) -- 0:00:08
869000 -- (-1149.498) [-1148.607] (-1153.590) (-1150.317) * (-1154.464) (-1150.206) (-1152.397) [-1149.950] -- 0:00:08
869500 -- [-1150.378] (-1151.051) (-1154.034) (-1151.831) * (-1153.202) (-1149.419) [-1152.686] (-1150.423) -- 0:00:08
870000 -- (-1152.308) (-1153.796) (-1150.451) [-1150.510] * (-1150.998) [-1148.963] (-1155.008) (-1150.710) -- 0:00:08
Average standard deviation of split frequencies: 0.010143
870500 -- (-1151.601) (-1152.721) (-1150.777) [-1151.009] * [-1149.106] (-1150.973) (-1154.099) (-1150.536) -- 0:00:08
871000 -- (-1152.374) [-1148.530] (-1153.780) (-1150.813) * (-1154.384) (-1152.917) (-1153.863) [-1150.530] -- 0:00:08
871500 -- (-1148.658) (-1151.819) [-1151.225] (-1151.833) * (-1150.691) [-1150.660] (-1150.383) (-1150.904) -- 0:00:08
872000 -- (-1151.324) (-1151.064) [-1155.843] (-1154.889) * (-1150.986) (-1151.046) [-1151.698] (-1152.679) -- 0:00:08
872500 -- (-1151.318) (-1150.323) [-1152.176] (-1149.679) * [-1153.015] (-1150.854) (-1151.122) (-1153.357) -- 0:00:08
873000 -- (-1151.604) [-1150.128] (-1154.573) (-1150.367) * (-1150.898) (-1149.903) (-1154.941) [-1153.441] -- 0:00:08
873500 -- (-1154.048) (-1155.391) (-1151.646) [-1151.473] * [-1150.116] (-1151.036) (-1153.116) (-1155.873) -- 0:00:08
874000 -- (-1155.891) (-1152.657) [-1153.698] (-1153.060) * (-1149.107) [-1152.889] (-1152.559) (-1150.917) -- 0:00:08
874500 -- (-1151.871) (-1151.544) [-1151.454] (-1155.810) * (-1150.307) [-1153.252] (-1152.524) (-1152.075) -- 0:00:08
875000 -- (-1152.141) (-1152.605) [-1149.757] (-1150.512) * [-1150.952] (-1154.676) (-1151.288) (-1151.216) -- 0:00:08
Average standard deviation of split frequencies: 0.010081
875500 -- (-1153.704) (-1150.249) (-1152.840) [-1157.255] * (-1151.719) (-1150.835) [-1154.942] (-1150.435) -- 0:00:08
876000 -- (-1150.122) [-1156.570] (-1151.791) (-1154.568) * (-1152.566) (-1151.090) [-1152.289] (-1150.695) -- 0:00:08
876500 -- (-1153.252) (-1157.672) (-1151.508) [-1154.319] * (-1153.449) [-1151.347] (-1151.479) (-1151.238) -- 0:00:08
877000 -- (-1149.530) [-1153.002] (-1151.025) (-1154.783) * (-1153.580) (-1150.975) [-1150.121] (-1154.099) -- 0:00:08
877500 -- [-1150.522] (-1151.528) (-1150.975) (-1153.002) * (-1152.185) (-1149.584) (-1150.769) [-1149.868] -- 0:00:08
878000 -- [-1152.559] (-1153.236) (-1150.566) (-1151.313) * (-1150.579) (-1151.687) (-1152.311) [-1150.839] -- 0:00:08
878500 -- (-1150.064) [-1150.647] (-1151.563) (-1149.871) * [-1150.565] (-1150.232) (-1151.561) (-1149.723) -- 0:00:08
879000 -- (-1153.625) [-1151.246] (-1151.775) (-1149.717) * (-1150.788) (-1150.590) [-1151.199] (-1154.606) -- 0:00:08
879500 -- (-1152.181) (-1151.644) [-1151.116] (-1153.220) * (-1151.042) (-1149.922) [-1150.000] (-1149.655) -- 0:00:08
880000 -- (-1149.446) [-1152.199] (-1150.465) (-1158.522) * (-1151.261) [-1149.914] (-1150.696) (-1151.347) -- 0:00:08
Average standard deviation of split frequencies: 0.010099
880500 -- [-1151.352] (-1151.820) (-1157.587) (-1151.584) * (-1150.778) (-1151.276) (-1153.808) [-1150.393] -- 0:00:08
881000 -- [-1150.752] (-1157.686) (-1159.876) (-1151.245) * (-1150.300) (-1151.053) (-1151.888) [-1151.169] -- 0:00:08
881500 -- (-1153.116) (-1153.815) [-1149.706] (-1153.398) * (-1154.587) (-1150.806) [-1149.726] (-1150.844) -- 0:00:08
882000 -- [-1148.800] (-1150.510) (-1154.297) (-1151.359) * [-1152.151] (-1148.922) (-1149.610) (-1150.259) -- 0:00:08
882500 -- (-1150.294) (-1151.173) (-1156.192) [-1151.969] * (-1151.762) (-1152.428) (-1150.461) [-1149.388] -- 0:00:07
883000 -- (-1150.985) (-1149.665) (-1152.695) [-1150.299] * (-1151.492) (-1150.498) [-1149.703] (-1150.659) -- 0:00:07
883500 -- (-1159.961) (-1150.763) [-1151.802] (-1151.558) * (-1150.862) (-1149.262) [-1149.840] (-1149.327) -- 0:00:07
884000 -- (-1148.722) [-1150.642] (-1151.238) (-1150.626) * (-1150.526) [-1149.139] (-1151.493) (-1153.189) -- 0:00:07
884500 -- [-1151.445] (-1153.373) (-1152.016) (-1151.009) * [-1150.581] (-1150.211) (-1152.145) (-1149.647) -- 0:00:07
885000 -- (-1151.292) (-1150.881) (-1149.909) [-1152.010] * (-1150.085) (-1153.500) (-1150.595) [-1151.232] -- 0:00:07
Average standard deviation of split frequencies: 0.009896
885500 -- (-1149.046) [-1149.535] (-1152.180) (-1150.407) * [-1151.122] (-1149.327) (-1150.415) (-1154.074) -- 0:00:07
886000 -- (-1150.886) (-1151.146) [-1152.443] (-1150.097) * (-1149.757) (-1150.307) (-1149.616) [-1151.476] -- 0:00:07
886500 -- (-1154.246) (-1148.729) (-1152.348) [-1151.835] * (-1154.153) [-1152.936] (-1150.512) (-1151.947) -- 0:00:07
887000 -- [-1152.719] (-1151.978) (-1149.921) (-1152.743) * (-1149.448) (-1151.118) (-1150.741) [-1151.164] -- 0:00:07
887500 -- [-1152.541] (-1150.789) (-1150.314) (-1151.618) * (-1153.908) [-1151.402] (-1153.101) (-1149.806) -- 0:00:07
888000 -- (-1150.716) (-1150.079) [-1147.937] (-1153.409) * (-1152.410) (-1152.650) (-1154.639) [-1149.173] -- 0:00:07
888500 -- (-1152.080) [-1150.384] (-1151.384) (-1149.886) * (-1152.182) [-1157.176] (-1153.194) (-1150.353) -- 0:00:07
889000 -- (-1148.830) (-1153.410) [-1151.499] (-1150.648) * (-1150.912) (-1151.336) [-1151.855] (-1152.588) -- 0:00:07
889500 -- (-1152.295) [-1153.727] (-1150.311) (-1150.429) * (-1150.192) (-1151.252) (-1154.152) [-1154.212] -- 0:00:07
890000 -- [-1150.317] (-1151.126) (-1151.106) (-1152.805) * (-1149.537) (-1151.848) (-1150.712) [-1153.697] -- 0:00:07
Average standard deviation of split frequencies: 0.009174
890500 -- (-1151.884) (-1154.267) [-1150.127] (-1151.693) * (-1147.772) [-1151.082] (-1152.471) (-1154.146) -- 0:00:07
891000 -- [-1152.032] (-1151.221) (-1150.293) (-1150.345) * (-1149.971) (-1156.799) (-1154.919) [-1155.576] -- 0:00:07
891500 -- (-1150.625) (-1152.460) (-1150.323) [-1150.569] * (-1155.492) (-1158.825) (-1156.260) [-1150.076] -- 0:00:07
892000 -- [-1150.424] (-1154.399) (-1150.461) (-1151.756) * (-1149.868) [-1159.880] (-1152.460) (-1149.718) -- 0:00:07
892500 -- [-1150.691] (-1152.015) (-1150.881) (-1150.485) * [-1152.122] (-1159.865) (-1150.864) (-1149.696) -- 0:00:07
893000 -- (-1150.099) (-1155.667) [-1150.097] (-1152.489) * [-1152.963] (-1156.139) (-1151.250) (-1150.473) -- 0:00:07
893500 -- (-1150.810) (-1149.375) [-1151.658] (-1152.756) * [-1150.146] (-1151.071) (-1150.980) (-1149.992) -- 0:00:07
894000 -- (-1153.053) (-1151.146) (-1152.546) [-1150.438] * (-1150.327) (-1155.837) (-1150.974) [-1149.890] -- 0:00:07
894500 -- (-1150.663) (-1152.354) (-1158.215) [-1150.500] * (-1150.006) (-1148.620) [-1151.069] (-1150.402) -- 0:00:07
895000 -- (-1153.898) [-1152.885] (-1150.572) (-1154.718) * (-1152.162) (-1149.921) [-1150.966] (-1150.845) -- 0:00:07
Average standard deviation of split frequencies: 0.009014
895500 -- [-1151.550] (-1151.435) (-1149.714) (-1155.021) * (-1150.793) (-1150.376) (-1151.562) [-1150.460] -- 0:00:07
896000 -- [-1149.038] (-1152.470) (-1151.573) (-1156.496) * (-1150.460) [-1150.620] (-1153.633) (-1151.237) -- 0:00:07
896500 -- (-1151.882) [-1149.457] (-1151.564) (-1158.215) * (-1153.219) (-1150.435) (-1152.020) [-1150.828] -- 0:00:07
897000 -- (-1151.332) (-1150.278) (-1153.962) [-1151.434] * (-1151.655) (-1151.030) (-1152.630) [-1152.045] -- 0:00:07
897500 -- [-1150.939] (-1149.407) (-1152.669) (-1150.034) * (-1150.877) (-1150.695) [-1151.073] (-1152.131) -- 0:00:06
898000 -- (-1152.136) [-1149.062] (-1149.601) (-1150.338) * (-1154.078) (-1153.480) [-1150.544] (-1152.618) -- 0:00:06
898500 -- (-1156.551) (-1150.145) [-1149.651] (-1150.640) * (-1149.579) [-1150.659] (-1150.366) (-1152.759) -- 0:00:06
899000 -- [-1152.360] (-1149.074) (-1150.153) (-1155.263) * (-1150.646) (-1150.182) [-1150.101] (-1150.970) -- 0:00:06
899500 -- (-1151.828) (-1150.190) [-1149.986] (-1151.803) * (-1151.748) (-1151.147) [-1151.461] (-1151.921) -- 0:00:06
900000 -- (-1150.831) (-1151.273) [-1148.351] (-1154.287) * (-1155.072) (-1154.541) (-1151.743) [-1151.863] -- 0:00:06
Average standard deviation of split frequencies: 0.009072
900500 -- [-1149.399] (-1152.307) (-1151.309) (-1150.113) * (-1153.178) (-1152.748) (-1150.801) [-1152.118] -- 0:00:06
901000 -- (-1152.414) (-1155.149) [-1150.752] (-1155.791) * [-1150.611] (-1150.883) (-1150.817) (-1150.996) -- 0:00:06
901500 -- (-1152.150) (-1152.263) (-1150.088) [-1151.723] * (-1150.629) [-1150.501] (-1149.232) (-1156.333) -- 0:00:06
902000 -- (-1150.973) [-1150.962] (-1149.037) (-1148.774) * (-1151.030) (-1152.460) [-1149.733] (-1152.882) -- 0:00:06
902500 -- [-1153.298] (-1153.489) (-1152.332) (-1152.070) * (-1151.741) (-1150.531) (-1155.042) [-1149.068] -- 0:00:06
903000 -- (-1151.955) (-1149.984) [-1150.821] (-1149.268) * (-1151.798) [-1149.632] (-1149.320) (-1151.231) -- 0:00:06
903500 -- (-1150.268) [-1147.542] (-1151.682) (-1151.953) * (-1151.482) (-1151.831) (-1151.359) [-1150.098] -- 0:00:06
904000 -- [-1150.803] (-1148.681) (-1150.712) (-1153.079) * [-1153.915] (-1152.340) (-1153.512) (-1149.278) -- 0:00:06
904500 -- (-1151.084) [-1150.256] (-1149.612) (-1153.418) * (-1153.146) (-1157.537) (-1150.424) [-1150.414] -- 0:00:06
905000 -- (-1150.617) [-1150.539] (-1153.812) (-1150.585) * [-1152.391] (-1150.164) (-1149.950) (-1156.023) -- 0:00:06
Average standard deviation of split frequencies: 0.009019
905500 -- [-1149.970] (-1149.789) (-1154.880) (-1150.547) * (-1152.250) (-1150.361) (-1153.878) [-1153.608] -- 0:00:06
906000 -- (-1150.393) [-1153.264] (-1152.795) (-1150.603) * (-1154.024) [-1154.705] (-1155.412) (-1151.240) -- 0:00:06
906500 -- (-1150.411) (-1151.848) [-1152.123] (-1150.512) * (-1156.299) (-1155.466) (-1150.272) [-1152.041] -- 0:00:06
907000 -- (-1149.624) (-1155.305) (-1149.942) [-1153.079] * (-1152.203) (-1160.637) [-1150.088] (-1154.192) -- 0:00:06
907500 -- [-1152.147] (-1151.079) (-1149.667) (-1151.737) * (-1151.464) (-1153.597) (-1151.000) [-1150.171] -- 0:00:06
908000 -- (-1151.142) (-1150.149) (-1150.329) [-1152.685] * (-1150.792) (-1151.535) [-1150.900] (-1152.020) -- 0:00:06
908500 -- [-1154.877] (-1149.120) (-1153.540) (-1151.916) * (-1153.506) (-1149.154) [-1151.767] (-1154.201) -- 0:00:06
909000 -- (-1154.790) (-1149.368) (-1151.323) [-1151.792] * (-1154.632) [-1151.626] (-1153.556) (-1154.957) -- 0:00:06
909500 -- (-1155.590) (-1151.519) (-1149.993) [-1152.338] * (-1151.400) [-1150.895] (-1150.615) (-1151.918) -- 0:00:06
910000 -- [-1152.773] (-1153.249) (-1149.662) (-1150.098) * (-1151.147) (-1151.599) (-1149.953) [-1150.465] -- 0:00:06
Average standard deviation of split frequencies: 0.009042
910500 -- (-1159.137) [-1152.587] (-1150.260) (-1152.116) * [-1152.706] (-1153.007) (-1152.455) (-1154.766) -- 0:00:06
911000 -- (-1158.138) (-1150.880) [-1150.829] (-1151.596) * (-1152.072) (-1151.012) (-1151.291) [-1151.292] -- 0:00:06
911500 -- (-1153.945) [-1150.446] (-1150.615) (-1153.416) * [-1151.266] (-1150.108) (-1149.789) (-1150.756) -- 0:00:06
912000 -- (-1151.946) [-1148.569] (-1154.507) (-1152.752) * (-1150.884) (-1150.357) [-1149.888] (-1150.779) -- 0:00:05
912500 -- (-1150.593) [-1151.137] (-1152.942) (-1151.407) * [-1150.252] (-1150.203) (-1147.917) (-1151.264) -- 0:00:05
913000 -- (-1154.090) (-1151.025) (-1151.580) [-1150.780] * (-1151.524) (-1157.467) (-1150.294) [-1149.746] -- 0:00:05
913500 -- (-1152.100) [-1148.728] (-1150.651) (-1150.897) * (-1151.830) (-1154.196) [-1150.949] (-1152.121) -- 0:00:05
914000 -- (-1151.037) [-1153.838] (-1149.884) (-1149.165) * [-1151.168] (-1154.345) (-1150.249) (-1152.427) -- 0:00:05
914500 -- (-1151.270) [-1154.194] (-1153.388) (-1150.846) * (-1150.112) [-1148.754] (-1151.801) (-1152.402) -- 0:00:05
915000 -- (-1152.224) (-1150.037) [-1150.982] (-1150.727) * (-1150.748) [-1148.754] (-1154.415) (-1152.910) -- 0:00:05
Average standard deviation of split frequencies: 0.008749
915500 -- (-1154.541) [-1151.406] (-1153.852) (-1152.265) * (-1156.431) (-1149.920) (-1153.665) [-1152.080] -- 0:00:05
916000 -- (-1151.724) [-1150.621] (-1153.500) (-1152.597) * [-1150.192] (-1149.949) (-1150.735) (-1153.073) -- 0:00:05
916500 -- (-1150.245) [-1150.431] (-1154.891) (-1153.728) * [-1150.561] (-1151.761) (-1151.483) (-1150.918) -- 0:00:05
917000 -- [-1150.082] (-1151.302) (-1150.232) (-1155.710) * (-1152.571) (-1154.406) [-1151.840] (-1152.798) -- 0:00:05
917500 -- (-1152.173) (-1149.800) [-1150.136] (-1153.589) * (-1150.668) (-1152.053) (-1150.509) [-1150.233] -- 0:00:05
918000 -- (-1152.477) (-1151.636) [-1150.884] (-1154.640) * (-1151.095) [-1151.545] (-1149.525) (-1149.719) -- 0:00:05
918500 -- (-1149.722) (-1150.176) (-1151.896) [-1150.514] * (-1154.490) (-1151.471) (-1152.651) [-1150.645] -- 0:00:05
919000 -- [-1148.570] (-1150.761) (-1154.513) (-1151.868) * (-1150.290) [-1150.747] (-1153.417) (-1150.826) -- 0:00:05
919500 -- (-1152.977) (-1150.327) [-1152.981] (-1152.003) * (-1153.522) (-1152.579) [-1149.834] (-1149.168) -- 0:00:05
920000 -- (-1152.726) [-1154.918] (-1151.559) (-1149.945) * (-1152.400) [-1150.173] (-1150.400) (-1151.933) -- 0:00:05
Average standard deviation of split frequencies: 0.008807
920500 -- (-1149.984) [-1151.159] (-1154.013) (-1150.108) * [-1153.087] (-1151.050) (-1151.742) (-1150.939) -- 0:00:05
921000 -- [-1151.594] (-1155.702) (-1150.988) (-1148.874) * (-1153.250) [-1148.484] (-1153.322) (-1149.291) -- 0:00:05
921500 -- [-1149.552] (-1152.287) (-1154.031) (-1150.431) * (-1151.629) [-1152.428] (-1149.936) (-1152.746) -- 0:00:05
922000 -- (-1150.976) [-1151.828] (-1151.969) (-1152.276) * (-1151.256) (-1151.704) (-1154.225) [-1151.560] -- 0:00:05
922500 -- [-1152.347] (-1153.152) (-1151.006) (-1153.491) * (-1151.791) [-1149.550] (-1152.213) (-1151.823) -- 0:00:05
923000 -- (-1152.931) [-1150.327] (-1150.533) (-1150.641) * (-1153.650) (-1150.786) [-1150.924] (-1153.156) -- 0:00:05
923500 -- (-1150.778) (-1150.655) (-1153.905) [-1149.241] * [-1149.770] (-1153.698) (-1150.843) (-1150.236) -- 0:00:05
924000 -- (-1151.459) (-1149.463) (-1154.045) [-1150.648] * (-1149.237) (-1152.182) (-1152.650) [-1151.369] -- 0:00:05
924500 -- [-1154.004] (-1150.911) (-1150.575) (-1150.271) * (-1150.416) [-1151.270] (-1149.847) (-1148.517) -- 0:00:05
925000 -- (-1151.595) [-1149.883] (-1151.620) (-1150.644) * [-1149.951] (-1155.612) (-1153.608) (-1149.889) -- 0:00:05
Average standard deviation of split frequencies: 0.008485
925500 -- (-1153.367) (-1150.203) [-1151.386] (-1151.637) * (-1151.119) [-1154.119] (-1153.186) (-1149.120) -- 0:00:05
926000 -- (-1154.191) (-1150.637) [-1151.318] (-1151.894) * (-1150.643) (-1153.834) (-1151.317) [-1150.553] -- 0:00:05
926500 -- [-1152.308] (-1152.003) (-1151.802) (-1150.627) * (-1149.674) (-1152.750) (-1151.200) [-1150.285] -- 0:00:04
927000 -- (-1153.586) [-1152.541] (-1151.559) (-1157.410) * (-1150.071) [-1152.643] (-1149.761) (-1151.240) -- 0:00:04
927500 -- [-1151.303] (-1152.183) (-1150.232) (-1154.440) * (-1152.997) (-1154.760) (-1149.416) [-1152.055] -- 0:00:04
928000 -- (-1150.539) [-1152.353] (-1151.506) (-1152.514) * (-1149.940) (-1151.781) [-1151.111] (-1150.275) -- 0:00:04
928500 -- [-1150.453] (-1152.551) (-1152.684) (-1149.650) * (-1157.364) (-1149.547) [-1150.400] (-1154.199) -- 0:00:04
929000 -- (-1149.838) (-1152.288) [-1150.604] (-1149.936) * (-1154.436) (-1153.159) (-1150.797) [-1152.055] -- 0:00:04
929500 -- (-1150.750) (-1149.841) (-1153.228) [-1148.757] * (-1154.713) (-1153.429) [-1151.833] (-1152.432) -- 0:00:04
930000 -- [-1151.192] (-1151.832) (-1150.537) (-1149.273) * (-1153.467) (-1152.654) (-1150.787) [-1153.577] -- 0:00:04
Average standard deviation of split frequencies: 0.008341
930500 -- [-1148.727] (-1151.357) (-1156.649) (-1150.828) * (-1149.102) [-1150.189] (-1151.357) (-1154.276) -- 0:00:04
931000 -- [-1150.708] (-1151.652) (-1150.345) (-1149.385) * (-1152.986) (-1153.047) (-1150.056) [-1151.619] -- 0:00:04
931500 -- (-1151.664) (-1150.354) [-1152.158] (-1152.481) * [-1149.677] (-1150.996) (-1148.834) (-1156.693) -- 0:00:04
932000 -- [-1150.386] (-1150.323) (-1152.391) (-1150.033) * (-1150.753) [-1151.648] (-1151.412) (-1150.580) -- 0:00:04
932500 -- (-1156.828) (-1149.192) (-1148.842) [-1148.018] * (-1149.982) [-1150.912] (-1151.174) (-1150.128) -- 0:00:04
933000 -- (-1150.615) (-1151.131) (-1148.991) [-1149.708] * (-1150.617) (-1151.572) [-1150.571] (-1150.839) -- 0:00:04
933500 -- [-1150.507] (-1149.781) (-1150.205) (-1150.163) * (-1150.107) [-1152.326] (-1155.881) (-1152.266) -- 0:00:04
934000 -- (-1149.503) (-1152.561) (-1152.669) [-1150.424] * [-1156.384] (-1154.228) (-1155.019) (-1154.798) -- 0:00:04
934500 -- [-1150.717] (-1152.036) (-1152.232) (-1150.597) * (-1150.070) [-1148.789] (-1149.620) (-1151.697) -- 0:00:04
935000 -- (-1149.831) (-1153.606) [-1152.160] (-1153.573) * (-1152.413) (-1153.224) (-1149.973) [-1149.209] -- 0:00:04
Average standard deviation of split frequencies: 0.008092
935500 -- [-1151.459] (-1152.622) (-1154.501) (-1151.847) * (-1152.065) [-1148.986] (-1153.904) (-1152.693) -- 0:00:04
936000 -- (-1151.877) (-1151.781) [-1153.309] (-1154.352) * [-1152.511] (-1150.777) (-1150.819) (-1151.950) -- 0:00:04
936500 -- (-1153.028) [-1151.163] (-1152.225) (-1158.113) * (-1150.374) [-1152.020] (-1150.244) (-1148.637) -- 0:00:04
937000 -- (-1154.267) (-1153.495) (-1150.422) [-1148.587] * (-1149.957) (-1151.197) [-1153.129] (-1149.779) -- 0:00:04
937500 -- [-1151.791] (-1152.063) (-1151.103) (-1152.101) * [-1150.011] (-1150.947) (-1149.839) (-1150.973) -- 0:00:04
938000 -- (-1152.803) (-1151.361) (-1157.100) [-1155.285] * (-1151.895) [-1151.103] (-1152.327) (-1154.102) -- 0:00:04
938500 -- (-1150.946) (-1152.041) [-1150.427] (-1153.231) * (-1150.191) [-1154.509] (-1153.888) (-1155.554) -- 0:00:04
939000 -- (-1149.537) (-1152.091) (-1150.305) [-1150.502] * (-1153.330) [-1150.509] (-1151.968) (-1149.222) -- 0:00:04
939500 -- [-1152.577] (-1152.056) (-1152.387) (-1152.658) * (-1154.040) (-1154.027) [-1152.563] (-1152.030) -- 0:00:04
940000 -- (-1151.574) (-1150.106) (-1152.174) [-1152.083] * (-1152.782) [-1153.776] (-1150.906) (-1153.166) -- 0:00:04
Average standard deviation of split frequencies: 0.007751
940500 -- (-1153.752) (-1150.059) (-1151.569) [-1150.001] * (-1153.241) (-1152.928) (-1153.052) [-1152.146] -- 0:00:04
941000 -- (-1152.212) [-1150.936] (-1151.324) (-1150.278) * [-1151.847] (-1160.199) (-1151.733) (-1148.633) -- 0:00:04
941500 -- [-1150.432] (-1151.709) (-1149.905) (-1151.157) * [-1151.040] (-1150.584) (-1150.569) (-1150.175) -- 0:00:03
942000 -- (-1151.136) (-1151.874) (-1152.484) [-1150.902] * (-1151.585) [-1152.254] (-1151.024) (-1150.026) -- 0:00:03
942500 -- (-1151.144) [-1150.700] (-1151.378) (-1150.965) * (-1150.314) (-1154.360) (-1149.436) [-1150.716] -- 0:00:03
943000 -- (-1150.941) (-1150.695) [-1149.156] (-1150.946) * (-1150.004) (-1154.816) (-1148.462) [-1153.490] -- 0:00:03
943500 -- (-1152.698) (-1150.692) [-1151.001] (-1151.037) * [-1152.304] (-1150.698) (-1150.584) (-1154.773) -- 0:00:03
944000 -- (-1154.726) (-1151.786) (-1150.431) [-1153.864] * (-1150.928) (-1153.049) (-1151.997) [-1152.445] -- 0:00:03
944500 -- [-1150.845] (-1153.950) (-1152.215) (-1152.694) * (-1152.669) [-1156.035] (-1150.898) (-1151.558) -- 0:00:03
945000 -- (-1152.199) (-1153.251) (-1150.020) [-1150.718] * [-1152.767] (-1151.196) (-1150.938) (-1152.367) -- 0:00:03
Average standard deviation of split frequencies: 0.007441
945500 -- (-1151.248) [-1152.673] (-1150.674) (-1149.431) * [-1157.089] (-1157.318) (-1150.461) (-1151.191) -- 0:00:03
946000 -- (-1153.580) (-1149.500) [-1149.496] (-1153.483) * (-1153.049) (-1151.089) [-1151.951] (-1153.010) -- 0:00:03
946500 -- (-1151.142) (-1149.376) (-1153.617) [-1152.456] * (-1160.281) [-1150.097] (-1154.653) (-1150.667) -- 0:00:03
947000 -- (-1152.201) [-1151.786] (-1159.496) (-1148.616) * (-1152.789) (-1150.761) (-1154.016) [-1156.557] -- 0:00:03
947500 -- [-1150.035] (-1151.653) (-1152.935) (-1149.933) * (-1149.677) (-1149.590) [-1151.216] (-1152.357) -- 0:00:03
948000 -- (-1150.506) (-1149.956) (-1153.481) [-1150.288] * (-1154.008) (-1149.173) (-1154.194) [-1154.044] -- 0:00:03
948500 -- [-1148.748] (-1150.120) (-1149.493) (-1150.506) * (-1149.322) (-1152.077) (-1152.569) [-1150.516] -- 0:00:03
949000 -- (-1149.992) (-1150.474) (-1152.027) [-1150.354] * (-1151.827) (-1153.109) [-1152.111] (-1151.773) -- 0:00:03
949500 -- (-1151.965) [-1150.643] (-1153.979) (-1155.485) * (-1151.779) (-1154.030) [-1149.522] (-1153.463) -- 0:00:03
950000 -- (-1150.651) (-1150.765) (-1151.786) [-1153.423] * (-1153.173) (-1151.287) (-1151.519) [-1149.989] -- 0:00:03
Average standard deviation of split frequencies: 0.007339
950500 -- (-1149.858) [-1151.642] (-1151.920) (-1151.642) * (-1151.721) (-1150.873) (-1150.220) [-1148.962] -- 0:00:03
951000 -- (-1153.476) (-1150.400) (-1151.453) [-1150.385] * (-1153.956) (-1155.870) [-1151.373] (-1150.871) -- 0:00:03
951500 -- (-1152.689) [-1150.520] (-1151.121) (-1151.026) * (-1150.740) [-1153.435] (-1150.679) (-1150.285) -- 0:00:03
952000 -- (-1154.796) [-1151.264] (-1149.456) (-1150.149) * (-1151.201) (-1151.198) [-1149.540] (-1150.687) -- 0:00:03
952500 -- [-1151.742] (-1155.283) (-1150.326) (-1151.238) * (-1151.675) (-1150.556) (-1150.263) [-1149.760] -- 0:00:03
953000 -- (-1149.642) (-1153.028) (-1150.389) [-1151.240] * (-1151.435) (-1152.315) [-1153.482] (-1159.400) -- 0:00:03
953500 -- (-1152.562) [-1151.657] (-1151.172) (-1149.659) * (-1150.687) [-1151.270] (-1150.840) (-1160.037) -- 0:00:03
954000 -- (-1150.270) [-1151.830] (-1152.715) (-1151.440) * [-1152.785] (-1152.167) (-1150.250) (-1150.482) -- 0:00:03
954500 -- (-1149.821) [-1152.655] (-1152.170) (-1153.146) * [-1151.998] (-1151.217) (-1150.255) (-1150.149) -- 0:00:03
955000 -- (-1150.365) (-1150.816) (-1149.034) [-1151.897] * (-1150.936) (-1151.412) (-1150.130) [-1152.948] -- 0:00:03
Average standard deviation of split frequencies: 0.007660
955500 -- (-1150.076) [-1151.087] (-1151.355) (-1151.588) * (-1152.979) (-1152.371) [-1153.040] (-1152.707) -- 0:00:03
956000 -- (-1151.449) (-1150.870) (-1150.307) [-1156.352] * (-1150.389) (-1151.436) (-1150.910) [-1148.729] -- 0:00:02
956500 -- (-1150.702) (-1150.349) (-1153.435) [-1153.065] * [-1152.840] (-1150.642) (-1152.142) (-1150.096) -- 0:00:02
957000 -- (-1151.035) (-1149.783) (-1151.177) [-1153.337] * (-1150.248) (-1150.562) (-1150.333) [-1149.954] -- 0:00:02
957500 -- (-1156.206) [-1150.505] (-1151.160) (-1149.123) * (-1152.570) (-1151.158) [-1150.844] (-1151.465) -- 0:00:02
958000 -- (-1153.519) (-1153.435) (-1151.693) [-1148.532] * [-1150.141] (-1151.737) (-1148.514) (-1151.957) -- 0:00:02
958500 -- (-1154.999) [-1149.125] (-1151.269) (-1150.472) * (-1151.769) (-1150.080) [-1151.113] (-1149.719) -- 0:00:02
959000 -- (-1153.357) (-1153.837) (-1151.022) [-1151.375] * (-1149.095) (-1151.796) [-1149.747] (-1150.147) -- 0:00:02
959500 -- (-1151.201) (-1150.399) (-1153.366) [-1151.624] * (-1151.093) (-1149.009) (-1150.269) [-1148.046] -- 0:00:02
960000 -- (-1150.925) (-1154.078) [-1150.698] (-1151.015) * [-1150.878] (-1154.125) (-1150.022) (-1150.291) -- 0:00:02
Average standard deviation of split frequencies: 0.007819
960500 -- (-1151.964) (-1151.676) [-1151.043] (-1150.764) * [-1150.349] (-1152.262) (-1149.925) (-1150.301) -- 0:00:02
961000 -- (-1151.792) (-1150.949) (-1152.262) [-1152.711] * (-1151.043) (-1150.919) [-1151.915] (-1150.536) -- 0:00:02
961500 -- (-1150.538) (-1149.840) [-1150.677] (-1151.852) * (-1151.477) (-1151.282) (-1148.998) [-1154.937] -- 0:00:02
962000 -- [-1150.597] (-1149.779) (-1150.258) (-1151.215) * (-1152.609) [-1150.638] (-1150.174) (-1150.940) -- 0:00:02
962500 -- (-1149.587) (-1157.989) [-1152.576] (-1153.665) * [-1151.227] (-1150.464) (-1151.366) (-1151.419) -- 0:00:02
963000 -- [-1151.590] (-1155.387) (-1154.096) (-1150.807) * (-1150.761) [-1148.792] (-1150.018) (-1151.733) -- 0:00:02
963500 -- (-1151.073) (-1154.933) (-1152.727) [-1149.378] * [-1151.938] (-1151.333) (-1150.202) (-1155.996) -- 0:00:02
964000 -- (-1152.725) [-1151.919] (-1154.538) (-1149.837) * (-1151.770) [-1152.143] (-1153.672) (-1152.290) -- 0:00:02
964500 -- (-1152.127) [-1151.387] (-1153.549) (-1148.451) * [-1150.124] (-1152.334) (-1152.541) (-1159.856) -- 0:00:02
965000 -- (-1151.071) [-1151.104] (-1152.072) (-1149.254) * (-1150.756) [-1153.301] (-1151.802) (-1149.940) -- 0:00:02
Average standard deviation of split frequencies: 0.008003
965500 -- (-1151.990) (-1151.304) (-1150.604) [-1149.342] * (-1149.833) [-1153.804] (-1149.813) (-1150.548) -- 0:00:02
966000 -- (-1149.404) [-1151.066] (-1150.473) (-1150.672) * (-1149.665) [-1150.112] (-1151.747) (-1153.088) -- 0:00:02
966500 -- (-1152.757) [-1153.170] (-1152.197) (-1152.129) * (-1149.625) (-1151.014) [-1153.744] (-1153.220) -- 0:00:02
967000 -- (-1152.389) (-1159.369) (-1151.648) [-1151.231] * (-1151.224) [-1156.244] (-1152.426) (-1151.713) -- 0:00:02
967500 -- [-1156.217] (-1153.437) (-1148.559) (-1151.482) * (-1152.862) (-1152.681) [-1151.287] (-1153.238) -- 0:00:02
968000 -- (-1150.490) (-1150.128) (-1153.654) [-1150.703] * (-1152.618) (-1150.150) (-1153.511) [-1152.007] -- 0:00:02
968500 -- [-1153.986] (-1151.255) (-1149.389) (-1152.584) * (-1157.466) [-1148.128] (-1150.083) (-1151.437) -- 0:00:02
969000 -- [-1150.788] (-1153.793) (-1150.590) (-1151.572) * (-1158.018) (-1150.748) [-1154.849] (-1150.360) -- 0:00:02
969500 -- (-1150.160) [-1152.431] (-1150.880) (-1148.905) * (-1149.753) (-1152.098) (-1152.309) [-1150.071] -- 0:00:02
970000 -- (-1151.926) [-1151.290] (-1150.286) (-1151.360) * (-1149.940) [-1150.844] (-1153.021) (-1150.140) -- 0:00:02
Average standard deviation of split frequencies: 0.007997
970500 -- (-1150.165) (-1151.379) [-1150.877] (-1151.956) * [-1152.051] (-1151.943) (-1150.861) (-1153.243) -- 0:00:02
971000 -- [-1150.420] (-1151.678) (-1154.441) (-1147.991) * (-1151.661) [-1159.054] (-1151.506) (-1152.361) -- 0:00:01
971500 -- (-1151.004) (-1152.404) [-1149.981] (-1150.326) * (-1150.311) [-1152.698] (-1150.660) (-1152.033) -- 0:00:01
972000 -- (-1149.506) (-1152.600) [-1153.760] (-1150.295) * (-1154.313) [-1152.766] (-1153.418) (-1152.005) -- 0:00:01
972500 -- (-1151.483) [-1153.108] (-1150.810) (-1150.902) * (-1152.808) (-1155.472) [-1150.286] (-1149.945) -- 0:00:01
973000 -- (-1153.544) [-1152.560] (-1150.251) (-1153.420) * [-1150.726] (-1151.532) (-1148.930) (-1150.478) -- 0:00:01
973500 -- (-1152.554) (-1155.049) (-1154.654) [-1153.073] * (-1151.137) (-1149.526) [-1153.056] (-1153.059) -- 0:00:01
974000 -- (-1151.963) (-1151.956) [-1150.574] (-1153.390) * (-1151.949) [-1150.813] (-1152.353) (-1151.389) -- 0:00:01
974500 -- (-1149.782) [-1150.769] (-1149.879) (-1150.692) * (-1150.046) (-1151.490) [-1151.351] (-1153.107) -- 0:00:01
975000 -- [-1149.628] (-1149.255) (-1149.992) (-1149.482) * (-1149.566) (-1153.089) (-1152.903) [-1154.663] -- 0:00:01
Average standard deviation of split frequencies: 0.008114
975500 -- (-1151.094) [-1149.821] (-1150.032) (-1153.630) * (-1151.087) (-1148.884) (-1151.720) [-1154.553] -- 0:00:01
976000 -- (-1152.301) [-1148.099] (-1150.440) (-1153.651) * (-1154.405) [-1149.166] (-1155.409) (-1153.361) -- 0:00:01
976500 -- (-1150.721) (-1150.076) [-1151.075] (-1154.129) * (-1153.556) (-1149.029) (-1153.579) [-1149.242] -- 0:00:01
977000 -- (-1151.173) (-1150.614) (-1152.966) [-1149.789] * [-1149.271] (-1149.979) (-1150.660) (-1149.463) -- 0:00:01
977500 -- (-1150.862) (-1154.078) [-1149.305] (-1151.176) * (-1151.858) [-1150.712] (-1152.961) (-1153.368) -- 0:00:01
978000 -- [-1154.408] (-1155.587) (-1150.809) (-1151.639) * (-1149.235) (-1152.464) [-1148.309] (-1151.297) -- 0:00:01
978500 -- (-1149.950) [-1153.264] (-1153.758) (-1152.470) * (-1151.566) (-1149.585) (-1149.303) [-1150.652] -- 0:00:01
979000 -- [-1150.260] (-1150.676) (-1152.473) (-1153.161) * (-1157.577) (-1152.003) [-1149.895] (-1153.914) -- 0:00:01
979500 -- (-1151.785) (-1155.211) [-1150.679] (-1151.532) * (-1155.159) (-1153.316) (-1150.843) [-1152.170] -- 0:00:01
980000 -- (-1152.666) [-1150.354] (-1150.119) (-1154.417) * (-1155.439) [-1149.597] (-1154.291) (-1149.213) -- 0:00:01
Average standard deviation of split frequencies: 0.008364
980500 -- (-1150.453) [-1153.447] (-1150.413) (-1152.967) * [-1151.627] (-1151.646) (-1151.229) (-1152.965) -- 0:00:01
981000 -- (-1149.914) [-1153.217] (-1148.907) (-1153.949) * [-1153.489] (-1150.757) (-1150.465) (-1151.825) -- 0:00:01
981500 -- (-1151.522) (-1152.451) (-1150.941) [-1150.493] * (-1150.183) (-1154.336) [-1149.152] (-1152.534) -- 0:00:01
982000 -- [-1151.172] (-1151.161) (-1151.088) (-1148.494) * (-1149.825) (-1155.072) [-1149.264] (-1153.420) -- 0:00:01
982500 -- [-1151.864] (-1150.437) (-1151.573) (-1149.707) * (-1150.000) [-1151.304] (-1148.248) (-1148.928) -- 0:00:01
983000 -- (-1152.209) [-1151.921] (-1150.483) (-1151.166) * (-1150.552) (-1150.172) (-1158.690) [-1149.289] -- 0:00:01
983500 -- (-1149.449) [-1152.622] (-1151.887) (-1154.126) * (-1153.608) (-1149.355) [-1150.198] (-1156.026) -- 0:00:01
984000 -- (-1149.376) [-1151.171] (-1151.145) (-1150.185) * (-1154.926) (-1149.312) (-1153.745) [-1152.516] -- 0:00:01
984500 -- (-1151.307) [-1150.927] (-1150.688) (-1152.220) * (-1154.336) (-1150.510) [-1149.751] (-1152.131) -- 0:00:01
985000 -- [-1150.457] (-1151.171) (-1149.918) (-1151.269) * (-1149.945) (-1150.773) (-1150.755) [-1154.500] -- 0:00:01
Average standard deviation of split frequencies: 0.008542
985500 -- [-1150.462] (-1151.351) (-1149.840) (-1152.165) * (-1149.728) [-1152.114] (-1149.762) (-1150.732) -- 0:00:00
986000 -- (-1152.427) (-1151.270) (-1150.686) [-1153.474] * (-1149.797) (-1149.961) [-1150.414] (-1151.387) -- 0:00:00
986500 -- (-1151.815) (-1151.562) [-1151.027] (-1152.741) * [-1150.801] (-1154.942) (-1150.720) (-1151.465) -- 0:00:00
987000 -- (-1150.601) (-1150.008) [-1152.050] (-1152.269) * (-1151.555) (-1151.763) (-1152.199) [-1150.469] -- 0:00:00
987500 -- [-1151.694] (-1154.966) (-1149.785) (-1152.558) * (-1151.097) (-1153.648) (-1150.912) [-1151.358] -- 0:00:00
988000 -- [-1150.923] (-1150.267) (-1152.060) (-1149.865) * (-1156.754) [-1150.530] (-1154.279) (-1154.504) -- 0:00:00
988500 -- (-1150.187) [-1151.844] (-1151.559) (-1152.738) * (-1152.345) (-1150.732) [-1148.700] (-1151.094) -- 0:00:00
989000 -- (-1154.495) [-1151.787] (-1152.861) (-1151.583) * (-1152.843) (-1152.875) (-1150.188) [-1151.134] -- 0:00:00
989500 -- (-1152.196) [-1154.087] (-1153.884) (-1150.590) * (-1152.719) (-1150.150) (-1154.522) [-1150.796] -- 0:00:00
990000 -- [-1150.181] (-1152.627) (-1152.934) (-1151.088) * (-1150.184) (-1152.792) (-1152.044) [-1151.218] -- 0:00:00
Average standard deviation of split frequencies: 0.008787
990500 -- [-1152.260] (-1153.925) (-1152.887) (-1156.253) * [-1153.430] (-1151.549) (-1153.990) (-1152.373) -- 0:00:00
991000 -- [-1148.724] (-1150.422) (-1151.593) (-1152.370) * (-1152.131) (-1155.096) (-1151.629) [-1149.910] -- 0:00:00
991500 -- (-1152.377) (-1150.125) [-1151.425] (-1152.608) * [-1152.988] (-1151.764) (-1152.693) (-1150.272) -- 0:00:00
992000 -- [-1151.540] (-1151.984) (-1149.815) (-1151.629) * [-1150.931] (-1152.370) (-1153.232) (-1151.397) -- 0:00:00
992500 -- [-1151.391] (-1151.814) (-1150.805) (-1155.897) * (-1151.342) (-1151.964) [-1153.733] (-1153.103) -- 0:00:00
993000 -- (-1151.089) (-1152.184) [-1150.854] (-1151.551) * (-1149.662) [-1151.388] (-1153.069) (-1152.459) -- 0:00:00
993500 -- (-1151.660) [-1155.427] (-1151.988) (-1149.769) * (-1151.511) (-1153.141) (-1159.306) [-1152.435] -- 0:00:00
994000 -- (-1151.602) [-1150.254] (-1155.358) (-1153.449) * [-1153.115] (-1150.731) (-1159.514) (-1156.090) -- 0:00:00
994500 -- (-1154.067) (-1150.163) [-1152.061] (-1150.406) * (-1150.817) (-1153.002) [-1151.189] (-1151.585) -- 0:00:00
995000 -- (-1152.883) (-1152.720) (-1153.124) [-1152.404] * (-1153.914) [-1150.757] (-1153.380) (-1154.275) -- 0:00:00
Average standard deviation of split frequencies: 0.008646
995500 -- (-1150.660) [-1153.658] (-1153.398) (-1150.628) * [-1154.832] (-1152.648) (-1151.229) (-1156.896) -- 0:00:00
996000 -- (-1151.839) (-1151.157) [-1151.092] (-1150.541) * (-1152.382) [-1153.436] (-1149.907) (-1152.142) -- 0:00:00
996500 -- (-1153.808) (-1151.437) (-1151.944) [-1154.299] * (-1152.359) (-1156.353) [-1153.421] (-1151.979) -- 0:00:00
997000 -- [-1151.355] (-1151.844) (-1153.810) (-1155.223) * (-1154.845) (-1153.782) (-1153.855) [-1152.209] -- 0:00:00
997500 -- (-1151.773) (-1150.752) (-1152.182) [-1158.642] * (-1153.948) (-1155.956) (-1153.206) [-1156.709] -- 0:00:00
998000 -- [-1151.127] (-1151.578) (-1152.663) (-1151.034) * (-1150.117) (-1148.452) [-1149.563] (-1149.858) -- 0:00:00
998500 -- (-1149.772) (-1151.366) [-1151.601] (-1150.782) * (-1149.631) (-1153.340) (-1151.244) [-1150.354] -- 0:00:00
999000 -- (-1155.290) [-1151.880] (-1152.450) (-1153.766) * [-1149.848] (-1152.443) (-1151.917) (-1149.764) -- 0:00:00
999500 -- (-1150.753) (-1151.711) (-1151.641) [-1149.166] * (-1150.760) (-1151.647) [-1150.350] (-1150.921) -- 0:00:00
1000000 -- (-1150.723) (-1151.335) (-1152.077) [-1150.313] * (-1150.771) (-1150.578) (-1152.584) [-1150.532] -- 0:00:00
Average standard deviation of split frequencies: 0.009014
Analysis completed in 1 mins 8 seconds
Analysis used 67.43 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1146.54
Likelihood of best state for "cold" chain of run 2 was -1146.94
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.4 % ( 67 %) Dirichlet(Revmat{all})
98.8 % ( 99 %) Slider(Revmat{all})
26.8 % ( 26 %) Dirichlet(Pi{all})
28.3 % ( 30 %) Slider(Pi{all})
71.7 % ( 46 %) Multiplier(Alpha{1,2})
80.1 % ( 61 %) Multiplier(Alpha{3})
25.5 % ( 34 %) Slider(Pinvar{all})
97.4 % ( 96 %) ExtSPR(Tau{all},V{all})
69.1 % ( 71 %) ExtTBR(Tau{all},V{all})
98.4 % ( 99 %) NNI(Tau{all},V{all})
88.0 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 28 %) Multiplier(V{all})
94.3 % ( 91 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 64 %) Dirichlet(Revmat{all})
98.8 % ( 97 %) Slider(Revmat{all})
26.8 % ( 19 %) Dirichlet(Pi{all})
28.0 % ( 19 %) Slider(Pi{all})
71.1 % ( 52 %) Multiplier(Alpha{1,2})
80.0 % ( 57 %) Multiplier(Alpha{3})
24.2 % ( 33 %) Slider(Pinvar{all})
97.4 % ( 98 %) ExtSPR(Tau{all},V{all})
69.4 % ( 77 %) ExtTBR(Tau{all},V{all})
98.4 % ( 98 %) NNI(Tau{all},V{all})
88.0 % ( 90 %) ParsSPR(Tau{all},V{all})
28.0 % ( 30 %) Multiplier(V{all})
94.3 % ( 93 %) Nodeslider(V{all})
30.6 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166392 0.82 0.66
3 | 166760 166762 0.83
4 | 166772 166788 166526
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.50
2 | 166189 0.82 0.66
3 | 166819 166698 0.84
4 | 166612 166504 167178
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1150.54
| 1 2 2 1 1 2 2 |
|1 2 2 1 2 1 1 1 1 |
| 1 2 1 2 2 *2 2 1 |
| 12 2 2 2 12 1 2 * 2 |
|2* * 1 2 22 2 2 1 21 222 1 12 |
| 1*2 111 2 1 2 2 12 1 *1 1 |
| * 12 1 22 *1 12 1 |
| 21 1 1 1 1 2 * 2 |
| 2 1 1 1 21 2 1 |
| 2 112 1 1 2|
| 1 |
| 1 2 1|
| 2 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1152.42
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1150.33 -1154.71
2 -1150.31 -1153.73
--------------------------------------
TOTAL -1150.32 -1154.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882559 0.091483 0.352579 1.513202 0.845531 1192.88 1345.45 1.000
r(A<->C){all} 0.164605 0.019435 0.000104 0.446475 0.128259 89.49 231.00 1.003
r(A<->G){all} 0.147622 0.018061 0.000018 0.427409 0.107436 214.08 257.94 1.009
r(A<->T){all} 0.161311 0.018203 0.000016 0.432762 0.128030 193.03 274.10 1.001
r(C<->G){all} 0.202551 0.025893 0.000060 0.528885 0.164689 100.52 160.63 1.006
r(C<->T){all} 0.167932 0.021000 0.000057 0.462488 0.129198 160.31 223.38 1.001
r(G<->T){all} 0.155980 0.017383 0.000096 0.426120 0.119891 192.69 196.18 1.000
pi(A){all} 0.199668 0.000182 0.174825 0.226775 0.199431 1293.26 1334.59 1.000
pi(C){all} 0.285945 0.000240 0.255358 0.315992 0.285735 1256.01 1353.37 1.000
pi(G){all} 0.345446 0.000270 0.312023 0.376636 0.344851 1292.84 1330.38 1.000
pi(T){all} 0.168942 0.000161 0.144041 0.193986 0.168539 1297.42 1348.92 1.001
alpha{1,2} 0.352095 0.168909 0.000143 1.199194 0.213214 1317.55 1398.45 1.000
alpha{3} 0.408469 0.223916 0.000122 1.351279 0.234926 1262.63 1371.63 1.000
pinvar{all} 0.996202 0.000010 0.989839 0.999969 0.997065 1240.35 1318.35 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- ....**
9 -- ..****
10 -- .*.*..
11 -- .****.
12 -- .**...
13 -- .*...*
14 -- ..*..*
15 -- .**.**
16 -- .*.***
17 -- ..**..
18 -- .*..*.
19 -- .***.*
20 -- ...*.*
21 -- ..*.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 484 0.161226 0.010364 0.153897 0.168554 2
8 454 0.151233 0.002827 0.149234 0.153231 2
9 447 0.148901 0.012719 0.139907 0.157895 2
10 445 0.148235 0.003298 0.145903 0.150566 2
11 441 0.146902 0.007066 0.141905 0.151899 2
12 441 0.146902 0.005182 0.143238 0.150566 2
13 439 0.146236 0.009893 0.139241 0.153231 2
14 435 0.144903 0.024968 0.127249 0.162558 2
15 429 0.142905 0.006124 0.138574 0.147235 2
16 423 0.140906 0.022141 0.125250 0.156562 2
17 417 0.138907 0.005182 0.135243 0.142572 2
18 411 0.136909 0.011777 0.128581 0.145237 2
19 405 0.134910 0.003298 0.132578 0.137242 2
20 402 0.133911 0.008480 0.127915 0.139907 2
21 388 0.129247 0.001884 0.127915 0.130580 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.126588 0.012731 0.000000 0.349980 0.095683 1.000 2
length{all}[2] 0.095499 0.009376 0.000032 0.289018 0.065712 1.000 2
length{all}[3] 0.096179 0.010241 0.000083 0.301623 0.063575 1.000 2
length{all}[4] 0.093299 0.009324 0.000041 0.285200 0.063734 1.000 2
length{all}[5] 0.091124 0.008921 0.000018 0.274425 0.061420 1.000 2
length{all}[6] 0.093943 0.009109 0.000019 0.285252 0.063052 1.000 2
length{all}[7] 0.095376 0.009216 0.000046 0.295797 0.068345 1.001 2
length{all}[8] 0.090743 0.009265 0.000277 0.254727 0.061732 1.000 2
length{all}[9] 0.099070 0.010786 0.000272 0.290039 0.066492 0.998 2
length{all}[10] 0.090736 0.007764 0.000008 0.271160 0.062537 0.998 2
length{all}[11] 0.094996 0.010279 0.000006 0.292065 0.056367 1.005 2
length{all}[12] 0.090764 0.009150 0.000531 0.268197 0.062929 0.998 2
length{all}[13] 0.094921 0.009829 0.000348 0.263050 0.057339 1.000 2
length{all}[14] 0.094453 0.007560 0.000366 0.265540 0.068664 0.999 2
length{all}[15] 0.102887 0.011359 0.000579 0.326620 0.071630 0.999 2
length{all}[16] 0.097495 0.009786 0.000172 0.290938 0.066444 1.000 2
length{all}[17] 0.097202 0.009146 0.000099 0.260189 0.067021 0.999 2
length{all}[18] 0.105340 0.009610 0.000446 0.298332 0.073163 0.998 2
length{all}[19] 0.093453 0.010471 0.000109 0.276909 0.063517 0.998 2
length{all}[20] 0.087762 0.006279 0.000623 0.259254 0.062930 0.998 2
length{all}[21] 0.090627 0.007263 0.000170 0.269731 0.060375 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009014
Maximum standard deviation of split frequencies = 0.024968
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------- C2 (2)
|
|------------------------------------------------ C3 (3)
+
|------------------------------------------------ C4 (4)
|
|---------------------------------------------- C5 (5)
|
\----------------------------------------------- C6 (6)
|--------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 843
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 281 / 281 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 281 / 281 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.109241 0.109175 0.109786 0.026169 0.080490 0.013475 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1228.562198
Iterating by ming2
Initial: fx= 1228.562198
x= 0.10924 0.10917 0.10979 0.02617 0.08049 0.01348 0.30000 1.30000
1 h-m-p 0.0000 0.0000 667.9927 ++ 1206.868132 m 0.0000 13 | 1/8
2 h-m-p 0.0000 0.0001 1013.1372 ++ 1177.869836 m 0.0001 24 | 2/8
3 h-m-p 0.0001 0.0007 141.5740 ++ 1131.362558 m 0.0007 35 | 3/8
4 h-m-p 0.0005 0.0025 56.3081 +CYCCYC 1111.113338 5 0.0024 56 | 3/8
5 h-m-p 0.0010 0.0049 26.6865 -----------.. | 3/8
6 h-m-p 0.0000 0.0000 686.5543 ++ 1109.554234 m 0.0000 87 | 4/8
7 h-m-p 0.0000 0.0000 345.6275 ++ 1109.497175 m 0.0000 98 | 5/8
8 h-m-p 0.0000 0.0225 3.1069 ++++YYCCC 1109.358079 4 0.0087 119 | 5/8
9 h-m-p 0.2058 8.0000 0.1309 +++ 1109.262535 m 8.0000 131 | 5/8
10 h-m-p 0.3158 1.5789 0.7639 ++ 1109.202573 m 1.5789 145 | 6/8
11 h-m-p 1.2309 8.0000 0.9787 ++ 1109.160140 m 8.0000 159 | 6/8
12 h-m-p 1.6000 8.0000 1.0941 YC 1109.154444 1 0.8255 173 | 6/8
13 h-m-p 0.9900 8.0000 0.9123 ++ 1109.147085 m 8.0000 184 | 6/8
14 h-m-p 1.5127 8.0000 4.8245 YCC 1109.142493 2 3.0583 200 | 6/8
15 h-m-p 1.6000 8.0000 4.7987 CC 1109.139886 1 2.1214 213 | 6/8
16 h-m-p 1.6000 8.0000 6.0951 +C 1109.137542 0 6.3884 225 | 6/8
17 h-m-p 1.6000 8.0000 10.9018 CC 1109.136529 1 1.9267 238 | 6/8
18 h-m-p 1.5460 8.0000 13.5865 ++ 1109.135473 m 8.0000 249 | 6/8
19 h-m-p 1.6000 8.0000 24.4177 C 1109.135058 0 1.6755 260 | 6/8
20 h-m-p 1.3290 8.0000 30.7839 ++ 1109.134570 m 8.0000 271 | 6/8
21 h-m-p 1.2050 6.0252 82.7615 YC 1109.134429 1 2.7485 283 | 6/8
22 h-m-p 0.5549 2.7743 97.7481 ++ 1109.134307 m 2.7743 294 | 7/8
23 h-m-p 1.6000 8.0000 0.0000 Y 1109.134302 0 0.9858 305 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 --------------N 1109.134302 0 0.0000 331
Out..
lnL = -1109.134302
332 lfun, 332 eigenQcodon, 1992 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.052469 0.035220 0.060871 0.035047 0.058176 0.010287 0.000100 0.887345 0.487754
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.169009
np = 9
lnL0 = -1175.040476
Iterating by ming2
Initial: fx= 1175.040476
x= 0.05247 0.03522 0.06087 0.03505 0.05818 0.01029 0.00011 0.88734 0.48775
1 h-m-p 0.0000 0.0000 658.6155 ++ 1173.381407 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 2587.4772 ++ 1155.156855 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0002 376.7778 ++ 1126.973364 m 0.0002 38 | 3/9
4 h-m-p 0.0000 0.0000 322.5511 ++ 1126.804644 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 33754.8932 ++ 1113.032780 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 226623.6329 ++ 1112.290811 m 0.0000 74 | 6/9
7 h-m-p 0.0037 0.1675 2.5936 ++CYYCCC 1109.407405 5 0.1374 97 | 6/9
8 h-m-p 0.1165 0.5827 0.5539 ++ 1109.359391 m 0.5827 109 | 7/9
9 h-m-p 1.6000 8.0000 0.0352 -CC 1109.359267 1 0.1470 127 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 -------Y 1109.359267 0 0.0000 148
Out..
lnL = -1109.359267
149 lfun, 447 eigenQcodon, 1788 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.069301 0.085216 0.016916 0.023984 0.069288 0.099705 0.000100 0.913401 0.333935 0.200371 1057.888656
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.053853
np = 11
lnL0 = -1155.894774
Iterating by ming2
Initial: fx= 1155.894774
x= 0.06930 0.08522 0.01692 0.02398 0.06929 0.09970 0.00011 0.91340 0.33393 0.20037 951.42857
1 h-m-p 0.0000 0.0000 142.5206 ++ 1155.786843 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0092 34.1728 +++++ 1146.247298 m 0.0092 33 | 2/11
3 h-m-p 0.0001 0.0003 49.0896 ++ 1144.485700 m 0.0003 47 | 3/11
4 h-m-p 0.0007 0.0180 24.0201 +++ 1134.433636 m 0.0180 62 | 4/11
5 h-m-p 0.0000 0.0002 977.9180 ++ 1130.585371 m 0.0002 76 | 5/11
6 h-m-p 0.0000 0.0000 41791.2118 ++ 1128.594071 m 0.0000 90 | 6/11
7 h-m-p 0.0013 0.0279 112.1336 ++YCCCC 1113.511414 4 0.0236 113 | 6/11
8 h-m-p 0.0323 0.1617 7.4732 YYCC 1113.327173 3 0.0115 131 | 6/11
9 h-m-p 0.2840 8.0000 0.3014 +++ 1112.610415 m 8.0000 146 | 6/11
10 h-m-p 0.0425 0.2124 16.5439 +YYYCYYYCYY 1109.827305 10 0.2071 178 | 6/11
11 h-m-p 0.5168 2.5839 4.2252 ----------------.. | 6/11
12 h-m-p 0.0000 0.0001 49.8674 YCCCC 1109.797414 4 0.0000 227 | 6/11
13 h-m-p 0.0020 0.9916 0.9734 +++++ 1109.498420 m 0.9916 244 | 7/11
14 h-m-p 0.3812 1.9059 0.0318 YCYCCC 1109.363382 5 0.9300 271 | 7/11
15 h-m-p 0.2855 8.0000 0.1035 +++ 1109.262952 m 8.0000 290 | 7/11
16 h-m-p 0.0245 0.6061 33.8061 +CYCC 1109.152919 3 0.0847 314 | 7/11
17 h-m-p 1.6000 8.0000 0.1499 YCCC 1109.139733 3 0.8069 333 | 7/11
18 h-m-p 0.8280 8.0000 0.1461 ++ 1109.135983 m 8.0000 351 | 7/11
19 h-m-p 1.6000 8.0000 0.5033 ++ 1109.134435 m 8.0000 369 | 7/11
20 h-m-p 1.6000 8.0000 0.0286 YC 1109.134346 1 1.0938 388 | 7/11
21 h-m-p 0.4505 8.0000 0.0695 +++ 1109.134334 m 8.0000 407 | 7/11
22 h-m-p 0.7434 8.0000 0.7475 +Y 1109.134319 0 5.1521 426 | 7/11
23 h-m-p 1.6000 8.0000 0.0626 Y 1109.134317 0 1.0429 444 | 7/11
24 h-m-p 0.8007 8.0000 0.0815 +C 1109.134317 0 3.2027 463 | 7/11
25 h-m-p 0.8805 8.0000 0.2965 ++ 1109.134317 m 8.0000 481 | 7/11
26 h-m-p 1.6000 8.0000 0.2401 C 1109.134317 0 1.9890 499 | 7/11
27 h-m-p 1.6000 8.0000 0.0733 C 1109.134317 0 0.4742 517 | 7/11
28 h-m-p 0.1436 8.0000 0.2421 +Y 1109.134317 0 0.4485 536 | 7/11
29 h-m-p 0.2330 8.0000 0.4661 Y 1109.134317 0 0.5497 554 | 7/11
30 h-m-p 0.3882 8.0000 0.6600 Y 1109.134317 0 0.7240 572 | 7/11
31 h-m-p 1.0709 8.0000 0.4462 ++ 1109.134317 m 8.0000 590 | 7/11
32 h-m-p 1.6000 8.0000 0.1420 +Y 1109.134317 0 5.1508 609 | 7/11
33 h-m-p 1.6000 8.0000 0.3774 --Y 1109.134317 0 0.0117 629 | 7/11
34 h-m-p 0.0061 3.0689 27.5399 ------------.. | 7/11
35 h-m-p 0.0004 0.1949 0.0185 ----Y 1109.134317 0 0.0000 675 | 7/11
36 h-m-p 0.0160 8.0000 0.0000 ---Y 1109.134317 0 0.0001 696
Out..
lnL = -1109.134317
697 lfun, 2788 eigenQcodon, 12546 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1114.070242 S = -1112.631347 -2.367449
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:04
did 20 / 56 patterns 0:05
did 30 / 56 patterns 0:05
did 40 / 56 patterns 0:05
did 50 / 56 patterns 0:05
did 56 / 56 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.036005 0.045827 0.078213 0.109166 0.097996 0.077691 0.000100 0.889874 1.888903
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.401636
np = 9
lnL0 = -1223.446954
Iterating by ming2
Initial: fx= 1223.446954
x= 0.03600 0.04583 0.07821 0.10917 0.09800 0.07769 0.00011 0.88987 1.88890
1 h-m-p 0.0000 0.0000 601.0269 ++ 1222.992541 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 986.0657 +CYCYYYYC 1207.991789 7 0.0000 36 | 1/9
3 h-m-p 0.0006 0.0130 68.5159 +++ 1170.313138 m 0.0130 49 | 1/9
4 h-m-p 0.0828 0.4142 4.6201 -CYCC
QuantileBeta(0.05, 0.00787, 1.80533) = 2.409235e-161 2000 rounds
C 1168.844420 4 0.0035 69 | 1/9
5 h-m-p 0.0003 0.0015 6.3413 ----------.. | 1/9
6 h-m-p 0.0000 0.0000 1006.3362 ++ 1157.488787 m 0.0000 101 | 2/9
7 h-m-p 0.0000 0.0000 801.1358 +CYCYYCCC 1145.566263 7 0.0000 125 | 2/9
8 h-m-p 0.0000 0.0000 9690.8690 ++ 1127.696982 m 0.0000 137 | 3/9
9 h-m-p 0.0000 0.0000 69.5714 ++ 1127.307506 m 0.0000 149 | 4/9
10 h-m-p 0.0000 0.0001 190.0307 ++ 1117.451805 m 0.0001 161 | 5/9
11 h-m-p 0.0000 0.0001 83.4888 ++ 1114.989084 m 0.0001 173 | 6/9
12 h-m-p 0.0054 2.6903 0.6688 +++++ 1110.228587 m 2.6903 188 | 7/9
13 h-m-p 1.6000 8.0000 0.0006 ++ 1109.633742 m 8.0000 203 | 7/9
14 h-m-p 1.6000 8.0000 0.0019 +CCCC 1109.381501 3 5.2730 224 | 7/9
15 h-m-p 1.6000 8.0000 0.0000 +Y 1109.381501 0 7.1016 239 | 7/9
16 h-m-p 1.4587 8.0000 0.0000 ---C 1109.381501 0 0.0057 256 | 7/9
17 h-m-p 0.0160 8.0000 0.0000 N 1109.381501 0 0.0040 270 | 7/9
18 h-m-p 0.0160 8.0000 0.0000 -----Y 1109.381501 0 0.0000 289
Out..
lnL = -1109.381501
290 lfun, 3190 eigenQcodon, 17400 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.074830 0.034719 0.093839 0.080360 0.014623 0.027225 0.000100 0.900000 1.001566 1.335559 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.109773
np = 11
lnL0 = -1135.390438
Iterating by ming2
Initial: fx= 1135.390438
x= 0.07483 0.03472 0.09384 0.08036 0.01462 0.02722 0.00011 0.90000 1.00157 1.33556 951.42857
1 h-m-p 0.0000 0.0000 210.4421 ++ 1134.125992 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0000 21496.1773 ++ 1116.912673 m 0.0000 30 | 2/11
3 h-m-p 0.0000 0.0000 857.6793 CYCYC 1115.736287 4 0.0000 51 | 2/11
4 h-m-p 0.0007 0.0076 13.3002 ++ 1114.865993 m 0.0076 65 | 3/11
5 h-m-p 0.0003 0.0013 9.7148 ++ 1114.492301 m 0.0013 79 | 4/11
6 h-m-p 0.0034 0.0245 3.4161 ++ 1113.443714 m 0.0245 93 | 5/11
7 h-m-p 0.0003 0.0017 55.2032 ++ 1113.029559 m 0.0017 107 | 6/11
8 h-m-p 0.1024 1.1664 0.9288 ++ 1110.621877 m 1.1664 121 | 6/11
9 h-m-p -0.0000 -0.0000 5.9431
h-m-p: -4.55658325e-18 -2.27829163e-17 5.94306596e+00 1110.621877
.. | 6/11
10 h-m-p 0.0000 0.0002 373.7050 ++YYYYCYCCCC 1109.144682 9 0.0002 166 | 6/11
11 h-m-p 0.0810 5.4034 0.7833 -----C 1109.144677 0 0.0000 185 | 6/11
12 h-m-p 0.0841 0.4206 0.0000 ++ 1109.144674 m 0.4206 204 | 6/11
13 h-m-p -0.0000 -0.0000 0.0254
h-m-p: -0.00000000e+00 -0.00000000e+00 2.54197547e-02 1109.144674
.. | 6/11
14 h-m-p 0.0002 0.1213 0.1810 Y 1109.144665 0 0.0005 239 | 6/11
15 h-m-p 0.0003 0.1471 6.3526 +++YYC 1109.137277 2 0.0282 263 | 6/11
16 h-m-p 1.6000 8.0000 0.0091 YC 1109.136360 1 0.9882 278 | 6/11
17 h-m-p 0.7385 8.0000 0.0122 ++ 1109.135593 m 8.0000 297 | 6/11
18 h-m-p 0.9397 6.2258 0.1041 ++ 1109.134315 m 6.2258 316
QuantileBeta(0.15, 0.00495, 2.09874) = 1.957685e-162 2000 rounds
| 7/11
19 h-m-p 0.7294 8.0000 0.0001 -----------Y 1109.134315 0 0.0000 346
QuantileBeta(0.15, 0.00495, 2.09874) = 1.957685e-162 2000 rounds
| 7/11
20 h-m-p 0.0024 1.1759 0.0014 ++++Y 1109.134314 0 0.3947 368 | 7/11
21 h-m-p 1.6000 8.0000 0.0000 ------------C 1109.134314 0 0.0000 398 | 7/11
22 h-m-p 0.0000 0.0044 0.0125 -------C 1109.134314 0 0.0000 423 | 7/11
23 h-m-p 0.0135 6.7562 0.0000 -Y 1109.134314 0 0.0008 442 | 7/11
24 h-m-p 0.0160 8.0000 0.0000 ------Y 1109.134314 0 0.0000 466
Out..
lnL = -1109.134314
467 lfun, 5604 eigenQcodon, 30822 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1113.812967 S = -1112.635182 -1.981260
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:17
did 20 / 56 patterns 0:17
did 30 / 56 patterns 0:18
did 40 / 56 patterns 0:18
did 50 / 56 patterns 0:18
did 56 / 56 patterns 0:18
Time used: 0:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=281
NC_011896_1_WP_012634439_1_1984_MLBR_RS09415 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
NC_002677_1_NP_302259_1_1131_rpsC VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
**************************************************
NC_011896_1_WP_012634439_1_1984_MLBR_RS09415 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NC_002677_1_NP_302259_1_1131_rpsC IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485 IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
**************************************************
NC_011896_1_WP_012634439_1_1984_MLBR_RS09415 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
NC_002677_1_NP_302259_1_1131_rpsC NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485 NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
**************************************************
NC_011896_1_WP_012634439_1_1984_MLBR_RS09415 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
NC_002677_1_NP_302259_1_1131_rpsC VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485 VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
**************************************************
NC_011896_1_WP_012634439_1_1984_MLBR_RS09415 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
NC_002677_1_NP_302259_1_1131_rpsC WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485 WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
**************************************************
NC_011896_1_WP_012634439_1_1984_MLBR_RS09415 GRAVGGQESAATNIGHSDDSVVTHEPQIAES
NC_002677_1_NP_302259_1_1131_rpsC GRAVGGEESAATNIGHSDDSVVTHEPQIAES
NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485 GRAVGGEESAATNIGHSDDSVVTHEPQIAES
******:************************
>NC_011896_1_WP_012634439_1_1984_MLBR_RS09415 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT GGACGGGCGGTGGGTGGCCAAGAAAGCGCTGCTACCAACATTGGGCACTC TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC >NC_002677_1_NP_302259_1_1131_rpsC GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC >NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC >NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC >NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC >NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485 GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>NC_011896_1_WP_012634439_1_1984_MLBR_RS09415 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA GRAVGGQESAATNIGHSDDSVVTHEPQIAES >NC_002677_1_NP_302259_1_1131_rpsC VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA GRAVGGEESAATNIGHSDDSVVTHEPQIAES >NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA GRAVGGEESAATNIGHSDDSVVTHEPQIAES >NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA GRAVGGEESAATNIGHSDDSVVTHEPQIAES >NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA GRAVGGEESAATNIGHSDDSVVTHEPQIAES >NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485 VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA GRAVGGEESAATNIGHSDDSVVTHEPQIAES
#NEXUS
[ID: 0147934217]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_012634439_1_1984_MLBR_RS09415
NC_002677_1_NP_302259_1_1131_rpsC
NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600
NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220
NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215
NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485
;
end;
begin trees;
translate
1 NC_011896_1_WP_012634439_1_1984_MLBR_RS09415,
2 NC_002677_1_NP_302259_1_1131_rpsC,
3 NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600,
4 NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220,
5 NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215,
6 NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.09568349,2:0.06571205,3:0.06357506,4:0.06373363,5:0.06142039,6:0.0630521);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.09568349,2:0.06571205,3:0.06357506,4:0.06373363,5:0.06142039,6:0.0630521);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1150.33 -1154.71
2 -1150.31 -1153.73
--------------------------------------
TOTAL -1150.32 -1154.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882559 0.091483 0.352579 1.513202 0.845531 1192.88 1345.45 1.000
r(A<->C){all} 0.164605 0.019435 0.000104 0.446475 0.128259 89.49 231.00 1.003
r(A<->G){all} 0.147622 0.018061 0.000018 0.427409 0.107436 214.08 257.94 1.009
r(A<->T){all} 0.161311 0.018203 0.000016 0.432762 0.128030 193.03 274.10 1.001
r(C<->G){all} 0.202551 0.025893 0.000060 0.528885 0.164689 100.52 160.63 1.006
r(C<->T){all} 0.167932 0.021000 0.000057 0.462488 0.129198 160.31 223.38 1.001
r(G<->T){all} 0.155980 0.017383 0.000096 0.426120 0.119891 192.69 196.18 1.000
pi(A){all} 0.199668 0.000182 0.174825 0.226775 0.199431 1293.26 1334.59 1.000
pi(C){all} 0.285945 0.000240 0.255358 0.315992 0.285735 1256.01 1353.37 1.000
pi(G){all} 0.345446 0.000270 0.312023 0.376636 0.344851 1292.84 1330.38 1.000
pi(T){all} 0.168942 0.000161 0.144041 0.193986 0.168539 1297.42 1348.92 1.001
alpha{1,2} 0.352095 0.168909 0.000143 1.199194 0.213214 1317.55 1398.45 1.000
alpha{3} 0.408469 0.223916 0.000122 1.351279 0.234926 1262.63 1371.63 1.000
pinvar{all} 0.996202 0.000010 0.989839 0.999969 0.997065 1240.35 1318.35 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpsC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 281
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 6 6 6 6 6 6 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 10 10 10 10 10 10
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 11 11 11 11 11 11
CTA 3 3 3 3 3 3 | CCA 0 0 0 0 0 0 | Gln CAA 6 5 5 5 5 5 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 6 6 6 6 6 6 | CAG 7 7 7 7 7 7 | CGG 12 12 12 12 12 12
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 2 2 2 2 2 2 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1
ATC 12 12 12 12 12 12 | ACC 14 14 14 14 14 14 | AAC 3 3 3 3 3 3 | AGC 5 5 5 5 5 5
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 10 10 10 10 10 10 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 8 8 8 8 8 8 | Asp GAT 3 3 3 3 3 3 | Gly GGT 7 7 7 7 7 7
GTC 9 9 9 9 9 9 | GCC 8 8 8 8 8 8 | GAC 10 10 10 10 10 10 | GGC 18 18 18 18 18 18
GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 6 7 7 7 7 7 | GGA 1 1 1 1 1 1
GTG 11 11 11 11 11 11 | GCG 12 12 12 12 12 12 | GAG 14 14 14 14 14 14 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_012634439_1_1984_MLBR_RS09415
position 1: T:0.10676 C:0.24199 A:0.23488 G:0.41637
position 2: T:0.22420 C:0.23132 A:0.27402 G:0.27046
position 3: T:0.17794 C:0.38790 A:0.09253 G:0.34164
Average T:0.16963 C:0.28707 A:0.20047 G:0.34282
#2: NC_002677_1_NP_302259_1_1131_rpsC
position 1: T:0.10676 C:0.23843 A:0.23488 G:0.41993
position 2: T:0.22420 C:0.23132 A:0.27402 G:0.27046
position 3: T:0.17794 C:0.38790 A:0.09253 G:0.34164
Average T:0.16963 C:0.28588 A:0.20047 G:0.34401
#3: NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600
position 1: T:0.10676 C:0.23843 A:0.23488 G:0.41993
position 2: T:0.22420 C:0.23132 A:0.27402 G:0.27046
position 3: T:0.17794 C:0.38790 A:0.09253 G:0.34164
Average T:0.16963 C:0.28588 A:0.20047 G:0.34401
#4: NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220
position 1: T:0.10676 C:0.23843 A:0.23488 G:0.41993
position 2: T:0.22420 C:0.23132 A:0.27402 G:0.27046
position 3: T:0.17794 C:0.38790 A:0.09253 G:0.34164
Average T:0.16963 C:0.28588 A:0.20047 G:0.34401
#5: NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215
position 1: T:0.10676 C:0.23843 A:0.23488 G:0.41993
position 2: T:0.22420 C:0.23132 A:0.27402 G:0.27046
position 3: T:0.17794 C:0.38790 A:0.09253 G:0.34164
Average T:0.16963 C:0.28588 A:0.20047 G:0.34401
#6: NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485
position 1: T:0.10676 C:0.23843 A:0.23488 G:0.41993
position 2: T:0.22420 C:0.23132 A:0.27402 G:0.27046
position 3: T:0.17794 C:0.38790 A:0.09253 G:0.34164
Average T:0.16963 C:0.28588 A:0.20047 G:0.34401
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 18 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 6 | TAC 36 | TGC 12
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 24 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 60
CTC 12 | CCC 6 | CAC 24 | CGC 66
CTA 18 | CCA 0 | Gln Q CAA 31 | CGA 0
CTG 6 | CCG 36 | CAG 42 | CGG 72
------------------------------------------------------------------------------
Ile I ATT 30 | Thr T ACT 12 | Asn N AAT 18 | Ser S AGT 6
ATC 72 | ACC 84 | AAC 18 | AGC 30
ATA 6 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 18 | ACG 6 | AAG 60 | AGG 12
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 48 | Asp D GAT 18 | Gly G GGT 42
GTC 54 | GCC 48 | GAC 60 | GGC 108
GTA 12 | GCA 12 | Glu E GAA 41 | GGA 6
GTG 66 | GCG 72 | GAG 84 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10676 C:0.23903 A:0.23488 G:0.41934
position 2: T:0.22420 C:0.23132 A:0.27402 G:0.27046
position 3: T:0.17794 C:0.38790 A:0.09253 G:0.34164
Average T:0.16963 C:0.28608 A:0.20047 G:0.34381
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -1109.134302 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.003603 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003623
(1: 0.003603, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634439_1_1984_MLBR_RS09415: 0.003603, NC_002677_1_NP_302259_1_1131_rpsC: 0.000004, NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600: 0.000004, NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220: 0.000004, NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215: 0.000004, NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.004 672.8 170.2 999.0000 0.0015 0.0000 1.0 0.0
7..2 0.000 672.8 170.2 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 672.8 170.2 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 672.8 170.2 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 672.8 170.2 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 672.8 170.2 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0015
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1109.359267 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.003603 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.820130 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003623
(1: 0.003603, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634439_1_1984_MLBR_RS09415: 0.003603, NC_002677_1_NP_302259_1_1131_rpsC: 0.000004, NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600: 0.000004, NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220: 0.000004, NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215: 0.000004, NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.82013 0.17987
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.004 672.8 170.2 1.0000 0.0012 0.0012 0.8 0.2
7..2 0.000 672.8 170.2 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 672.8 170.2 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 672.8 170.2 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 672.8 170.2 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 672.8 170.2 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1109.134317 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.003603 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000001 0.003856 1.000000 951.452634
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003623
(1: 0.003603, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634439_1_1984_MLBR_RS09415: 0.003603, NC_002677_1_NP_302259_1_1131_rpsC: 0.000004, NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600: 0.000004, NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220: 0.000004, NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215: 0.000004, NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00386 0.99614
w: 1.00000 1.00000 951.45263
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.004 672.8 170.2 947.7870 0.0015 0.0000 1.0 0.0
7..2 0.000 672.8 170.2 947.7870 0.0000 0.0000 0.0 0.0
7..3 0.000 672.8 170.2 947.7870 0.0000 0.0000 0.0 0.0
7..4 0.000 672.8 170.2 947.7870 0.0000 0.0000 0.0 0.0
7..5 0.000 672.8 170.2 947.7870 0.0000 0.0000 0.0 0.0
7..6 0.000 672.8 170.2 947.7870 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634439_1_1984_MLBR_RS09415)
Pr(w>1) post mean +- SE for w
1 V 0.996** 947.772
2 G 0.996** 947.771
3 Q 0.996** 947.768
4 K 0.996** 947.773
5 I 0.996** 947.779
6 N 0.996** 947.778
7 P 0.996** 947.773
8 H 0.996** 947.776
9 G 0.996** 947.771
10 F 0.996** 947.774
11 R 0.996** 947.776
12 L 0.996** 947.777
13 G 0.996** 947.780
14 I 0.996** 947.773
15 T 0.996** 947.776
16 T 0.996** 947.776
17 G 0.996** 947.771
18 W 0.996** 947.774
19 K 0.996** 947.773
20 S 0.996** 947.782
21 R 0.996** 947.780
22 W 0.996** 947.774
23 Y 0.996** 947.774
24 A 0.996** 947.770
25 D 0.996** 947.764
26 K 0.996** 947.780
27 Q 0.996** 947.768
28 Y 0.996** 947.774
29 A 0.996** 947.770
30 E 0.996** 947.765
31 Y 0.996** 947.774
32 V 0.996** 947.770
33 K 0.996** 947.773
34 E 0.996** 947.774
35 D 0.996** 947.773
36 V 0.996** 947.770
37 A 0.996** 947.772
38 I 0.996** 947.773
39 R 0.996** 947.776
40 R 0.996** 947.776
41 L 0.996** 947.774
42 L 0.996** 947.783
43 S 0.996** 947.775
44 T 0.996** 947.776
45 G 0.996** 947.771
46 L 0.996** 947.783
47 E 0.996** 947.765
48 R 0.996** 947.771
49 A 0.996** 947.772
50 G 0.996** 947.773
51 I 0.996** 947.773
52 A 0.996** 947.770
53 D 0.996** 947.764
54 V 0.996** 947.772
55 E 0.996** 947.765
56 I 0.996** 947.779
57 E 0.996** 947.765
58 R 0.996** 947.771
59 T 0.996** 947.776
60 R 0.996** 947.780
61 D 0.996** 947.764
62 R 0.996** 947.776
63 V 0.996** 947.770
64 R 0.996** 947.775
65 V 0.996** 947.772
66 D 0.996** 947.764
67 I 0.996** 947.773
68 H 0.996** 947.767
69 T 0.996** 947.776
70 A 0.996** 947.770
71 R 0.996** 947.780
72 P 0.996** 947.771
73 G 0.996** 947.771
74 I 0.996** 947.773
75 V 0.996** 947.770
76 I 0.996** 947.779
77 G 0.996** 947.780
78 R 0.996** 947.780
79 R 0.996** 947.771
80 G 0.996** 947.780
81 T 0.996** 947.776
82 E 0.996** 947.774
83 A 0.996** 947.770
84 D 0.996** 947.764
85 R 0.996** 947.776
86 I 0.996** 947.784
87 R 0.996** 947.776
88 A 0.996** 947.783
89 D 0.996** 947.773
90 L 0.996** 947.783
91 E 0.996** 947.765
92 K 0.996** 947.773
93 L 0.996** 947.777
94 T 0.996** 947.776
95 C 0.996** 947.773
96 K 0.996** 947.773
97 Q 0.996** 947.768
98 V 0.996** 947.779
99 Q 0.996** 947.778
100 L 0.996** 947.772
101 N 0.996** 947.778
102 I 0.996** 947.773
103 L 0.996** 947.772
104 E 0.996** 947.774
105 V 0.996** 947.770
106 K 0.996** 947.780
107 N 0.996** 947.772
108 P 0.996** 947.780
109 E 0.996** 947.765
110 S 0.996** 947.778
111 Q 0.996** 947.778
112 A 0.996** 947.783
113 Q 0.996** 947.778
114 L 0.996** 947.777
115 V 0.996** 947.772
116 A 0.996** 947.770
117 Q 0.996** 947.778
118 G 0.996** 947.773
119 V 0.996** 947.770
120 A 0.996** 947.779
121 E 0.996** 947.765
122 Q 0.996** 947.768
123 L 0.996** 947.777
124 S 0.996** 947.772
125 N 0.996** 947.778
126 R 0.996** 947.776
127 V 0.996** 947.772
128 A 0.996** 947.772
129 F 0.996** 947.774
130 R 0.996** 947.780
131 R 0.996** 947.776
132 A 0.996** 947.772
133 M 0.996** 947.773
134 R 0.996** 947.771
135 K 0.996** 947.773
136 A 0.996** 947.779
137 I 0.996** 947.773
138 Q 0.996** 947.768
139 S 0.996** 947.782
140 A 0.996** 947.772
141 M 0.996** 947.773
142 R 0.996** 947.780
143 Q 0.996** 947.778
144 P 0.996** 947.780
145 N 0.996** 947.772
146 V 0.996** 947.770
147 K 0.996** 947.773
148 G 0.996** 947.771
149 I 0.996** 947.773
150 R 0.996** 947.775
151 V 0.996** 947.772
152 Q 0.996** 947.768
153 C 0.996** 947.773
154 S 0.996** 947.778
155 G 0.996** 947.771
156 R 0.996** 947.776
157 L 0.996** 947.780
158 G 0.996** 947.780
159 G 0.996** 947.771
160 A 0.996** 947.772
161 E 0.996** 947.765
162 M 0.996** 947.773
163 S 0.996** 947.772
164 R 0.996** 947.771
165 S 0.996** 947.778
166 E 0.996** 947.765
167 F 0.996** 947.780
168 Y 0.996** 947.774
169 R 0.996** 947.780
170 E 0.996** 947.765
171 G 0.996** 947.771
172 R 0.996** 947.771
173 V 0.996** 947.772
174 P 0.996** 947.773
175 L 0.996** 947.777
176 H 0.996** 947.767
177 T 0.996** 947.776
178 L 0.996** 947.777
179 R 0.996** 947.771
180 A 0.996** 947.779
181 D 0.996** 947.773
182 I 0.996** 947.773
183 D 0.996** 947.764
184 Y 0.996** 947.774
185 G 0.996** 947.773
186 L 0.996** 947.783
187 H 0.996** 947.776
188 E 0.996** 947.765
189 A 0.996** 947.770
190 K 0.996** 947.773
191 T 0.996** 947.782
192 T 0.996** 947.776
193 F 0.996** 947.774
194 G 0.996** 947.771
195 R 0.996** 947.776
196 I 0.996** 947.773
197 G 0.996** 947.771
198 V 0.996** 947.772
199 K 0.996** 947.773
200 V 0.996** 947.783
201 W 0.996** 947.774
202 I 0.996** 947.773
203 Y 0.996** 947.774
204 K 0.996** 947.773
205 G 0.996** 947.771
206 D 0.996** 947.764
207 I 0.996** 947.779
208 V 0.996** 947.770
209 G 0.996** 947.780
210 G 0.996** 947.771
211 K 0.996** 947.780
212 R 0.996** 947.780
213 E 0.996** 947.774
214 V 0.996** 947.772
215 T 0.996** 947.784
216 A 0.996** 947.770
217 V 0.996** 947.770
218 A 0.996** 947.772
219 P 0.996** 947.773
220 A 0.996** 947.779
221 G 0.996** 947.780
222 A 0.996** 947.779
223 E 0.996** 947.765
224 R 0.996** 947.780
225 A 0.996** 947.772
226 R 0.996** 947.771
227 R 0.996** 947.771
228 E 0.996** 947.765
229 R 0.996** 947.776
230 P 0.996** 947.773
231 S 0.996** 947.778
232 G 0.996** 947.771
233 T 0.996** 947.777
234 R 0.996** 947.780
235 P 0.996** 947.773
236 R 0.996** 947.771
237 R 0.996** 947.771
238 S 0.996** 947.778
239 G 0.996** 947.771
240 A 0.996** 947.772
241 A 0.996** 947.772
242 G 0.996** 947.771
243 T 0.996** 947.776
244 T 0.996** 947.776
245 V 0.996** 947.783
246 T 0.996** 947.782
247 G 0.996** 947.771
248 T 0.996** 947.776
249 D 0.996** 947.764
250 A 0.996** 947.779
251 G 0.996** 947.784
252 R 0.996** 947.776
253 A 0.996** 947.772
254 V 0.996** 947.772
255 G 0.996** 947.780
256 G 0.996** 947.771
257 Q 1.000** 951.449
258 E 0.996** 947.774
259 S 0.996** 947.772
260 A 0.996** 947.779
261 A 0.996** 947.779
262 T 0.996** 947.776
263 N 0.996** 947.772
264 I 0.996** 947.779
265 G 0.996** 947.773
266 H 0.996** 947.767
267 S 0.996** 947.782
268 D 0.996** 947.764
269 D 0.996** 947.764
270 S 0.996** 947.772
271 V 0.996** 947.772
272 V 0.996** 947.779
273 T 0.996** 947.776
274 H 0.996** 947.767
275 E 0.996** 947.774
276 P 0.996** 947.773
277 Q 0.996** 947.768
278 I 0.996** 947.773
279 A 0.996** 947.772
280 E 0.996** 947.765
281 S 0.996** 947.772
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634439_1_1984_MLBR_RS09415)
Pr(w>1) post mean +- SE for w
257 Q 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1109.381501 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.003604 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.045874 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003624
(1: 0.003604, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634439_1_1984_MLBR_RS09415: 0.003604, NC_002677_1_NP_302259_1_1131_rpsC: 0.000004, NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600: 0.000004, NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220: 0.000004, NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215: 0.000004, NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.04587 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.004 672.8 170.2 0.9000 0.0012 0.0013 0.8 0.2
7..2 0.000 672.8 170.2 0.9000 0.0000 0.0000 0.0 0.0
7..3 0.000 672.8 170.2 0.9000 0.0000 0.0000 0.0 0.0
7..4 0.000 672.8 170.2 0.9000 0.0000 0.0000 0.0 0.0
7..5 0.000 672.8 170.2 0.9000 0.0000 0.0000 0.0 0.0
7..6 0.000 672.8 170.2 0.9000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1109.134314 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.003603 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005007 2.098744 951.433008
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003623
(1: 0.003603, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634439_1_1984_MLBR_RS09415: 0.003603, NC_002677_1_NP_302259_1_1131_rpsC: 0.000004, NZ_LVXE01000034_1_WP_010908580_1_1551_A3216_RS09600: 0.000004, NZ_LYPH01000037_1_WP_010908580_1_1507_A8144_RS07220: 0.000004, NZ_CP029543_1_WP_010908580_1_2007_DIJ64_RS10215: 0.000004, NZ_AP014567_1_WP_010908580_1_2061_JK2ML_RS10485: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00501 q = 2.09874
(p1 = 0.99999) w = 951.43301
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 951.43301
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.004 672.8 170.2 951.4235 0.0015 0.0000 1.0 0.0
7..2 0.000 672.8 170.2 951.4235 0.0000 0.0000 0.0 0.0
7..3 0.000 672.8 170.2 951.4235 0.0000 0.0000 0.0 0.0
7..4 0.000 672.8 170.2 951.4235 0.0000 0.0000 0.0 0.0
7..5 0.000 672.8 170.2 951.4235 0.0000 0.0000 0.0 0.0
7..6 0.000 672.8 170.2 951.4235 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634439_1_1984_MLBR_RS09415)
Pr(w>1) post mean +- SE for w
1 V 1.000** 951.423
2 G 1.000** 951.423
3 Q 1.000** 951.423
4 K 1.000** 951.423
5 I 1.000** 951.423
6 N 1.000** 951.423
7 P 1.000** 951.423
8 H 1.000** 951.423
9 G 1.000** 951.423
10 F 1.000** 951.423
11 R 1.000** 951.423
12 L 1.000** 951.423
13 G 1.000** 951.423
14 I 1.000** 951.423
15 T 1.000** 951.423
16 T 1.000** 951.423
17 G 1.000** 951.423
18 W 1.000** 951.423
19 K 1.000** 951.423
20 S 1.000** 951.423
21 R 1.000** 951.423
22 W 1.000** 951.423
23 Y 1.000** 951.423
24 A 1.000** 951.423
25 D 1.000** 951.423
26 K 1.000** 951.423
27 Q 1.000** 951.423
28 Y 1.000** 951.423
29 A 1.000** 951.423
30 E 1.000** 951.423
31 Y 1.000** 951.423
32 V 1.000** 951.423
33 K 1.000** 951.423
34 E 1.000** 951.423
35 D 1.000** 951.423
36 V 1.000** 951.423
37 A 1.000** 951.423
38 I 1.000** 951.423
39 R 1.000** 951.423
40 R 1.000** 951.423
41 L 1.000** 951.423
42 L 1.000** 951.423
43 S 1.000** 951.423
44 T 1.000** 951.423
45 G 1.000** 951.423
46 L 1.000** 951.423
47 E 1.000** 951.423
48 R 1.000** 951.423
49 A 1.000** 951.423
50 G 1.000** 951.423
51 I 1.000** 951.423
52 A 1.000** 951.423
53 D 1.000** 951.423
54 V 1.000** 951.423
55 E 1.000** 951.423
56 I 1.000** 951.423
57 E 1.000** 951.423
58 R 1.000** 951.423
59 T 1.000** 951.423
60 R 1.000** 951.423
61 D 1.000** 951.423
62 R 1.000** 951.423
63 V 1.000** 951.423
64 R 1.000** 951.423
65 V 1.000** 951.423
66 D 1.000** 951.423
67 I 1.000** 951.423
68 H 1.000** 951.423
69 T 1.000** 951.423
70 A 1.000** 951.423
71 R 1.000** 951.423
72 P 1.000** 951.423
73 G 1.000** 951.423
74 I 1.000** 951.423
75 V 1.000** 951.423
76 I 1.000** 951.423
77 G 1.000** 951.423
78 R 1.000** 951.423
79 R 1.000** 951.423
80 G 1.000** 951.423
81 T 1.000** 951.423
82 E 1.000** 951.423
83 A 1.000** 951.423
84 D 1.000** 951.423
85 R 1.000** 951.423
86 I 1.000** 951.423
87 R 1.000** 951.423
88 A 1.000** 951.423
89 D 1.000** 951.423
90 L 1.000** 951.423
91 E 1.000** 951.423
92 K 1.000** 951.423
93 L 1.000** 951.423
94 T 1.000** 951.423
95 C 1.000** 951.423
96 K 1.000** 951.423
97 Q 1.000** 951.423
98 V 1.000** 951.423
99 Q 1.000** 951.423
100 L 1.000** 951.423
101 N 1.000** 951.423
102 I 1.000** 951.423
103 L 1.000** 951.423
104 E 1.000** 951.423
105 V 1.000** 951.423
106 K 1.000** 951.423
107 N 1.000** 951.423
108 P 1.000** 951.423
109 E 1.000** 951.423
110 S 1.000** 951.423
111 Q 1.000** 951.423
112 A 1.000** 951.423
113 Q 1.000** 951.423
114 L 1.000** 951.423
115 V 1.000** 951.423
116 A 1.000** 951.423
117 Q 1.000** 951.423
118 G 1.000** 951.423
119 V 1.000** 951.423
120 A 1.000** 951.423
121 E 1.000** 951.423
122 Q 1.000** 951.423
123 L 1.000** 951.423
124 S 1.000** 951.423
125 N 1.000** 951.423
126 R 1.000** 951.423
127 V 1.000** 951.423
128 A 1.000** 951.423
129 F 1.000** 951.423
130 R 1.000** 951.423
131 R 1.000** 951.423
132 A 1.000** 951.423
133 M 1.000** 951.423
134 R 1.000** 951.423
135 K 1.000** 951.423
136 A 1.000** 951.423
137 I 1.000** 951.423
138 Q 1.000** 951.423
139 S 1.000** 951.423
140 A 1.000** 951.423
141 M 1.000** 951.423
142 R 1.000** 951.423
143 Q 1.000** 951.423
144 P 1.000** 951.423
145 N 1.000** 951.423
146 V 1.000** 951.423
147 K 1.000** 951.423
148 G 1.000** 951.423
149 I 1.000** 951.423
150 R 1.000** 951.423
151 V 1.000** 951.423
152 Q 1.000** 951.423
153 C 1.000** 951.423
154 S 1.000** 951.423
155 G 1.000** 951.423
156 R 1.000** 951.423
157 L 1.000** 951.423
158 G 1.000** 951.423
159 G 1.000** 951.423
160 A 1.000** 951.423
161 E 1.000** 951.423
162 M 1.000** 951.423
163 S 1.000** 951.423
164 R 1.000** 951.423
165 S 1.000** 951.423
166 E 1.000** 951.423
167 F 1.000** 951.423
168 Y 1.000** 951.423
169 R 1.000** 951.423
170 E 1.000** 951.423
171 G 1.000** 951.423
172 R 1.000** 951.423
173 V 1.000** 951.423
174 P 1.000** 951.423
175 L 1.000** 951.423
176 H 1.000** 951.423
177 T 1.000** 951.423
178 L 1.000** 951.423
179 R 1.000** 951.423
180 A 1.000** 951.423
181 D 1.000** 951.423
182 I 1.000** 951.423
183 D 1.000** 951.423
184 Y 1.000** 951.423
185 G 1.000** 951.423
186 L 1.000** 951.423
187 H 1.000** 951.423
188 E 1.000** 951.423
189 A 1.000** 951.423
190 K 1.000** 951.423
191 T 1.000** 951.423
192 T 1.000** 951.423
193 F 1.000** 951.423
194 G 1.000** 951.423
195 R 1.000** 951.423
196 I 1.000** 951.423
197 G 1.000** 951.423
198 V 1.000** 951.423
199 K 1.000** 951.423
200 V 1.000** 951.423
201 W 1.000** 951.423
202 I 1.000** 951.423
203 Y 1.000** 951.423
204 K 1.000** 951.423
205 G 1.000** 951.423
206 D 1.000** 951.423
207 I 1.000** 951.423
208 V 1.000** 951.423
209 G 1.000** 951.423
210 G 1.000** 951.423
211 K 1.000** 951.423
212 R 1.000** 951.423
213 E 1.000** 951.423
214 V 1.000** 951.423
215 T 1.000** 951.423
216 A 1.000** 951.423
217 V 1.000** 951.423
218 A 1.000** 951.423
219 P 1.000** 951.423
220 A 1.000** 951.423
221 G 1.000** 951.423
222 A 1.000** 951.423
223 E 1.000** 951.423
224 R 1.000** 951.423
225 A 1.000** 951.423
226 R 1.000** 951.423
227 R 1.000** 951.423
228 E 1.000** 951.423
229 R 1.000** 951.423
230 P 1.000** 951.423
231 S 1.000** 951.423
232 G 1.000** 951.423
233 T 1.000** 951.423
234 R 1.000** 951.423
235 P 1.000** 951.423
236 R 1.000** 951.423
237 R 1.000** 951.423
238 S 1.000** 951.423
239 G 1.000** 951.423
240 A 1.000** 951.423
241 A 1.000** 951.423
242 G 1.000** 951.423
243 T 1.000** 951.423
244 T 1.000** 951.423
245 V 1.000** 951.423
246 T 1.000** 951.423
247 G 1.000** 951.423
248 T 1.000** 951.423
249 D 1.000** 951.423
250 A 1.000** 951.423
251 G 1.000** 951.423
252 R 1.000** 951.423
253 A 1.000** 951.423
254 V 1.000** 951.423
255 G 1.000** 951.423
256 G 1.000** 951.423
257 Q 1.000** 951.433
258 E 1.000** 951.423
259 S 1.000** 951.423
260 A 1.000** 951.423
261 A 1.000** 951.423
262 T 1.000** 951.423
263 N 1.000** 951.423
264 I 1.000** 951.423
265 G 1.000** 951.423
266 H 1.000** 951.423
267 S 1.000** 951.423
268 D 1.000** 951.423
269 D 1.000** 951.423
270 S 1.000** 951.423
271 V 1.000** 951.423
272 V 1.000** 951.423
273 T 1.000** 951.423
274 H 1.000** 951.423
275 E 1.000** 951.423
276 P 1.000** 951.423
277 Q 1.000** 951.423
278 I 1.000** 951.423
279 A 1.000** 951.423
280 E 1.000** 951.423
281 S 1.000** 951.423
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634439_1_1984_MLBR_RS09415)
Pr(w>1) post mean +- SE for w
1 V 0.639 4.860 +- 3.856
2 G 0.639 4.860 +- 3.856
3 Q 0.639 4.860 +- 3.856
4 K 0.639 4.860 +- 3.856
5 I 0.639 4.860 +- 3.856
6 N 0.639 4.860 +- 3.856
7 P 0.639 4.860 +- 3.856
8 H 0.639 4.860 +- 3.856
9 G 0.639 4.860 +- 3.856
10 F 0.639 4.860 +- 3.856
11 R 0.639 4.860 +- 3.856
12 L 0.639 4.860 +- 3.856
13 G 0.639 4.860 +- 3.856
14 I 0.639 4.860 +- 3.856
15 T 0.639 4.860 +- 3.856
16 T 0.639 4.860 +- 3.856
17 G 0.639 4.860 +- 3.856
18 W 0.639 4.860 +- 3.856
19 K 0.639 4.860 +- 3.856
20 S 0.639 4.860 +- 3.856
21 R 0.639 4.860 +- 3.856
22 W 0.639 4.860 +- 3.856
23 Y 0.639 4.860 +- 3.856
24 A 0.639 4.860 +- 3.856
25 D 0.639 4.860 +- 3.856
26 K 0.639 4.860 +- 3.856
27 Q 0.639 4.860 +- 3.856
28 Y 0.639 4.860 +- 3.856
29 A 0.639 4.860 +- 3.856
30 E 0.639 4.860 +- 3.856
31 Y 0.639 4.860 +- 3.856
32 V 0.639 4.860 +- 3.856
33 K 0.639 4.860 +- 3.856
34 E 0.639 4.860 +- 3.856
35 D 0.639 4.860 +- 3.856
36 V 0.639 4.860 +- 3.856
37 A 0.639 4.860 +- 3.856
38 I 0.639 4.860 +- 3.856
39 R 0.639 4.860 +- 3.856
40 R 0.639 4.860 +- 3.856
41 L 0.639 4.860 +- 3.856
42 L 0.639 4.860 +- 3.856
43 S 0.639 4.860 +- 3.856
44 T 0.639 4.860 +- 3.856
45 G 0.639 4.860 +- 3.856
46 L 0.639 4.860 +- 3.856
47 E 0.639 4.860 +- 3.856
48 R 0.639 4.860 +- 3.856
49 A 0.639 4.860 +- 3.856
50 G 0.639 4.860 +- 3.856
51 I 0.639 4.860 +- 3.856
52 A 0.639 4.860 +- 3.856
53 D 0.639 4.860 +- 3.856
54 V 0.639 4.860 +- 3.856
55 E 0.639 4.860 +- 3.856
56 I 0.639 4.860 +- 3.856
57 E 0.639 4.860 +- 3.856
58 R 0.639 4.860 +- 3.856
59 T 0.639 4.860 +- 3.856
60 R 0.639 4.860 +- 3.856
61 D 0.639 4.860 +- 3.856
62 R 0.639 4.860 +- 3.856
63 V 0.639 4.860 +- 3.856
64 R 0.639 4.860 +- 3.856
65 V 0.639 4.860 +- 3.856
66 D 0.639 4.860 +- 3.856
67 I 0.639 4.860 +- 3.856
68 H 0.639 4.860 +- 3.856
69 T 0.639 4.860 +- 3.856
70 A 0.639 4.860 +- 3.856
71 R 0.639 4.860 +- 3.856
72 P 0.639 4.860 +- 3.856
73 G 0.639 4.860 +- 3.856
74 I 0.639 4.860 +- 3.856
75 V 0.639 4.860 +- 3.856
76 I 0.639 4.860 +- 3.856
77 G 0.639 4.860 +- 3.856
78 R 0.639 4.860 +- 3.856
79 R 0.639 4.860 +- 3.856
80 G 0.639 4.860 +- 3.856
81 T 0.639 4.860 +- 3.856
82 E 0.639 4.860 +- 3.856
83 A 0.639 4.860 +- 3.856
84 D 0.639 4.860 +- 3.856
85 R 0.639 4.860 +- 3.856
86 I 0.639 4.860 +- 3.856
87 R 0.639 4.860 +- 3.856
88 A 0.639 4.860 +- 3.856
89 D 0.639 4.860 +- 3.856
90 L 0.639 4.860 +- 3.856
91 E 0.639 4.860 +- 3.856
92 K 0.639 4.860 +- 3.856
93 L 0.639 4.860 +- 3.856
94 T 0.639 4.860 +- 3.856
95 C 0.639 4.860 +- 3.856
96 K 0.639 4.860 +- 3.856
97 Q 0.639 4.860 +- 3.856
98 V 0.639 4.860 +- 3.856
99 Q 0.639 4.860 +- 3.856
100 L 0.639 4.860 +- 3.856
101 N 0.639 4.860 +- 3.856
102 I 0.639 4.860 +- 3.856
103 L 0.639 4.860 +- 3.856
104 E 0.639 4.860 +- 3.856
105 V 0.639 4.860 +- 3.856
106 K 0.639 4.860 +- 3.856
107 N 0.639 4.860 +- 3.856
108 P 0.639 4.860 +- 3.856
109 E 0.639 4.860 +- 3.856
110 S 0.639 4.860 +- 3.856
111 Q 0.639 4.860 +- 3.856
112 A 0.639 4.860 +- 3.856
113 Q 0.639 4.860 +- 3.856
114 L 0.639 4.860 +- 3.856
115 V 0.639 4.860 +- 3.856
116 A 0.639 4.860 +- 3.856
117 Q 0.639 4.860 +- 3.856
118 G 0.639 4.860 +- 3.856
119 V 0.639 4.860 +- 3.856
120 A 0.639 4.860 +- 3.856
121 E 0.639 4.860 +- 3.856
122 Q 0.639 4.860 +- 3.856
123 L 0.639 4.860 +- 3.856
124 S 0.639 4.860 +- 3.856
125 N 0.639 4.860 +- 3.856
126 R 0.639 4.860 +- 3.856
127 V 0.639 4.860 +- 3.856
128 A 0.639 4.860 +- 3.856
129 F 0.639 4.860 +- 3.856
130 R 0.639 4.860 +- 3.856
131 R 0.639 4.860 +- 3.856
132 A 0.639 4.860 +- 3.856
133 M 0.639 4.860 +- 3.856
134 R 0.639 4.860 +- 3.856
135 K 0.639 4.860 +- 3.856
136 A 0.639 4.860 +- 3.856
137 I 0.639 4.860 +- 3.856
138 Q 0.639 4.860 +- 3.856
139 S 0.639 4.860 +- 3.856
140 A 0.639 4.860 +- 3.856
141 M 0.639 4.860 +- 3.856
142 R 0.639 4.860 +- 3.856
143 Q 0.639 4.860 +- 3.856
144 P 0.639 4.860 +- 3.856
145 N 0.639 4.860 +- 3.856
146 V 0.639 4.860 +- 3.856
147 K 0.639 4.860 +- 3.856
148 G 0.639 4.860 +- 3.856
149 I 0.639 4.860 +- 3.856
150 R 0.639 4.860 +- 3.856
151 V 0.639 4.860 +- 3.856
152 Q 0.639 4.860 +- 3.856
153 C 0.639 4.860 +- 3.856
154 S 0.639 4.860 +- 3.856
155 G 0.639 4.860 +- 3.856
156 R 0.639 4.860 +- 3.856
157 L 0.639 4.860 +- 3.856
158 G 0.639 4.860 +- 3.856
159 G 0.639 4.860 +- 3.856
160 A 0.639 4.860 +- 3.856
161 E 0.639 4.860 +- 3.856
162 M 0.639 4.860 +- 3.856
163 S 0.639 4.860 +- 3.856
164 R 0.639 4.860 +- 3.856
165 S 0.639 4.860 +- 3.856
166 E 0.639 4.860 +- 3.856
167 F 0.639 4.860 +- 3.856
168 Y 0.639 4.860 +- 3.856
169 R 0.639 4.860 +- 3.856
170 E 0.639 4.860 +- 3.856
171 G 0.639 4.860 +- 3.856
172 R 0.639 4.860 +- 3.856
173 V 0.639 4.860 +- 3.856
174 P 0.639 4.860 +- 3.856
175 L 0.639 4.860 +- 3.856
176 H 0.639 4.860 +- 3.856
177 T 0.639 4.860 +- 3.856
178 L 0.639 4.860 +- 3.856
179 R 0.639 4.860 +- 3.856
180 A 0.639 4.860 +- 3.856
181 D 0.639 4.860 +- 3.856
182 I 0.639 4.860 +- 3.856
183 D 0.639 4.860 +- 3.856
184 Y 0.639 4.860 +- 3.856
185 G 0.639 4.860 +- 3.856
186 L 0.639 4.860 +- 3.856
187 H 0.639 4.860 +- 3.856
188 E 0.639 4.860 +- 3.856
189 A 0.639 4.860 +- 3.856
190 K 0.639 4.860 +- 3.856
191 T 0.639 4.860 +- 3.856
192 T 0.639 4.860 +- 3.856
193 F 0.639 4.860 +- 3.856
194 G 0.639 4.860 +- 3.856
195 R 0.639 4.860 +- 3.856
196 I 0.639 4.860 +- 3.856
197 G 0.639 4.860 +- 3.856
198 V 0.639 4.860 +- 3.856
199 K 0.639 4.860 +- 3.856
200 V 0.639 4.860 +- 3.856
201 W 0.639 4.860 +- 3.856
202 I 0.639 4.860 +- 3.856
203 Y 0.639 4.860 +- 3.856
204 K 0.639 4.860 +- 3.856
205 G 0.639 4.860 +- 3.856
206 D 0.639 4.860 +- 3.856
207 I 0.639 4.860 +- 3.856
208 V 0.639 4.860 +- 3.856
209 G 0.639 4.860 +- 3.856
210 G 0.639 4.860 +- 3.856
211 K 0.639 4.860 +- 3.856
212 R 0.639 4.860 +- 3.856
213 E 0.639 4.860 +- 3.856
214 V 0.639 4.860 +- 3.856
215 T 0.639 4.860 +- 3.856
216 A 0.639 4.860 +- 3.856
217 V 0.639 4.860 +- 3.856
218 A 0.639 4.860 +- 3.856
219 P 0.639 4.860 +- 3.856
220 A 0.639 4.860 +- 3.856
221 G 0.639 4.860 +- 3.856
222 A 0.639 4.860 +- 3.856
223 E 0.639 4.860 +- 3.856
224 R 0.639 4.860 +- 3.856
225 A 0.639 4.860 +- 3.856
226 R 0.639 4.860 +- 3.856
227 R 0.639 4.860 +- 3.856
228 E 0.639 4.860 +- 3.856
229 R 0.639 4.860 +- 3.856
230 P 0.639 4.860 +- 3.856
231 S 0.639 4.860 +- 3.856
232 G 0.639 4.860 +- 3.856
233 T 0.639 4.860 +- 3.856
234 R 0.639 4.860 +- 3.856
235 P 0.639 4.860 +- 3.856
236 R 0.639 4.860 +- 3.856
237 R 0.639 4.860 +- 3.856
238 S 0.639 4.860 +- 3.856
239 G 0.639 4.860 +- 3.856
240 A 0.639 4.860 +- 3.856
241 A 0.639 4.860 +- 3.856
242 G 0.639 4.860 +- 3.856
243 T 0.639 4.860 +- 3.856
244 T 0.639 4.860 +- 3.856
245 V 0.639 4.860 +- 3.856
246 T 0.639 4.860 +- 3.856
247 G 0.639 4.860 +- 3.856
248 T 0.639 4.860 +- 3.856
249 D 0.639 4.860 +- 3.856
250 A 0.639 4.860 +- 3.856
251 G 0.639 4.860 +- 3.856
252 R 0.639 4.860 +- 3.856
253 A 0.639 4.860 +- 3.856
254 V 0.639 4.860 +- 3.856
255 G 0.639 4.860 +- 3.856
256 G 0.639 4.860 +- 3.856
257 Q 0.923 6.858 +- 3.003
258 E 0.639 4.860 +- 3.856
259 S 0.639 4.860 +- 3.856
260 A 0.639 4.860 +- 3.856
261 A 0.639 4.860 +- 3.856
262 T 0.639 4.860 +- 3.856
263 N 0.639 4.860 +- 3.856
264 I 0.639 4.860 +- 3.856
265 G 0.639 4.860 +- 3.856
266 H 0.639 4.860 +- 3.856
267 S 0.639 4.860 +- 3.856
268 D 0.639 4.860 +- 3.856
269 D 0.639 4.860 +- 3.856
270 S 0.639 4.860 +- 3.856
271 V 0.639 4.860 +- 3.856
272 V 0.639 4.860 +- 3.856
273 T 0.639 4.860 +- 3.856
274 H 0.639 4.860 +- 3.856
275 E 0.639 4.860 +- 3.856
276 P 0.639 4.860 +- 3.856
277 Q 0.639 4.860 +- 3.856
278 I 0.639 4.860 +- 3.856
279 A 0.639 4.860 +- 3.856
280 E 0.639 4.860 +- 3.856
281 S 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:18
Model 1: NearlyNeutral -1109.359267 Model 2: PositiveSelection -1109.134317 Model 0: one-ratio -1109.134302 Model 7: beta -1109.381501 Model 8: beta&w>1 -1109.134314 Model 0 vs 1 0.4499300000002222 Model 2 vs 1 0.4499000000000706 Model 8 vs 7 0.4943740000003345
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
