--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:14:13 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1150.33         -1154.71
2      -1150.31         -1153.73
--------------------------------------
TOTAL    -1150.32         -1154.34
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.882559    0.091483    0.352579    1.513202    0.845531   1192.88   1345.45    1.000
r(A<->C){all}   0.164605    0.019435    0.000104    0.446475    0.128259     89.49    231.00    1.003
r(A<->G){all}   0.147622    0.018061    0.000018    0.427409    0.107436    214.08    257.94    1.009
r(A<->T){all}   0.161311    0.018203    0.000016    0.432762    0.128030    193.03    274.10    1.001
r(C<->G){all}   0.202551    0.025893    0.000060    0.528885    0.164689    100.52    160.63    1.006
r(C<->T){all}   0.167932    0.021000    0.000057    0.462488    0.129198    160.31    223.38    1.001
r(G<->T){all}   0.155980    0.017383    0.000096    0.426120    0.119891    192.69    196.18    1.000
pi(A){all}      0.199668    0.000182    0.174825    0.226775    0.199431   1293.26   1334.59    1.000
pi(C){all}      0.285945    0.000240    0.255358    0.315992    0.285735   1256.01   1353.37    1.000
pi(G){all}      0.345446    0.000270    0.312023    0.376636    0.344851   1292.84   1330.38    1.000
pi(T){all}      0.168942    0.000161    0.144041    0.193986    0.168539   1297.42   1348.92    1.001
alpha{1,2}      0.352095    0.168909    0.000143    1.199194    0.213214   1317.55   1398.45    1.000
alpha{3}        0.408469    0.223916    0.000122    1.351279    0.234926   1262.63   1371.63    1.000
pinvar{all}     0.996202    0.000010    0.989839    0.999969    0.997065   1240.35   1318.35    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1109.359267
Model 2: PositiveSelection	-1109.134317
Model 0: one-ratio	-1109.134302
Model 7: beta	-1109.381501
Model 8: beta&w>1	-1109.134314


Model 0 vs 1	0.4499300000002222

Model 2 vs 1	0.4499000000000706

Model 8 vs 7	0.4943740000003345
>C1
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGQESAATNIGHSDDSVVTHEPQIAES
>C2
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C3
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C4
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C5
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C6
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=281 

C1              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C2              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C3              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C4              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C5              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C6              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
                **************************************************

C1              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C2              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C3              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C4              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C5              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C6              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
                **************************************************

C1              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C2              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C3              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C4              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C5              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C6              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
                **************************************************

C1              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C2              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C3              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C4              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C5              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C6              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
                **************************************************

C1              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C2              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C3              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C4              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C5              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C6              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
                **************************************************

C1              GRAVGGQESAATNIGHSDDSVVTHEPQIAES
C2              GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C3              GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C4              GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C5              GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C6              GRAVGGEESAATNIGHSDDSVVTHEPQIAES
                ******:************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8430]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [8430]--->[8430]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.502 Mb, Max= 30.839 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C2              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C3              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C4              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C5              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
C6              VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
                **************************************************

C1              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C2              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C3              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C4              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C5              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
C6              IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
                **************************************************

C1              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C2              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C3              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C4              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C5              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
C6              NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
                **************************************************

C1              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C2              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C3              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C4              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C5              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
C6              VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
                **************************************************

C1              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C2              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C3              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C4              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C5              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
C6              WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
                **************************************************

C1              GRAVGGQESAATNIGHSDDSVVTHEPQIAES
C2              GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C3              GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C4              GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C5              GRAVGGEESAATNIGHSDDSVVTHEPQIAES
C6              GRAVGGEESAATNIGHSDDSVVTHEPQIAES
                ******:************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.64 C1	 C2	 99.64
TOP	    1    0	 99.64 C2	 C1	 99.64
BOT	    0    2	 99.64 C1	 C3	 99.64
TOP	    2    0	 99.64 C3	 C1	 99.64
BOT	    0    3	 99.64 C1	 C4	 99.64
TOP	    3    0	 99.64 C4	 C1	 99.64
BOT	    0    4	 99.64 C1	 C5	 99.64
TOP	    4    0	 99.64 C5	 C1	 99.64
BOT	    0    5	 99.64 C1	 C6	 99.64
TOP	    5    0	 99.64 C6	 C1	 99.64
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.64
AVG	 1	 C2	  *	 99.93
AVG	 2	 C3	  *	 99.93
AVG	 3	 C4	  *	 99.93
AVG	 4	 C5	  *	 99.93
AVG	 5	 C6	  *	 99.93
TOT	 TOT	  *	 99.88
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
C2              GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
C3              GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
C4              GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
C5              GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
C6              GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
                **************************************************

C1              CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
C2              CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
C3              CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
C4              CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
C5              CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
C6              CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
                **************************************************

C1              AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
C2              AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
C3              AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
C4              AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
C5              AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
C6              AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
                **************************************************

C1              ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
C2              ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
C3              ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
C4              ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
C5              ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
C6              ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
                **************************************************

C1              CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
C2              CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
C3              CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
C4              CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
C5              CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
C6              CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
                **************************************************

C1              ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
C2              ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
C3              ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
C4              ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
C5              ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
C6              ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
                **************************************************

C1              AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
C2              AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
C3              AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
C4              AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
C5              AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
C6              AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
                **************************************************

C1              AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
C2              AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
C3              AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
C4              AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
C5              AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
C6              AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
                **************************************************

C1              GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
C2              GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
C3              GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
C4              GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
C5              GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
C6              GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
                **************************************************

C1              GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
C2              GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
C3              GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
C4              GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
C5              GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
C6              GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
                **************************************************

C1              TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
C2              TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
C3              TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
C4              TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
C5              TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
C6              TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
                **************************************************

C1              ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
C2              ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
C3              ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
C4              ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
C5              ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
C6              ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
                **************************************************

C1              TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
C2              TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
C3              TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
C4              TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
C5              TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
C6              TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
                **************************************************

C1              CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
C2              CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
C3              CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
C4              CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
C5              CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
C6              CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
                **************************************************

C1              GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
C2              GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
C3              GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
C4              GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
C5              GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
C6              GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
                **************************************************

C1              GGACGGGCGGTGGGTGGCCAAGAAAGCGCTGCTACCAACATTGGGCACTC
C2              GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
C3              GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
C4              GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
C5              GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
C6              GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
                ****************** *******************************

C1              TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
C2              TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
C3              TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
C4              TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
C5              TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
C6              TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
                *******************************************



>C1
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCCAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C2
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C3
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C4
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C5
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C6
GTGGGCCAGAAGATTAATCCGCATGGCTTCCGGTTGGGTATCACCACCGG
CTGGAAGTCTCGTTGGTACGCCGACAAACAGTACGCCGAGTACGTCAAGG
AAGATGTCGCGATCCGGCGGCTGCTATCCACCGGCCTAGAGCGCGCGGGG
ATCGCCGACGTGGAGATTGAGCGCACCCGTGACCGGGTCAGGGTGGACAT
CCACACCGCCCGTCCCGGCATCGTCATTGGTCGTCGCGGTACCGAAGCCG
ACCGGATACGGGCAGATCTAGAGAAGTTGACCTGCAAGCAGGTTCAACTC
AATATCCTCGAAGTCAAAAACCCTGAGTCGCAAGCACAATTGGTGGCCCA
AGGGGTCGCTGAGCAGTTGAGCAATCGGGTGGCGTTCCGTCGGGCGATGC
GCAAGGCTATCCAGTCTGCGATGCGTCAACCTAACGTCAAGGGCATCAGG
GTGCAGTGCTCGGGCCGGCTTGGTGGCGCGGAGATGAGCCGCTCGGAGTT
TTACCGTGAGGGCCGCGTGCCGTTGCACACCTTGCGCGCTGATATCGACT
ACGGGTTACATGAGGCCAAGACTACCTTCGGCCGGATCGGCGTGAAGGTA
TGGATCTACAAGGGCGACATTGTCGGTGGCAAACGTGAAGTGACAGCCGT
CGCGCCGGCTGGTGCTGAGCGTGCGCGCCGCGAGCGGCCGTCGGGCACGC
GTCCGCGCCGCAGTGGCGCGGCGGGCACCACCGTAACTGGCACCGACGCT
GGACGGGCGGTGGGTGGCGAAGAAAGCGCTGCTACCAACATTGGGCACTC
TGACGACAGCGTGGTTACCCACGAACCGCAGATCGCGGAGAGC
>C1
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGQESAATNIGHSDDSVVTHEPQIAES
>C2
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C3
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C4
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C5
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES
>C6
VGQKINPHGFRLGITTGWKSRWYADKQYAEYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKV
WIYKGDIVGGKREVTAVAPAGAERARRERPSGTRPRRSGAAGTTVTGTDA
GRAVGGEESAATNIGHSDDSVVTHEPQIAES


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 843 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579792363
      Setting output file names to "/data/11res/rpsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1347553195
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0147934217
      Seed = 1934390529
      Swapseed = 1579792363
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 5 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1890.077276 -- -24.965149
         Chain 2 -- -1890.077276 -- -24.965149
         Chain 3 -- -1890.077276 -- -24.965149
         Chain 4 -- -1890.076923 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1890.077276 -- -24.965149
         Chain 2 -- -1890.075618 -- -24.965149
         Chain 3 -- -1890.075618 -- -24.965149
         Chain 4 -- -1890.077276 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1890.077] (-1890.077) (-1890.077) (-1890.077) * [-1890.077] (-1890.076) (-1890.076) (-1890.077) 
        500 -- (-1167.602) (-1154.728) [-1164.462] (-1167.051) * (-1190.540) (-1175.484) (-1160.307) [-1159.231] -- 0:00:00
       1000 -- (-1159.558) (-1153.922) [-1160.748] (-1155.274) * (-1170.730) (-1162.940) (-1164.055) [-1158.979] -- 0:00:00
       1500 -- (-1158.465) [-1155.110] (-1158.227) (-1158.655) * [-1155.649] (-1160.494) (-1156.873) (-1161.468) -- 0:00:00
       2000 -- (-1156.789) (-1153.977) (-1152.843) [-1157.183] * (-1154.148) [-1155.409] (-1161.880) (-1156.166) -- 0:00:00
       2500 -- [-1160.378] (-1152.818) (-1152.562) (-1161.039) * (-1163.983) [-1158.382] (-1166.146) (-1156.877) -- 0:00:00
       3000 -- (-1159.201) (-1159.969) (-1157.507) [-1155.192] * [-1156.313] (-1161.667) (-1156.516) (-1162.772) -- 0:00:00
       3500 -- [-1157.009] (-1158.110) (-1154.025) (-1156.231) * (-1155.386) [-1155.646] (-1154.626) (-1156.275) -- 0:00:00
       4000 -- (-1159.532) [-1155.625] (-1161.571) (-1160.096) * (-1154.052) (-1152.833) (-1159.134) [-1152.022] -- 0:00:00
       4500 -- [-1152.579] (-1160.072) (-1152.967) (-1152.799) * [-1154.107] (-1155.945) (-1152.625) (-1156.120) -- 0:00:00
       5000 -- [-1153.464] (-1156.473) (-1160.392) (-1153.963) * (-1156.871) (-1157.544) (-1156.192) [-1159.629] -- 0:00:00

      Average standard deviation of split frequencies: 0.116143

       5500 -- (-1165.790) (-1158.405) (-1151.741) [-1158.517] * [-1149.428] (-1155.287) (-1167.780) (-1157.306) -- 0:00:00
       6000 -- (-1158.854) (-1161.538) (-1156.312) [-1157.204] * [-1156.806] (-1155.872) (-1155.035) (-1160.122) -- 0:00:00
       6500 -- (-1158.671) [-1152.851] (-1161.059) (-1153.908) * (-1152.404) (-1152.848) (-1152.480) [-1153.873] -- 0:00:00
       7000 -- (-1167.980) (-1154.920) [-1154.113] (-1159.406) * [-1157.810] (-1150.035) (-1156.310) (-1152.290) -- 0:00:00
       7500 -- (-1161.626) (-1156.069) (-1163.282) [-1158.235] * (-1156.256) (-1158.079) [-1156.405] (-1162.600) -- 0:00:00
       8000 -- (-1152.839) (-1162.750) [-1158.252] (-1151.166) * (-1163.222) (-1160.541) [-1158.141] (-1157.543) -- 0:00:00
       8500 -- (-1151.949) (-1155.927) (-1159.807) [-1151.945] * (-1155.846) (-1152.699) (-1160.615) [-1152.790] -- 0:00:00
       9000 -- (-1168.519) [-1158.128] (-1161.556) (-1159.802) * [-1151.057] (-1160.791) (-1155.324) (-1159.874) -- 0:00:00
       9500 -- (-1160.528) [-1157.325] (-1148.636) (-1159.320) * [-1153.219] (-1166.029) (-1154.319) (-1167.834) -- 0:00:00
      10000 -- (-1152.014) [-1152.554] (-1149.257) (-1151.929) * (-1150.738) [-1150.741] (-1163.313) (-1155.842) -- 0:00:00

      Average standard deviation of split frequencies: 0.081759

      10500 -- (-1155.424) (-1157.894) (-1149.492) [-1157.001] * (-1157.892) [-1159.687] (-1157.482) (-1164.785) -- 0:00:00
      11000 -- (-1165.063) (-1157.459) [-1150.516] (-1158.438) * (-1153.930) (-1154.137) (-1157.709) [-1165.721] -- 0:00:00
      11500 -- (-1154.138) (-1157.843) (-1150.040) [-1156.442] * (-1154.787) (-1151.039) (-1160.080) [-1155.901] -- 0:00:00
      12000 -- (-1170.415) [-1159.291] (-1152.492) (-1159.552) * (-1163.405) (-1161.516) [-1155.906] (-1158.249) -- 0:00:00
      12500 -- (-1153.603) (-1163.493) [-1150.493] (-1159.555) * [-1160.218] (-1159.792) (-1157.878) (-1154.948) -- 0:00:00
      13000 -- (-1161.841) (-1161.060) (-1150.607) [-1153.489] * [-1156.294] (-1157.029) (-1153.587) (-1164.379) -- 0:00:00
      13500 -- (-1160.688) (-1157.353) (-1150.322) [-1155.279] * [-1154.101] (-1153.800) (-1159.778) (-1162.515) -- 0:00:00
      14000 -- [-1153.946] (-1158.668) (-1150.581) (-1160.048) * (-1154.063) (-1151.805) [-1153.434] (-1154.673) -- 0:01:10
      14500 -- [-1155.223] (-1162.744) (-1149.974) (-1156.558) * (-1160.458) (-1162.819) [-1156.312] (-1163.425) -- 0:01:07
      15000 -- (-1157.164) [-1157.986] (-1151.566) (-1156.113) * (-1160.010) (-1149.034) [-1156.505] (-1159.901) -- 0:01:05

      Average standard deviation of split frequencies: 0.060265

      15500 -- [-1160.694] (-1164.709) (-1152.004) (-1163.912) * (-1153.778) (-1150.136) [-1157.562] (-1152.402) -- 0:01:03
      16000 -- (-1163.447) [-1160.527] (-1152.170) (-1159.926) * (-1150.684) (-1152.332) [-1158.117] (-1162.332) -- 0:01:01
      16500 -- (-1155.276) [-1150.953] (-1151.572) (-1159.325) * (-1156.032) (-1150.378) (-1158.693) [-1158.144] -- 0:00:59
      17000 -- (-1164.732) [-1155.057] (-1151.060) (-1156.211) * (-1155.430) (-1151.235) [-1156.310] (-1153.608) -- 0:00:57
      17500 -- (-1155.205) (-1152.465) (-1152.347) [-1154.257] * (-1150.127) (-1149.423) (-1159.857) [-1158.752] -- 0:00:56
      18000 -- (-1154.219) (-1159.661) (-1153.501) [-1153.467] * (-1159.478) (-1153.031) (-1160.302) [-1149.873] -- 0:00:54
      18500 -- (-1159.056) [-1158.243] (-1150.855) (-1159.358) * [-1156.888] (-1158.965) (-1155.036) (-1155.548) -- 0:00:53
      19000 -- (-1161.087) [-1154.023] (-1153.310) (-1157.562) * (-1159.521) (-1152.401) [-1155.485] (-1155.520) -- 0:00:51
      19500 -- [-1153.857] (-1155.068) (-1152.833) (-1153.648) * (-1159.239) (-1149.926) [-1158.089] (-1163.611) -- 0:00:50
      20000 -- (-1163.290) (-1162.785) (-1151.378) [-1157.212] * (-1154.890) (-1156.777) (-1157.993) [-1157.507] -- 0:00:49

      Average standard deviation of split frequencies: 0.064628

      20500 -- (-1153.824) (-1161.278) [-1150.204] (-1158.502) * [-1162.418] (-1152.882) (-1161.205) (-1151.189) -- 0:00:47
      21000 -- (-1158.082) (-1149.407) [-1150.827] (-1163.354) * [-1156.193] (-1151.842) (-1155.039) (-1150.848) -- 0:00:46
      21500 -- (-1160.010) [-1152.659] (-1155.307) (-1153.039) * [-1155.576] (-1149.578) (-1154.480) (-1155.041) -- 0:00:45
      22000 -- (-1160.598) (-1159.004) [-1149.932] (-1158.831) * [-1155.681] (-1149.747) (-1164.197) (-1155.410) -- 0:00:44
      22500 -- (-1156.748) [-1156.639] (-1153.433) (-1157.749) * [-1152.398] (-1151.863) (-1150.246) (-1151.271) -- 0:00:43
      23000 -- (-1158.244) [-1155.475] (-1151.021) (-1153.626) * [-1156.941] (-1156.811) (-1150.529) (-1153.740) -- 0:00:42
      23500 -- [-1153.693] (-1160.885) (-1150.744) (-1153.800) * [-1155.998] (-1153.464) (-1151.113) (-1151.094) -- 0:00:41
      24000 -- [-1156.399] (-1156.051) (-1151.166) (-1155.162) * (-1154.988) (-1153.365) [-1151.511] (-1152.335) -- 0:00:40
      24500 -- (-1155.478) [-1152.575] (-1151.287) (-1157.766) * [-1154.109] (-1156.093) (-1150.371) (-1151.886) -- 0:00:39
      25000 -- [-1154.380] (-1155.132) (-1152.050) (-1153.986) * (-1148.935) (-1151.181) [-1150.992] (-1150.146) -- 0:00:39

      Average standard deviation of split frequencies: 0.043357

      25500 -- (-1152.319) (-1153.150) (-1151.060) [-1159.771] * (-1152.030) (-1151.810) [-1148.880] (-1151.719) -- 0:00:38
      26000 -- [-1154.429] (-1159.609) (-1151.782) (-1154.604) * (-1159.901) [-1150.473] (-1149.258) (-1150.342) -- 0:00:37
      26500 -- (-1152.376) (-1158.402) (-1151.135) [-1157.417] * [-1153.493] (-1150.729) (-1154.877) (-1154.110) -- 0:00:36
      27000 -- (-1164.790) (-1157.733) [-1151.131] (-1163.467) * [-1155.951] (-1149.896) (-1151.308) (-1151.030) -- 0:00:36
      27500 -- [-1154.483] (-1156.780) (-1151.591) (-1154.421) * [-1149.070] (-1154.949) (-1156.277) (-1150.414) -- 0:00:35
      28000 -- [-1156.735] (-1157.342) (-1155.195) (-1156.927) * (-1158.024) (-1155.133) (-1151.561) [-1151.581] -- 0:00:34
      28500 -- (-1152.514) (-1153.273) (-1151.192) [-1158.934] * (-1163.665) (-1154.282) [-1150.320] (-1150.602) -- 0:01:08
      29000 -- (-1162.938) (-1153.281) [-1151.027] (-1159.059) * (-1163.170) (-1155.921) [-1150.656] (-1152.851) -- 0:01:06
      29500 -- (-1160.371) (-1154.615) [-1150.539] (-1162.237) * [-1154.954] (-1152.802) (-1154.040) (-1150.970) -- 0:01:05
      30000 -- [-1154.548] (-1152.955) (-1150.462) (-1155.110) * (-1156.167) (-1152.175) (-1151.948) [-1150.820] -- 0:01:04

      Average standard deviation of split frequencies: 0.038796

      30500 -- [-1154.731] (-1155.823) (-1151.146) (-1161.460) * (-1155.958) [-1155.200] (-1152.876) (-1150.929) -- 0:01:03
      31000 -- [-1155.430] (-1151.029) (-1149.173) (-1158.264) * (-1158.869) (-1150.605) (-1154.239) [-1150.599] -- 0:01:02
      31500 -- [-1154.263] (-1159.499) (-1150.861) (-1159.243) * [-1154.299] (-1151.415) (-1150.771) (-1150.901) -- 0:01:01
      32000 -- [-1157.229] (-1150.099) (-1152.138) (-1165.191) * (-1158.925) [-1150.885] (-1155.593) (-1152.516) -- 0:01:00
      32500 -- (-1156.743) [-1151.469] (-1151.492) (-1160.193) * [-1155.569] (-1150.964) (-1154.654) (-1150.932) -- 0:00:59
      33000 -- (-1154.101) (-1152.969) [-1150.608] (-1156.566) * [-1152.898] (-1155.417) (-1153.685) (-1150.887) -- 0:00:58
      33500 -- (-1155.286) (-1152.202) (-1151.207) [-1156.575] * [-1153.208] (-1151.243) (-1150.196) (-1149.460) -- 0:00:57
      34000 -- (-1164.366) [-1148.762] (-1151.558) (-1152.713) * (-1153.756) [-1152.555] (-1150.639) (-1151.871) -- 0:00:56
      34500 -- [-1152.588] (-1150.168) (-1150.566) (-1157.461) * (-1149.877) [-1150.547] (-1150.496) (-1150.285) -- 0:00:55
      35000 -- [-1155.898] (-1151.295) (-1155.536) (-1154.312) * [-1156.478] (-1149.888) (-1151.066) (-1149.889) -- 0:00:55

      Average standard deviation of split frequencies: 0.034701

      35500 -- (-1157.603) [-1152.432] (-1154.509) (-1155.778) * [-1153.086] (-1150.531) (-1153.625) (-1149.699) -- 0:00:54
      36000 -- (-1155.494) (-1150.588) (-1151.152) [-1159.075] * [-1156.601] (-1150.634) (-1154.319) (-1154.015) -- 0:00:53
      36500 -- (-1156.899) (-1153.857) [-1150.495] (-1153.417) * (-1151.765) (-1151.049) (-1154.936) [-1149.649] -- 0:00:52
      37000 -- [-1154.256] (-1151.732) (-1150.979) (-1159.985) * [-1157.281] (-1151.072) (-1156.129) (-1150.753) -- 0:00:52
      37500 -- (-1155.074) (-1153.719) [-1151.064] (-1152.516) * [-1155.704] (-1150.993) (-1159.770) (-1150.644) -- 0:00:51
      38000 -- (-1154.286) (-1151.505) (-1153.088) [-1157.577] * (-1152.497) [-1150.972] (-1152.075) (-1151.451) -- 0:00:50
      38500 -- (-1159.369) (-1152.365) [-1150.779] (-1157.726) * (-1161.970) (-1151.805) (-1147.932) [-1154.197] -- 0:00:49
      39000 -- [-1156.617] (-1150.526) (-1151.506) (-1162.450) * (-1172.991) (-1150.826) [-1148.778] (-1150.902) -- 0:00:49
      39500 -- (-1156.877) [-1152.177] (-1151.128) (-1159.579) * (-1152.484) (-1150.566) [-1152.307] (-1151.081) -- 0:00:48
      40000 -- (-1156.728) (-1152.625) (-1151.211) [-1158.156] * (-1150.960) [-1150.213] (-1150.930) (-1151.777) -- 0:00:48

      Average standard deviation of split frequencies: 0.027241

      40500 -- (-1162.224) (-1152.425) (-1153.504) [-1152.343] * [-1149.612] (-1153.180) (-1150.065) (-1150.049) -- 0:00:47
      41000 -- [-1153.900] (-1152.925) (-1154.175) (-1159.183) * (-1148.887) (-1153.525) [-1149.188] (-1153.360) -- 0:00:46
      41500 -- (-1152.772) [-1150.807] (-1151.655) (-1157.749) * (-1150.635) (-1151.049) [-1150.996] (-1151.817) -- 0:00:46
      42000 -- (-1153.025) (-1152.523) [-1150.621] (-1152.114) * (-1152.563) (-1149.471) [-1150.893] (-1152.501) -- 0:00:45
      42500 -- [-1151.661] (-1151.972) (-1150.341) (-1158.906) * (-1153.603) [-1147.773] (-1154.990) (-1152.273) -- 0:00:45
      43000 -- [-1164.206] (-1153.946) (-1153.279) (-1153.327) * (-1151.502) (-1149.646) (-1154.295) [-1154.984] -- 0:00:44
      43500 -- [-1162.822] (-1152.073) (-1151.484) (-1157.505) * (-1150.960) (-1150.474) (-1151.457) [-1150.260] -- 0:01:05
      44000 -- (-1160.737) (-1150.261) (-1152.234) [-1153.154] * (-1150.303) (-1148.228) [-1150.546] (-1153.266) -- 0:01:05
      44500 -- (-1162.429) (-1151.393) (-1152.576) [-1152.591] * [-1150.142] (-1149.011) (-1149.125) (-1153.642) -- 0:01:04
      45000 -- (-1153.454) [-1149.769] (-1149.516) (-1155.491) * (-1152.232) [-1149.527] (-1156.540) (-1151.933) -- 0:01:03

      Average standard deviation of split frequencies: 0.026645

      45500 -- (-1163.952) [-1149.179] (-1151.102) (-1158.125) * (-1154.538) (-1150.718) (-1157.089) [-1152.339] -- 0:01:02
      46000 -- (-1157.899) (-1150.322) [-1151.262] (-1160.928) * (-1151.509) (-1150.353) (-1149.409) [-1151.759] -- 0:01:02
      46500 -- [-1157.173] (-1149.538) (-1151.182) (-1157.351) * (-1154.276) [-1151.009] (-1151.412) (-1151.207) -- 0:01:01
      47000 -- [-1155.268] (-1151.745) (-1152.563) (-1154.732) * (-1155.210) [-1150.543] (-1150.186) (-1152.288) -- 0:01:00
      47500 -- [-1149.772] (-1148.801) (-1151.579) (-1157.414) * [-1152.749] (-1153.148) (-1151.324) (-1152.391) -- 0:01:00
      48000 -- (-1153.747) (-1150.476) [-1152.361] (-1156.209) * (-1152.216) (-1153.565) (-1152.205) [-1154.558] -- 0:00:59
      48500 -- (-1165.383) (-1153.130) (-1150.725) [-1158.711] * (-1151.196) [-1151.192] (-1152.459) (-1149.251) -- 0:00:58
      49000 -- (-1159.357) (-1150.835) (-1150.726) [-1164.152] * (-1150.831) [-1149.059] (-1151.404) (-1150.192) -- 0:00:58
      49500 -- (-1156.921) (-1155.698) [-1151.319] (-1161.880) * (-1151.092) [-1149.613] (-1150.169) (-1150.682) -- 0:00:57
      50000 -- [-1150.112] (-1152.605) (-1151.464) (-1159.825) * (-1156.581) [-1149.989] (-1150.868) (-1154.656) -- 0:00:57

      Average standard deviation of split frequencies: 0.027912

      50500 -- [-1154.740] (-1152.670) (-1151.123) (-1149.882) * [-1152.994] (-1150.485) (-1150.390) (-1151.912) -- 0:00:56
      51000 -- (-1159.105) [-1151.947] (-1150.247) (-1150.710) * (-1151.473) [-1150.347] (-1152.597) (-1149.492) -- 0:00:55
      51500 -- (-1158.618) (-1150.827) (-1153.001) [-1152.148] * (-1151.027) (-1151.348) (-1152.590) [-1151.244] -- 0:00:55
      52000 -- (-1159.171) [-1152.516] (-1151.803) (-1152.013) * (-1153.569) (-1149.585) [-1151.207] (-1151.268) -- 0:00:54
      52500 -- (-1151.555) [-1152.933] (-1151.950) (-1155.384) * (-1154.358) [-1150.104] (-1150.791) (-1151.033) -- 0:00:54
      53000 -- (-1166.936) (-1154.098) (-1152.161) [-1150.631] * (-1153.415) (-1151.658) [-1150.726] (-1151.555) -- 0:00:53
      53500 -- [-1154.252] (-1156.805) (-1152.484) (-1151.650) * (-1153.932) (-1152.074) [-1150.017] (-1151.988) -- 0:00:53
      54000 -- [-1153.455] (-1152.102) (-1151.543) (-1154.097) * (-1158.894) (-1152.329) (-1153.476) [-1154.742] -- 0:00:52
      54500 -- (-1155.072) (-1152.365) (-1153.271) [-1155.027] * [-1152.292] (-1153.037) (-1151.970) (-1151.730) -- 0:00:52
      55000 -- [-1155.410] (-1151.729) (-1153.440) (-1156.644) * (-1151.356) (-1152.214) [-1152.354] (-1151.930) -- 0:00:51

      Average standard deviation of split frequencies: 0.032068

      55500 -- [-1158.747] (-1151.195) (-1155.347) (-1158.330) * (-1149.874) (-1156.644) [-1152.450] (-1150.674) -- 0:00:51
      56000 -- [-1155.454] (-1149.661) (-1152.824) (-1161.120) * [-1149.252] (-1155.942) (-1152.173) (-1151.162) -- 0:00:50
      56500 -- [-1153.208] (-1148.677) (-1151.569) (-1150.529) * (-1148.541) (-1154.608) [-1152.747] (-1150.123) -- 0:00:50
      57000 -- (-1150.971) [-1150.742] (-1153.782) (-1155.319) * (-1151.912) [-1150.801] (-1157.495) (-1154.815) -- 0:00:49
      57500 -- (-1155.323) [-1150.188] (-1151.890) (-1152.695) * (-1152.328) [-1150.795] (-1157.025) (-1151.661) -- 0:00:49
      58000 -- [-1153.661] (-1150.295) (-1153.191) (-1150.218) * [-1150.767] (-1150.209) (-1151.181) (-1152.196) -- 0:00:48
      58500 -- (-1155.725) (-1150.441) (-1150.144) [-1150.981] * (-1149.195) (-1149.956) (-1157.235) [-1149.468] -- 0:01:04
      59000 -- (-1159.786) (-1150.669) [-1150.296] (-1152.677) * (-1149.215) (-1152.102) (-1151.956) [-1149.453] -- 0:01:03
      59500 -- (-1164.101) (-1149.973) [-1150.827] (-1153.047) * (-1151.789) (-1151.485) (-1152.876) [-1150.558] -- 0:01:03
      60000 -- (-1158.108) [-1150.952] (-1154.681) (-1152.467) * (-1150.726) (-1150.626) (-1150.544) [-1150.652] -- 0:01:02

      Average standard deviation of split frequencies: 0.028491

      60500 -- [-1156.798] (-1150.384) (-1150.044) (-1150.521) * (-1150.831) (-1149.408) (-1149.592) [-1155.022] -- 0:01:02
      61000 -- (-1159.193) [-1148.949] (-1151.073) (-1152.234) * (-1150.806) (-1153.620) [-1149.213] (-1154.130) -- 0:01:01
      61500 -- [-1154.784] (-1149.989) (-1150.157) (-1152.387) * (-1149.616) (-1150.449) (-1151.484) [-1151.837] -- 0:01:01
      62000 -- (-1157.425) [-1148.721] (-1152.222) (-1150.645) * (-1148.831) [-1151.313] (-1151.207) (-1152.949) -- 0:01:00
      62500 -- (-1155.710) (-1152.142) [-1148.871] (-1151.129) * (-1148.060) (-1148.446) [-1152.246] (-1152.008) -- 0:01:00
      63000 -- (-1163.638) [-1150.621] (-1149.110) (-1152.665) * (-1148.670) (-1150.954) [-1150.139] (-1149.978) -- 0:00:59
      63500 -- (-1157.366) (-1151.085) [-1150.836] (-1150.328) * [-1150.140] (-1151.197) (-1151.821) (-1152.635) -- 0:00:58
      64000 -- [-1153.042] (-1148.341) (-1149.209) (-1153.254) * (-1155.255) [-1155.214] (-1151.069) (-1149.745) -- 0:00:58
      64500 -- (-1156.248) [-1151.653] (-1149.032) (-1152.988) * (-1156.939) [-1148.398] (-1149.008) (-1149.754) -- 0:00:58
      65000 -- (-1151.280) [-1153.209] (-1149.991) (-1153.099) * (-1148.935) [-1150.189] (-1154.920) (-1148.541) -- 0:00:57

      Average standard deviation of split frequencies: 0.024059

      65500 -- [-1154.446] (-1151.610) (-1154.120) (-1151.089) * (-1149.481) [-1150.666] (-1151.750) (-1150.931) -- 0:00:57
      66000 -- [-1154.211] (-1156.911) (-1152.667) (-1152.070) * [-1151.150] (-1149.140) (-1152.570) (-1152.016) -- 0:00:56
      66500 -- (-1162.747) (-1151.234) (-1152.717) [-1153.190] * (-1154.744) (-1150.235) [-1157.068] (-1150.717) -- 0:00:56
      67000 -- [-1154.884] (-1150.950) (-1150.772) (-1150.307) * [-1151.087] (-1150.114) (-1150.642) (-1150.649) -- 0:00:55
      67500 -- (-1163.017) [-1149.821] (-1151.357) (-1152.081) * [-1149.929] (-1149.314) (-1153.445) (-1150.468) -- 0:00:55
      68000 -- [-1151.079] (-1151.025) (-1151.224) (-1152.499) * [-1150.129] (-1148.804) (-1153.389) (-1149.764) -- 0:00:54
      68500 -- (-1152.742) [-1153.773] (-1153.999) (-1152.667) * (-1151.710) (-1149.874) [-1153.859] (-1150.057) -- 0:00:54
      69000 -- [-1150.631] (-1150.506) (-1151.092) (-1154.718) * [-1153.678] (-1151.746) (-1150.756) (-1149.954) -- 0:00:53
      69500 -- (-1149.826) (-1149.634) (-1152.077) [-1154.358] * (-1150.365) (-1152.742) [-1150.045] (-1152.085) -- 0:00:53
      70000 -- (-1150.298) [-1149.820] (-1151.531) (-1156.998) * (-1152.731) (-1153.989) [-1153.140] (-1152.561) -- 0:00:53

      Average standard deviation of split frequencies: 0.022681

      70500 -- [-1150.405] (-1153.341) (-1148.481) (-1155.132) * (-1155.556) (-1151.880) [-1154.728] (-1152.565) -- 0:00:52
      71000 -- (-1152.224) (-1150.864) [-1151.020] (-1157.169) * (-1150.635) [-1153.145] (-1155.162) (-1154.556) -- 0:00:52
      71500 -- (-1151.554) (-1156.692) (-1153.383) [-1153.565] * (-1150.178) [-1151.028] (-1153.775) (-1151.916) -- 0:00:51
      72000 -- (-1156.050) (-1161.988) (-1152.363) [-1153.718] * [-1150.193] (-1149.726) (-1152.036) (-1152.986) -- 0:00:51
      72500 -- [-1154.157] (-1154.012) (-1151.686) (-1150.596) * (-1149.220) (-1152.937) [-1150.429] (-1152.303) -- 0:00:51
      73000 -- (-1150.610) (-1154.958) (-1152.129) [-1150.362] * (-1153.745) [-1149.403] (-1150.046) (-1151.570) -- 0:00:50
      73500 -- (-1150.861) (-1152.487) (-1150.370) [-1153.630] * (-1152.530) (-1151.371) [-1151.208] (-1150.661) -- 0:00:50
      74000 -- (-1152.412) [-1149.404] (-1149.085) (-1150.180) * (-1152.286) [-1152.061] (-1154.903) (-1149.861) -- 0:01:02
      74500 -- (-1151.227) (-1148.933) (-1151.693) [-1150.946] * (-1151.309) (-1155.010) (-1156.093) [-1151.174] -- 0:01:02
      75000 -- (-1151.297) (-1151.085) [-1152.679] (-1151.070) * (-1152.219) [-1151.075] (-1151.982) (-1151.617) -- 0:01:01

      Average standard deviation of split frequencies: 0.023088

      75500 -- (-1149.423) (-1151.317) [-1151.703] (-1153.241) * [-1151.527] (-1150.636) (-1150.860) (-1151.151) -- 0:01:01
      76000 -- (-1151.698) (-1150.819) [-1151.664] (-1156.452) * (-1149.373) [-1151.287] (-1152.125) (-1150.514) -- 0:01:00
      76500 -- [-1150.446] (-1153.393) (-1150.355) (-1154.000) * (-1149.990) [-1151.537] (-1151.266) (-1149.369) -- 0:01:00
      77000 -- [-1149.018] (-1153.375) (-1150.322) (-1155.268) * (-1148.749) [-1152.471] (-1150.617) (-1149.157) -- 0:00:59
      77500 -- (-1149.741) [-1152.391] (-1150.123) (-1153.102) * (-1152.280) (-1150.662) (-1152.016) [-1150.238] -- 0:00:59
      78000 -- [-1151.817] (-1152.209) (-1151.994) (-1151.982) * (-1152.460) (-1149.701) (-1151.115) [-1150.980] -- 0:00:59
      78500 -- (-1151.183) (-1152.143) (-1150.356) [-1151.810] * (-1152.678) (-1150.238) [-1151.251] (-1150.584) -- 0:00:58
      79000 -- (-1150.017) (-1149.717) (-1150.705) [-1149.259] * (-1150.240) (-1149.692) (-1152.909) [-1151.609] -- 0:00:58
      79500 -- (-1151.973) [-1150.619] (-1152.217) (-1153.065) * (-1150.879) (-1149.932) [-1151.638] (-1152.379) -- 0:00:57
      80000 -- (-1155.857) [-1150.751] (-1150.606) (-1153.432) * (-1157.236) [-1152.795] (-1151.272) (-1153.139) -- 0:00:57

      Average standard deviation of split frequencies: 0.025221

      80500 -- [-1152.242] (-1153.093) (-1153.552) (-1151.142) * (-1149.903) (-1152.896) [-1152.619] (-1153.183) -- 0:00:57
      81000 -- (-1151.817) (-1151.173) [-1153.179] (-1152.373) * (-1151.468) (-1151.147) (-1154.284) [-1149.753] -- 0:00:56
      81500 -- [-1152.669] (-1152.357) (-1151.281) (-1153.689) * [-1152.118] (-1154.040) (-1150.694) (-1151.256) -- 0:00:56
      82000 -- (-1152.993) (-1153.543) [-1154.133] (-1154.675) * [-1152.119] (-1153.078) (-1150.924) (-1151.371) -- 0:00:55
      82500 -- (-1151.153) [-1151.248] (-1150.284) (-1153.225) * (-1151.353) [-1150.150] (-1150.600) (-1150.592) -- 0:00:55
      83000 -- [-1150.905] (-1153.507) (-1151.467) (-1150.408) * (-1150.878) (-1149.714) [-1149.372] (-1151.493) -- 0:00:55
      83500 -- [-1149.997] (-1152.841) (-1149.129) (-1150.139) * [-1152.257] (-1149.731) (-1151.148) (-1151.066) -- 0:00:54
      84000 -- (-1151.118) (-1152.741) [-1151.094] (-1152.019) * (-1151.887) (-1149.979) (-1153.299) [-1152.333] -- 0:00:54
      84500 -- (-1150.389) [-1152.339] (-1149.234) (-1150.769) * (-1151.665) (-1150.887) (-1149.824) [-1150.327] -- 0:00:54
      85000 -- (-1149.603) [-1150.338] (-1150.774) (-1150.506) * [-1153.566] (-1150.772) (-1150.594) (-1151.187) -- 0:00:53

      Average standard deviation of split frequencies: 0.020621

      85500 -- (-1149.576) [-1150.696] (-1151.480) (-1152.860) * [-1153.842] (-1152.778) (-1149.669) (-1151.148) -- 0:00:53
      86000 -- [-1151.401] (-1152.966) (-1150.187) (-1152.479) * [-1151.026] (-1149.875) (-1154.799) (-1150.509) -- 0:00:53
      86500 -- [-1150.542] (-1151.176) (-1152.229) (-1150.712) * [-1150.120] (-1151.154) (-1152.469) (-1150.529) -- 0:00:52
      87000 -- (-1150.451) (-1151.509) (-1150.668) [-1150.220] * [-1149.516] (-1149.039) (-1151.283) (-1153.612) -- 0:00:52
      87500 -- (-1151.048) (-1150.773) [-1149.871] (-1155.882) * (-1150.946) (-1153.153) (-1152.180) [-1153.402] -- 0:00:52
      88000 -- (-1152.161) [-1151.402] (-1158.712) (-1155.245) * (-1150.882) [-1150.267] (-1153.463) (-1151.420) -- 0:00:51
      88500 -- (-1150.023) (-1153.777) [-1153.759] (-1154.051) * (-1152.712) [-1150.733] (-1150.318) (-1151.122) -- 0:00:51
      89000 -- (-1150.982) (-1151.487) [-1149.750] (-1150.925) * (-1152.342) [-1149.249] (-1153.586) (-1154.300) -- 0:01:01
      89500 -- (-1153.704) [-1151.904] (-1151.735) (-1150.794) * [-1150.471] (-1153.383) (-1153.227) (-1152.932) -- 0:01:01
      90000 -- (-1152.781) (-1150.392) (-1150.818) [-1149.591] * (-1149.746) (-1152.206) (-1154.370) [-1150.856] -- 0:01:00

      Average standard deviation of split frequencies: 0.021345

      90500 -- (-1150.794) (-1150.679) [-1148.537] (-1152.549) * (-1153.645) (-1150.993) [-1151.327] (-1150.470) -- 0:01:00
      91000 -- (-1150.086) [-1151.245] (-1150.483) (-1152.583) * (-1154.448) [-1148.594] (-1151.272) (-1151.912) -- 0:00:59
      91500 -- (-1150.308) [-1151.315] (-1148.804) (-1154.319) * (-1151.429) (-1150.349) [-1149.929] (-1151.789) -- 0:00:59
      92000 -- (-1152.001) [-1148.871] (-1149.584) (-1150.690) * [-1149.731] (-1150.137) (-1149.929) (-1150.413) -- 0:00:59
      92500 -- [-1153.795] (-1155.830) (-1151.963) (-1151.170) * [-1152.904] (-1152.108) (-1153.153) (-1152.258) -- 0:00:58
      93000 -- (-1151.966) [-1151.278] (-1151.018) (-1149.840) * (-1151.937) [-1149.692] (-1151.869) (-1153.056) -- 0:00:58
      93500 -- (-1154.990) (-1152.370) [-1152.262] (-1150.483) * [-1151.315] (-1150.540) (-1150.423) (-1148.649) -- 0:00:58
      94000 -- [-1152.938] (-1152.659) (-1152.989) (-1155.565) * [-1153.577] (-1150.589) (-1150.198) (-1149.017) -- 0:00:57
      94500 -- (-1151.837) [-1150.078] (-1150.238) (-1151.340) * [-1154.081] (-1150.631) (-1149.476) (-1149.988) -- 0:00:57
      95000 -- (-1157.125) (-1151.184) [-1153.757] (-1150.791) * (-1148.765) [-1152.767] (-1150.317) (-1151.532) -- 0:00:57

      Average standard deviation of split frequencies: 0.022097

      95500 -- [-1154.049] (-1151.250) (-1149.824) (-1151.305) * (-1148.371) (-1151.354) (-1150.609) [-1153.146] -- 0:00:56
      96000 -- (-1152.944) [-1151.214] (-1152.200) (-1150.555) * (-1149.653) (-1149.716) [-1151.159] (-1149.813) -- 0:00:56
      96500 -- (-1149.738) (-1149.872) (-1151.414) [-1157.802] * (-1150.599) (-1148.820) (-1156.485) [-1151.001] -- 0:00:56
      97000 -- (-1150.655) [-1151.644] (-1151.436) (-1154.506) * (-1151.703) (-1152.133) [-1150.863] (-1151.112) -- 0:00:55
      97500 -- (-1149.882) (-1150.110) [-1152.169] (-1153.793) * (-1156.062) (-1150.690) [-1151.130] (-1151.355) -- 0:00:55
      98000 -- (-1152.303) [-1149.229] (-1149.291) (-1153.774) * [-1151.287] (-1155.514) (-1150.630) (-1153.575) -- 0:00:55
      98500 -- (-1152.011) (-1149.577) [-1150.443] (-1151.110) * [-1151.347] (-1152.925) (-1148.872) (-1157.166) -- 0:00:54
      99000 -- (-1152.207) (-1150.779) [-1149.589] (-1150.210) * [-1153.847] (-1151.746) (-1150.015) (-1151.158) -- 0:00:54
      99500 -- (-1151.733) [-1151.018] (-1152.219) (-1151.637) * (-1152.550) [-1155.307] (-1153.127) (-1151.115) -- 0:00:54
      100000 -- (-1151.255) [-1151.999] (-1151.395) (-1151.674) * (-1150.138) [-1154.669] (-1151.825) (-1150.206) -- 0:00:54

      Average standard deviation of split frequencies: 0.021593

      100500 -- (-1151.210) (-1150.723) [-1149.801] (-1150.022) * (-1152.583) (-1150.259) (-1151.034) [-1149.929] -- 0:00:53
      101000 -- (-1151.070) [-1150.270] (-1151.413) (-1151.245) * (-1151.170) (-1150.633) [-1150.813] (-1148.956) -- 0:00:53
      101500 -- (-1151.503) (-1150.795) [-1151.054] (-1151.207) * (-1151.700) (-1149.844) [-1152.422] (-1152.146) -- 0:00:53
      102000 -- [-1152.425] (-1150.091) (-1150.626) (-1150.914) * [-1150.812] (-1151.351) (-1152.822) (-1152.011) -- 0:00:52
      102500 -- (-1153.789) (-1153.205) [-1150.553] (-1149.919) * [-1150.754] (-1153.345) (-1150.056) (-1153.783) -- 0:00:52
      103000 -- (-1152.483) (-1151.229) [-1153.709] (-1152.581) * [-1150.585] (-1151.869) (-1151.822) (-1153.981) -- 0:00:52
      103500 -- [-1152.368] (-1151.600) (-1150.013) (-1151.149) * (-1151.201) (-1153.050) [-1151.415] (-1153.556) -- 0:01:00
      104000 -- (-1149.690) (-1151.431) (-1153.304) [-1151.610] * (-1151.193) (-1152.232) (-1149.631) [-1149.873] -- 0:01:00
      104500 -- [-1150.692] (-1150.617) (-1151.026) (-1150.583) * [-1152.194] (-1151.512) (-1150.349) (-1152.938) -- 0:00:59
      105000 -- [-1149.835] (-1150.966) (-1152.613) (-1150.192) * (-1152.046) [-1151.657] (-1151.287) (-1151.614) -- 0:00:59

      Average standard deviation of split frequencies: 0.021742

      105500 -- (-1150.880) (-1151.026) (-1154.544) [-1151.584] * (-1149.418) (-1152.747) [-1149.778] (-1153.514) -- 0:00:59
      106000 -- (-1151.372) (-1150.259) (-1151.153) [-1149.091] * (-1153.422) (-1156.625) [-1151.745] (-1153.187) -- 0:00:59
      106500 -- (-1151.590) (-1154.625) [-1151.272] (-1149.842) * [-1152.947] (-1152.369) (-1151.438) (-1152.245) -- 0:00:58
      107000 -- (-1150.084) (-1149.135) (-1151.230) [-1150.385] * (-1151.917) [-1150.473] (-1154.084) (-1151.039) -- 0:00:58
      107500 -- (-1152.474) (-1151.041) [-1149.891] (-1154.762) * (-1150.899) [-1151.249] (-1158.052) (-1150.359) -- 0:00:58
      108000 -- (-1150.678) [-1152.203] (-1151.361) (-1149.890) * (-1150.549) (-1151.765) [-1151.078] (-1151.492) -- 0:00:57
      108500 -- (-1151.311) [-1149.903] (-1150.977) (-1149.452) * (-1151.413) (-1156.243) (-1149.404) [-1152.327] -- 0:00:57
      109000 -- (-1150.974) (-1149.101) [-1149.709] (-1149.992) * [-1152.552] (-1152.492) (-1150.538) (-1149.147) -- 0:00:57
      109500 -- (-1151.359) (-1150.692) (-1151.340) [-1149.173] * (-1150.554) (-1150.004) [-1150.725] (-1153.842) -- 0:00:56
      110000 -- (-1151.561) (-1153.981) [-1150.189] (-1153.416) * (-1150.910) [-1150.884] (-1149.613) (-1153.874) -- 0:00:56

      Average standard deviation of split frequencies: 0.017711

      110500 -- (-1151.695) (-1151.384) [-1152.355] (-1150.669) * (-1150.016) (-1153.479) [-1149.491] (-1150.818) -- 0:00:56
      111000 -- (-1151.441) [-1147.991] (-1150.397) (-1150.340) * [-1153.178] (-1153.110) (-1151.217) (-1149.441) -- 0:00:56
      111500 -- [-1152.181] (-1150.371) (-1149.168) (-1148.627) * (-1150.354) (-1150.762) (-1151.082) [-1151.716] -- 0:00:55
      112000 -- (-1153.716) (-1152.402) [-1150.917] (-1151.562) * (-1152.411) [-1149.256] (-1149.432) (-1151.105) -- 0:00:55
      112500 -- (-1151.089) (-1150.208) (-1152.367) [-1152.168] * (-1152.632) (-1150.623) [-1152.708] (-1151.481) -- 0:00:55
      113000 -- (-1150.606) (-1152.162) [-1150.219] (-1151.847) * (-1150.101) [-1151.917] (-1150.614) (-1152.340) -- 0:00:54
      113500 -- (-1150.729) (-1151.611) [-1150.082] (-1150.548) * (-1150.796) (-1152.958) (-1150.690) [-1148.661] -- 0:00:54
      114000 -- [-1150.672] (-1151.227) (-1152.684) (-1149.615) * [-1151.630] (-1150.735) (-1153.459) (-1151.669) -- 0:00:54
      114500 -- (-1152.943) (-1150.453) [-1153.684] (-1149.833) * (-1149.953) (-1151.641) (-1153.127) [-1153.252] -- 0:00:54
      115000 -- [-1153.515] (-1150.640) (-1151.034) (-1150.159) * (-1150.437) (-1154.451) [-1150.476] (-1153.466) -- 0:00:53

      Average standard deviation of split frequencies: 0.018608

      115500 -- (-1151.432) (-1156.528) (-1150.820) [-1150.758] * (-1152.267) [-1150.123] (-1151.068) (-1150.961) -- 0:00:53
      116000 -- (-1150.712) (-1155.211) (-1153.637) [-1150.130] * (-1154.607) [-1149.959] (-1151.914) (-1152.184) -- 0:00:53
      116500 -- (-1151.185) (-1150.810) [-1156.392] (-1156.002) * (-1150.470) (-1151.113) [-1149.933] (-1150.821) -- 0:00:53
      117000 -- [-1152.007] (-1150.933) (-1151.061) (-1152.585) * (-1150.051) (-1151.758) (-1150.573) [-1150.930] -- 0:00:52
      117500 -- (-1150.861) (-1151.702) [-1150.561] (-1151.892) * (-1150.275) [-1152.930] (-1150.660) (-1148.467) -- 0:00:52
      118000 -- (-1151.418) (-1151.441) [-1150.027] (-1150.189) * (-1151.974) (-1151.269) (-1152.659) [-1149.810] -- 0:00:52
      118500 -- (-1151.054) (-1150.896) [-1150.001] (-1150.557) * (-1152.537) [-1151.758] (-1156.032) (-1151.683) -- 0:00:59
      119000 -- (-1151.199) (-1153.299) (-1153.812) [-1150.910] * [-1151.392] (-1152.752) (-1154.253) (-1149.999) -- 0:00:59
      119500 -- [-1150.941] (-1151.528) (-1152.697) (-1151.245) * (-1153.856) [-1153.964] (-1153.798) (-1149.122) -- 0:00:58
      120000 -- (-1150.804) (-1151.243) [-1150.761] (-1153.587) * (-1155.899) [-1150.813] (-1149.261) (-1149.496) -- 0:00:58

      Average standard deviation of split frequencies: 0.018947

      120500 -- (-1151.490) (-1149.727) [-1151.263] (-1153.476) * (-1156.092) (-1154.007) [-1153.748] (-1153.271) -- 0:00:58
      121000 -- [-1149.454] (-1149.586) (-1152.730) (-1152.095) * (-1154.606) (-1151.686) [-1150.826] (-1155.374) -- 0:00:58
      121500 -- [-1149.267] (-1150.857) (-1150.729) (-1152.275) * (-1149.550) (-1153.313) (-1153.487) [-1149.613] -- 0:00:57
      122000 -- (-1150.948) [-1150.278] (-1150.328) (-1150.223) * (-1151.987) (-1152.772) (-1152.012) [-1152.052] -- 0:00:57
      122500 -- (-1150.825) (-1152.709) [-1154.634] (-1149.939) * [-1152.286] (-1152.318) (-1152.892) (-1151.504) -- 0:00:57
      123000 -- (-1150.471) (-1151.622) (-1153.739) [-1150.281] * (-1153.132) [-1152.827] (-1152.532) (-1150.606) -- 0:00:57
      123500 -- (-1151.739) [-1150.930] (-1150.590) (-1150.796) * [-1151.865] (-1154.158) (-1152.004) (-1149.312) -- 0:00:56
      124000 -- (-1151.629) [-1151.030] (-1151.041) (-1151.224) * (-1153.514) (-1150.885) [-1150.259] (-1153.643) -- 0:00:56
      124500 -- (-1151.578) (-1150.639) [-1150.264] (-1150.429) * [-1150.345] (-1151.603) (-1151.427) (-1154.778) -- 0:00:56
      125000 -- (-1150.062) [-1152.341] (-1151.858) (-1150.703) * [-1150.642] (-1152.727) (-1153.171) (-1155.503) -- 0:00:56

      Average standard deviation of split frequencies: 0.017023

      125500 -- [-1151.110] (-1151.096) (-1150.111) (-1154.003) * (-1159.192) (-1150.446) (-1152.727) [-1150.628] -- 0:00:55
      126000 -- (-1152.984) [-1150.050] (-1150.824) (-1151.044) * (-1151.734) [-1152.455] (-1149.345) (-1150.793) -- 0:00:55
      126500 -- [-1150.858] (-1153.629) (-1152.360) (-1151.088) * (-1151.425) [-1151.217] (-1149.832) (-1154.183) -- 0:00:55
      127000 -- (-1150.958) [-1151.684] (-1151.279) (-1152.868) * (-1150.660) (-1151.628) (-1153.856) [-1154.747] -- 0:00:54
      127500 -- (-1151.858) [-1147.852] (-1152.290) (-1151.301) * (-1151.579) (-1154.717) [-1154.331] (-1153.345) -- 0:00:54
      128000 -- [-1152.189] (-1148.645) (-1152.741) (-1152.689) * (-1150.571) (-1150.424) [-1153.182] (-1149.134) -- 0:00:54
      128500 -- (-1152.499) (-1151.112) [-1151.491] (-1153.957) * [-1152.462] (-1150.456) (-1153.250) (-1152.304) -- 0:00:54
      129000 -- (-1151.817) (-1150.111) (-1152.151) [-1153.422] * [-1153.155] (-1150.503) (-1156.719) (-1152.296) -- 0:00:54
      129500 -- (-1152.148) (-1148.651) [-1152.420] (-1153.712) * (-1152.357) (-1152.069) [-1151.150] (-1150.243) -- 0:00:53
      130000 -- (-1153.619) [-1149.912] (-1150.210) (-1151.256) * [-1149.562] (-1153.863) (-1151.374) (-1150.168) -- 0:00:53

      Average standard deviation of split frequencies: 0.019350

      130500 -- [-1151.745] (-1150.442) (-1151.397) (-1148.599) * [-1152.347] (-1155.711) (-1151.009) (-1150.480) -- 0:00:53
      131000 -- (-1152.085) [-1151.238] (-1155.885) (-1148.842) * (-1149.114) (-1153.036) (-1148.751) [-1150.398] -- 0:00:53
      131500 -- (-1155.537) (-1151.996) (-1151.940) [-1150.093] * (-1149.883) (-1155.265) [-1150.349] (-1155.536) -- 0:00:52
      132000 -- [-1154.512] (-1152.531) (-1152.225) (-1152.406) * (-1148.996) (-1152.776) (-1150.921) [-1148.617] -- 0:00:52
      132500 -- [-1156.183] (-1151.052) (-1151.923) (-1151.822) * (-1149.173) (-1152.753) (-1150.063) [-1151.093] -- 0:00:52
      133000 -- (-1151.120) (-1156.809) [-1154.650] (-1150.620) * (-1150.844) [-1150.741] (-1150.567) (-1151.748) -- 0:00:58
      133500 -- (-1151.072) (-1151.434) [-1150.525] (-1149.999) * (-1155.288) (-1152.836) [-1151.262] (-1149.619) -- 0:00:58
      134000 -- (-1150.337) [-1149.029] (-1150.121) (-1151.944) * [-1152.196] (-1151.331) (-1150.656) (-1148.896) -- 0:00:58
      134500 -- (-1150.529) [-1151.800] (-1150.736) (-1150.366) * [-1151.673] (-1154.844) (-1150.711) (-1149.556) -- 0:00:57
      135000 -- [-1151.215] (-1152.933) (-1152.602) (-1149.279) * [-1152.658] (-1149.139) (-1150.488) (-1150.576) -- 0:00:57

      Average standard deviation of split frequencies: 0.018982

      135500 -- [-1154.423] (-1152.666) (-1152.495) (-1150.653) * (-1149.927) (-1152.294) [-1148.590] (-1150.620) -- 0:00:57
      136000 -- (-1149.685) (-1149.993) (-1154.704) [-1150.040] * [-1151.966] (-1150.901) (-1149.689) (-1149.825) -- 0:00:57
      136500 -- (-1152.874) (-1152.286) (-1151.691) [-1150.573] * (-1153.962) (-1150.588) [-1149.690] (-1152.810) -- 0:00:56
      137000 -- (-1157.157) (-1154.287) (-1152.012) [-1149.011] * [-1149.849] (-1151.604) (-1150.083) (-1148.608) -- 0:00:56
      137500 -- (-1152.767) [-1151.113] (-1151.476) (-1149.824) * (-1152.279) [-1151.738] (-1154.114) (-1152.326) -- 0:00:56
      138000 -- (-1150.425) [-1150.046] (-1160.188) (-1150.231) * (-1157.712) [-1150.528] (-1161.187) (-1151.709) -- 0:00:56
      138500 -- [-1151.136] (-1150.590) (-1152.115) (-1153.632) * (-1151.615) [-1150.288] (-1156.820) (-1151.991) -- 0:00:55
      139000 -- [-1152.233] (-1150.790) (-1151.701) (-1153.079) * (-1152.675) [-1151.279] (-1152.619) (-1151.722) -- 0:00:55
      139500 -- (-1153.116) (-1149.443) [-1151.030] (-1150.332) * (-1151.161) [-1150.226] (-1149.548) (-1154.170) -- 0:00:55
      140000 -- (-1153.718) [-1148.975] (-1150.187) (-1149.442) * (-1150.787) [-1151.838] (-1155.854) (-1150.649) -- 0:00:55

      Average standard deviation of split frequencies: 0.018033

      140500 -- (-1152.377) (-1150.223) [-1150.750] (-1153.053) * (-1151.564) [-1150.055] (-1152.698) (-1151.971) -- 0:00:55
      141000 -- (-1152.602) [-1150.622] (-1152.107) (-1153.865) * (-1152.924) (-1152.737) [-1150.924] (-1149.966) -- 0:00:54
      141500 -- (-1151.244) [-1150.320] (-1150.839) (-1152.328) * (-1150.723) [-1151.180] (-1152.167) (-1150.851) -- 0:00:54
      142000 -- (-1152.001) [-1149.486] (-1150.386) (-1150.200) * [-1152.668] (-1150.268) (-1153.699) (-1151.212) -- 0:00:54
      142500 -- (-1151.675) (-1150.340) [-1150.275] (-1154.769) * [-1153.980] (-1150.749) (-1152.591) (-1151.889) -- 0:00:54
      143000 -- (-1151.327) (-1150.013) [-1150.238] (-1151.953) * [-1152.952] (-1153.305) (-1154.106) (-1149.713) -- 0:00:53
      143500 -- [-1152.556] (-1154.421) (-1151.460) (-1150.600) * [-1150.994] (-1153.502) (-1152.902) (-1150.746) -- 0:00:53
      144000 -- (-1154.514) [-1149.382] (-1151.593) (-1153.957) * [-1150.809] (-1152.580) (-1152.595) (-1152.515) -- 0:00:53
      144500 -- [-1154.597] (-1149.994) (-1149.418) (-1151.146) * (-1155.337) [-1150.554] (-1152.347) (-1154.234) -- 0:00:53
      145000 -- (-1155.731) [-1148.639] (-1149.564) (-1152.502) * (-1156.699) [-1149.821] (-1154.122) (-1153.213) -- 0:00:53

      Average standard deviation of split frequencies: 0.017528

      145500 -- (-1152.848) (-1149.342) (-1152.541) [-1152.764] * (-1150.120) (-1151.131) (-1151.043) [-1154.848] -- 0:00:52
      146000 -- (-1152.886) (-1151.369) (-1153.653) [-1155.722] * (-1151.816) (-1150.832) (-1150.476) [-1150.247] -- 0:00:52
      146500 -- (-1153.237) (-1153.236) (-1151.183) [-1154.177] * (-1154.386) (-1154.544) [-1149.315] (-1150.924) -- 0:00:52
      147000 -- (-1152.211) (-1153.442) [-1151.303] (-1152.129) * (-1149.895) (-1152.620) [-1150.037] (-1152.786) -- 0:00:52
      147500 -- [-1151.770] (-1151.294) (-1150.199) (-1153.269) * (-1151.016) (-1154.563) (-1150.850) [-1152.030] -- 0:00:52
      148000 -- [-1150.558] (-1153.241) (-1150.163) (-1151.229) * [-1151.135] (-1152.187) (-1154.340) (-1155.432) -- 0:00:57
      148500 -- (-1154.802) [-1153.662] (-1151.923) (-1148.881) * (-1151.468) [-1152.931] (-1155.294) (-1151.813) -- 0:00:57
      149000 -- (-1152.885) (-1153.024) (-1153.453) [-1151.050] * [-1151.977] (-1151.673) (-1156.252) (-1149.317) -- 0:00:57
      149500 -- (-1152.240) (-1150.881) [-1150.344] (-1150.747) * [-1150.980] (-1150.445) (-1152.422) (-1149.915) -- 0:00:56
      150000 -- (-1150.002) (-1153.318) [-1149.249] (-1151.701) * (-1150.877) (-1150.875) [-1150.521] (-1149.571) -- 0:00:56

      Average standard deviation of split frequencies: 0.015809

      150500 -- (-1151.133) (-1150.469) [-1150.906] (-1148.891) * (-1154.614) (-1152.027) [-1153.824] (-1152.707) -- 0:00:56
      151000 -- (-1151.271) [-1150.550] (-1151.707) (-1148.169) * [-1151.818] (-1151.096) (-1150.268) (-1154.510) -- 0:00:56
      151500 -- (-1156.820) [-1150.822] (-1150.502) (-1151.331) * (-1152.513) [-1150.341] (-1152.168) (-1153.036) -- 0:00:56
      152000 -- (-1152.364) (-1154.223) [-1152.307] (-1152.941) * (-1150.944) [-1153.700] (-1151.482) (-1150.713) -- 0:00:55
      152500 -- (-1152.102) (-1151.146) (-1151.695) [-1151.818] * (-1150.600) (-1157.382) [-1155.804] (-1154.138) -- 0:00:55
      153000 -- (-1156.399) (-1150.351) [-1151.274] (-1154.414) * (-1151.058) (-1153.077) (-1151.535) [-1152.262] -- 0:00:55
      153500 -- (-1152.199) (-1150.119) [-1151.680] (-1149.294) * (-1150.373) (-1153.222) (-1150.102) [-1151.223] -- 0:00:55
      154000 -- (-1156.323) (-1151.141) [-1150.861] (-1155.151) * [-1150.604] (-1150.987) (-1151.782) (-1152.446) -- 0:00:54
      154500 -- [-1152.741] (-1150.568) (-1154.278) (-1153.198) * (-1152.627) [-1150.954] (-1150.246) (-1152.755) -- 0:00:54
      155000 -- (-1156.198) (-1153.726) [-1151.436] (-1150.083) * (-1152.397) (-1151.743) [-1149.575] (-1152.725) -- 0:00:54

      Average standard deviation of split frequencies: 0.014438

      155500 -- (-1151.655) [-1150.734] (-1150.852) (-1153.612) * (-1154.221) (-1152.602) (-1149.810) [-1150.433] -- 0:00:54
      156000 -- [-1153.386] (-1151.634) (-1152.574) (-1154.962) * (-1159.644) [-1152.130] (-1149.494) (-1150.852) -- 0:00:54
      156500 -- [-1149.767] (-1149.864) (-1149.855) (-1152.935) * (-1156.320) (-1151.705) [-1151.426] (-1156.041) -- 0:00:53
      157000 -- [-1150.651] (-1153.153) (-1149.904) (-1157.332) * (-1152.362) (-1150.359) [-1150.485] (-1156.182) -- 0:00:53
      157500 -- (-1149.418) (-1152.420) [-1150.489] (-1152.814) * (-1153.676) (-1149.722) (-1152.014) [-1150.050] -- 0:00:53
      158000 -- (-1152.783) (-1151.727) [-1151.882] (-1152.368) * (-1153.964) (-1153.100) [-1150.561] (-1151.555) -- 0:00:53
      158500 -- (-1151.002) (-1152.244) [-1152.025] (-1154.500) * (-1150.683) (-1153.523) (-1151.738) [-1152.759] -- 0:00:53
      159000 -- (-1150.373) (-1153.903) [-1151.956] (-1152.274) * (-1149.395) (-1150.193) [-1151.361] (-1151.019) -- 0:00:52
      159500 -- (-1157.586) (-1151.809) (-1157.955) [-1159.183] * (-1151.043) (-1151.800) [-1150.692] (-1158.886) -- 0:00:52
      160000 -- (-1151.578) (-1155.619) [-1153.837] (-1156.991) * (-1150.356) [-1155.404] (-1150.738) (-1152.750) -- 0:00:52

      Average standard deviation of split frequencies: 0.015485

      160500 -- (-1153.157) [-1151.512] (-1150.156) (-1151.717) * [-1151.759] (-1150.849) (-1151.810) (-1151.160) -- 0:00:52
      161000 -- (-1152.365) (-1152.757) (-1149.630) [-1151.417] * [-1151.223] (-1151.831) (-1152.794) (-1149.810) -- 0:00:52
      161500 -- (-1151.844) (-1151.513) [-1149.431] (-1152.501) * [-1151.778] (-1150.849) (-1151.518) (-1150.992) -- 0:00:51
      162000 -- [-1151.963] (-1153.194) (-1153.076) (-1150.683) * (-1150.405) (-1153.158) [-1150.386] (-1150.715) -- 0:00:51
      162500 -- [-1151.772] (-1151.202) (-1153.496) (-1150.204) * (-1154.095) [-1149.756] (-1152.153) (-1152.836) -- 0:00:51
      163000 -- (-1150.995) (-1153.957) [-1152.965] (-1152.395) * [-1151.809] (-1151.018) (-1152.157) (-1151.015) -- 0:00:56
      163500 -- (-1150.329) (-1150.966) (-1154.189) [-1152.661] * (-1150.809) (-1150.659) (-1150.474) [-1150.767] -- 0:00:56
      164000 -- (-1152.488) (-1150.272) (-1155.267) [-1150.694] * (-1150.977) [-1149.632] (-1155.221) (-1150.641) -- 0:00:56
      164500 -- [-1152.394] (-1151.614) (-1152.541) (-1153.141) * (-1150.203) (-1149.211) [-1149.653] (-1152.956) -- 0:00:55
      165000 -- (-1150.919) [-1150.079] (-1152.157) (-1149.827) * (-1150.282) [-1147.861] (-1154.408) (-1151.117) -- 0:00:55

      Average standard deviation of split frequencies: 0.014357

      165500 -- (-1150.795) (-1151.810) (-1155.933) [-1152.436] * (-1150.198) (-1154.701) (-1149.338) [-1150.776] -- 0:00:55
      166000 -- (-1153.009) (-1150.722) [-1153.299] (-1150.112) * (-1150.024) (-1149.883) (-1150.087) [-1152.231] -- 0:00:55
      166500 -- (-1153.581) (-1153.393) (-1152.009) [-1151.935] * (-1151.784) [-1150.518] (-1151.478) (-1149.071) -- 0:00:55
      167000 -- (-1150.976) (-1152.094) (-1152.070) [-1152.739] * (-1150.972) (-1151.775) [-1152.802] (-1152.394) -- 0:00:54
      167500 -- (-1151.296) (-1152.105) (-1151.333) [-1151.666] * (-1150.032) (-1152.167) (-1151.481) [-1150.261] -- 0:00:54
      168000 -- (-1150.851) (-1152.013) (-1153.086) [-1149.523] * (-1153.402) [-1151.328] (-1152.359) (-1152.471) -- 0:00:54
      168500 -- (-1152.542) (-1151.359) (-1153.356) [-1149.573] * (-1155.392) (-1154.327) (-1152.148) [-1152.083] -- 0:00:54
      169000 -- (-1155.477) (-1156.414) (-1153.485) [-1150.673] * (-1151.425) (-1149.529) [-1150.625] (-1150.177) -- 0:00:54
      169500 -- (-1151.168) (-1150.896) (-1151.420) [-1149.892] * (-1152.102) (-1151.885) (-1151.599) [-1151.706] -- 0:00:53
      170000 -- (-1151.769) (-1155.015) (-1153.423) [-1148.448] * (-1149.954) (-1151.157) (-1150.675) [-1152.404] -- 0:00:53

      Average standard deviation of split frequencies: 0.015345

      170500 -- (-1152.024) (-1150.437) [-1150.362] (-1151.581) * [-1154.886] (-1151.828) (-1149.200) (-1151.057) -- 0:00:53
      171000 -- (-1152.311) (-1149.290) (-1154.430) [-1150.082] * (-1149.904) (-1154.026) (-1156.248) [-1151.661] -- 0:00:53
      171500 -- (-1152.168) [-1150.714] (-1154.077) (-1150.046) * (-1151.751) (-1153.752) (-1152.650) [-1152.087] -- 0:00:53
      172000 -- (-1151.086) [-1150.925] (-1150.670) (-1156.428) * (-1151.422) (-1154.161) [-1152.192] (-1150.297) -- 0:00:52
      172500 -- [-1153.651] (-1152.384) (-1152.379) (-1149.195) * (-1150.279) [-1150.031] (-1150.583) (-1153.331) -- 0:00:52
      173000 -- (-1150.642) [-1153.790] (-1150.263) (-1150.232) * (-1151.352) [-1150.720] (-1153.625) (-1150.049) -- 0:00:52
      173500 -- (-1151.988) [-1151.811] (-1151.436) (-1151.270) * [-1151.342] (-1151.479) (-1151.017) (-1153.630) -- 0:00:52
      174000 -- (-1154.015) (-1150.835) (-1153.516) [-1151.971] * (-1151.467) (-1150.221) [-1156.165] (-1152.387) -- 0:00:52
      174500 -- (-1151.989) [-1150.390] (-1150.263) (-1151.139) * (-1151.605) (-1153.066) (-1156.475) [-1151.882] -- 0:00:52
      175000 -- (-1151.109) (-1152.184) [-1151.217] (-1150.178) * (-1150.833) (-1152.224) (-1155.329) [-1149.535] -- 0:00:51

      Average standard deviation of split frequencies: 0.016219

      175500 -- [-1151.088] (-1152.186) (-1149.496) (-1151.498) * (-1150.872) [-1150.399] (-1151.352) (-1151.183) -- 0:00:51
      176000 -- (-1150.662) (-1150.674) [-1154.337] (-1152.765) * (-1154.261) (-1150.832) (-1150.990) [-1151.820] -- 0:00:51
      176500 -- (-1149.992) (-1151.018) (-1153.983) [-1151.119] * (-1150.910) (-1150.642) [-1150.011] (-1156.246) -- 0:00:55
      177000 -- (-1152.681) [-1150.886] (-1153.765) (-1153.892) * (-1149.617) (-1155.585) (-1152.475) [-1153.455] -- 0:00:55
      177500 -- (-1150.690) [-1151.068] (-1156.384) (-1152.025) * (-1150.095) [-1155.008] (-1151.715) (-1154.385) -- 0:00:55
      178000 -- [-1151.728] (-1151.072) (-1153.328) (-1157.286) * [-1150.926] (-1154.370) (-1153.976) (-1150.515) -- 0:00:55
      178500 -- [-1150.745] (-1151.526) (-1150.648) (-1150.518) * (-1149.272) (-1153.264) [-1150.413] (-1153.910) -- 0:00:55
      179000 -- (-1153.857) [-1151.202] (-1150.089) (-1151.717) * (-1154.136) [-1150.518] (-1150.942) (-1150.976) -- 0:00:55
      179500 -- (-1152.700) (-1151.172) (-1150.680) [-1151.362] * (-1153.944) [-1150.369] (-1150.579) (-1150.739) -- 0:00:54
      180000 -- (-1151.608) (-1151.460) (-1155.147) [-1149.080] * (-1153.888) (-1151.923) [-1149.455] (-1151.614) -- 0:00:54

      Average standard deviation of split frequencies: 0.016235

      180500 -- (-1151.118) (-1150.246) (-1157.176) [-1148.684] * (-1154.697) (-1151.887) (-1150.218) [-1152.457] -- 0:00:54
      181000 -- (-1152.864) (-1150.407) (-1152.603) [-1152.439] * (-1152.626) [-1151.651] (-1156.020) (-1153.688) -- 0:00:54
      181500 -- (-1151.534) (-1152.249) (-1153.307) [-1152.619] * [-1150.877] (-1150.714) (-1153.147) (-1153.902) -- 0:00:54
      182000 -- (-1149.742) (-1152.499) [-1150.720] (-1151.643) * (-1150.102) [-1151.633] (-1148.897) (-1151.025) -- 0:00:53
      182500 -- (-1151.643) [-1152.440] (-1152.029) (-1154.298) * (-1150.722) (-1150.848) (-1148.316) [-1151.122] -- 0:00:53
      183000 -- [-1154.092] (-1152.518) (-1150.372) (-1150.697) * [-1159.613] (-1151.264) (-1149.595) (-1151.829) -- 0:00:53
      183500 -- [-1153.760] (-1153.752) (-1150.111) (-1155.373) * (-1153.963) [-1150.131] (-1151.565) (-1150.894) -- 0:00:53
      184000 -- (-1154.681) (-1150.119) [-1150.437] (-1149.869) * [-1152.472] (-1150.062) (-1152.290) (-1154.282) -- 0:00:53
      184500 -- (-1154.412) (-1152.023) [-1151.161] (-1150.122) * [-1148.653] (-1150.954) (-1150.650) (-1153.012) -- 0:00:53
      185000 -- [-1150.671] (-1151.298) (-1153.462) (-1149.764) * (-1149.861) (-1149.235) (-1152.105) [-1151.803] -- 0:00:52

      Average standard deviation of split frequencies: 0.016807

      185500 -- (-1152.044) [-1149.694] (-1152.185) (-1149.556) * (-1153.133) [-1151.039] (-1150.130) (-1153.343) -- 0:00:52
      186000 -- (-1155.166) (-1150.755) (-1156.626) [-1150.670] * (-1152.878) [-1150.368] (-1150.873) (-1149.759) -- 0:00:52
      186500 -- (-1154.127) [-1150.713] (-1153.807) (-1155.609) * [-1155.169] (-1152.518) (-1152.324) (-1149.502) -- 0:00:52
      187000 -- (-1151.366) (-1150.780) [-1150.390] (-1155.077) * (-1149.880) (-1150.927) (-1151.127) [-1150.976] -- 0:00:52
      187500 -- (-1150.245) (-1155.622) (-1151.557) [-1150.609] * (-1153.195) [-1150.411] (-1150.164) (-1153.742) -- 0:00:52
      188000 -- [-1151.103] (-1150.621) (-1152.825) (-1154.611) * (-1153.362) [-1152.779] (-1152.104) (-1154.921) -- 0:00:51
      188500 -- [-1154.104] (-1151.302) (-1149.894) (-1150.388) * (-1150.978) (-1152.535) [-1150.038] (-1151.349) -- 0:00:51
      189000 -- (-1152.580) (-1152.541) (-1152.090) [-1151.867] * (-1151.968) (-1151.360) [-1150.565] (-1149.704) -- 0:00:51
      189500 -- (-1152.047) (-1152.897) [-1150.294] (-1149.572) * (-1152.374) (-1152.542) [-1152.629] (-1150.321) -- 0:00:51
      190000 -- (-1151.506) [-1153.398] (-1151.971) (-1150.609) * [-1152.660] (-1152.106) (-1151.967) (-1150.236) -- 0:00:51

      Average standard deviation of split frequencies: 0.014574

      190500 -- [-1151.983] (-1153.893) (-1151.269) (-1147.918) * [-1150.242] (-1151.581) (-1151.722) (-1149.713) -- 0:00:55
      191000 -- [-1150.590] (-1151.846) (-1150.724) (-1152.884) * (-1151.121) [-1151.926] (-1152.084) (-1154.036) -- 0:00:55
      191500 -- [-1151.574] (-1150.539) (-1152.224) (-1151.807) * [-1151.245] (-1151.803) (-1152.212) (-1153.191) -- 0:00:54
      192000 -- [-1153.169] (-1150.909) (-1152.431) (-1153.179) * (-1151.546) [-1149.258] (-1151.490) (-1151.278) -- 0:00:54
      192500 -- [-1151.046] (-1150.660) (-1151.866) (-1151.986) * (-1154.651) [-1149.405] (-1148.715) (-1152.052) -- 0:00:54
      193000 -- (-1151.855) (-1151.037) [-1149.705] (-1149.476) * (-1153.774) (-1149.202) [-1150.678] (-1153.057) -- 0:00:54
      193500 -- [-1149.928] (-1150.573) (-1154.021) (-1149.288) * (-1149.374) [-1151.061] (-1150.122) (-1151.772) -- 0:00:54
      194000 -- [-1151.843] (-1149.804) (-1150.465) (-1151.213) * (-1151.748) (-1152.305) (-1150.896) [-1151.046] -- 0:00:54
      194500 -- (-1153.820) (-1154.208) (-1150.078) [-1151.381] * (-1151.445) (-1149.931) [-1150.984] (-1149.367) -- 0:00:53
      195000 -- (-1150.091) (-1150.994) (-1154.550) [-1151.273] * [-1151.332] (-1150.579) (-1152.246) (-1150.112) -- 0:00:53

      Average standard deviation of split frequencies: 0.012293

      195500 -- (-1152.702) (-1152.927) [-1150.176] (-1151.297) * (-1153.326) (-1150.108) (-1152.484) [-1148.498] -- 0:00:53
      196000 -- (-1154.252) [-1151.221] (-1150.901) (-1151.535) * (-1151.611) (-1153.927) (-1150.380) [-1148.527] -- 0:00:53
      196500 -- (-1153.475) (-1152.552) (-1150.185) [-1148.306] * (-1150.511) (-1150.784) [-1150.482] (-1150.158) -- 0:00:53
      197000 -- [-1154.594] (-1153.412) (-1150.568) (-1150.217) * (-1153.443) (-1149.277) (-1151.536) [-1152.155] -- 0:00:52
      197500 -- (-1151.966) (-1153.356) (-1150.900) [-1149.906] * (-1152.611) (-1151.283) (-1150.451) [-1151.892] -- 0:00:52
      198000 -- (-1151.203) (-1154.745) (-1150.780) [-1152.755] * (-1150.601) [-1151.086] (-1150.375) (-1151.699) -- 0:00:52
      198500 -- (-1156.248) (-1152.749) (-1151.323) [-1151.182] * (-1152.050) (-1151.068) [-1148.780] (-1151.181) -- 0:00:52
      199000 -- (-1154.113) [-1149.056] (-1149.931) (-1150.755) * [-1148.576] (-1149.338) (-1149.529) (-1150.935) -- 0:00:52
      199500 -- [-1152.740] (-1150.319) (-1150.827) (-1150.822) * (-1150.553) (-1150.109) (-1154.642) [-1149.445] -- 0:00:52
      200000 -- (-1153.554) (-1152.711) [-1149.811] (-1151.389) * (-1150.456) (-1148.609) [-1149.697] (-1149.096) -- 0:00:51

      Average standard deviation of split frequencies: 0.013704

      200500 -- (-1152.504) (-1151.509) [-1149.116] (-1151.912) * [-1150.615] (-1148.792) (-1149.248) (-1149.536) -- 0:00:51
      201000 -- (-1153.889) [-1149.024] (-1150.710) (-1153.276) * (-1150.426) (-1150.342) (-1148.893) [-1152.017] -- 0:00:51
      201500 -- [-1153.620] (-1151.172) (-1152.335) (-1151.474) * (-1153.252) (-1150.855) [-1149.502] (-1151.367) -- 0:00:51
      202000 -- (-1154.520) (-1153.005) (-1149.325) [-1151.345] * (-1150.349) [-1153.164] (-1150.812) (-1150.285) -- 0:00:51
      202500 -- (-1155.110) [-1150.750] (-1149.824) (-1150.093) * (-1151.991) [-1152.364] (-1155.006) (-1151.704) -- 0:00:51
      203000 -- [-1150.360] (-1152.251) (-1148.931) (-1149.208) * (-1154.499) (-1151.391) [-1154.744] (-1152.194) -- 0:00:51
      203500 -- [-1150.453] (-1151.308) (-1152.141) (-1151.247) * (-1150.176) [-1150.513] (-1152.649) (-1152.006) -- 0:00:50
      204000 -- (-1152.941) (-1151.517) [-1151.179] (-1149.797) * [-1152.930] (-1151.278) (-1155.345) (-1152.348) -- 0:00:50
      204500 -- [-1151.153] (-1153.719) (-1151.934) (-1152.574) * (-1151.059) (-1149.750) (-1150.130) [-1152.204] -- 0:00:50
      205000 -- (-1152.201) (-1154.165) (-1153.228) [-1150.871] * [-1149.809] (-1153.974) (-1157.170) (-1153.100) -- 0:00:54

      Average standard deviation of split frequencies: 0.015416

      205500 -- (-1153.342) (-1151.161) [-1153.300] (-1149.480) * (-1150.551) (-1151.011) [-1150.169] (-1153.897) -- 0:00:54
      206000 -- (-1152.011) (-1148.601) [-1150.746] (-1153.727) * (-1152.372) [-1149.647] (-1151.541) (-1154.504) -- 0:00:53
      206500 -- (-1152.123) (-1152.218) (-1149.035) [-1148.454] * [-1154.878] (-1151.376) (-1149.566) (-1151.310) -- 0:00:53
      207000 -- (-1149.741) (-1152.983) (-1152.467) [-1150.714] * (-1152.336) (-1151.176) [-1151.148] (-1152.005) -- 0:00:53
      207500 -- (-1152.820) [-1150.324] (-1152.529) (-1150.721) * (-1150.475) (-1151.305) (-1150.054) [-1151.481] -- 0:00:53
      208000 -- (-1150.617) [-1150.393] (-1152.189) (-1150.016) * (-1149.514) [-1150.420] (-1152.239) (-1151.447) -- 0:00:53
      208500 -- [-1153.092] (-1153.502) (-1150.189) (-1149.991) * (-1150.917) [-1148.391] (-1152.393) (-1159.495) -- 0:00:53
      209000 -- (-1151.797) [-1152.515] (-1151.630) (-1152.793) * [-1148.618] (-1152.573) (-1149.428) (-1157.335) -- 0:00:52
      209500 -- [-1149.828] (-1153.691) (-1152.136) (-1150.192) * (-1150.176) (-1154.370) (-1153.087) [-1150.192] -- 0:00:52
      210000 -- (-1149.180) (-1151.194) [-1149.406] (-1150.128) * (-1149.845) [-1150.869] (-1155.881) (-1150.385) -- 0:00:52

      Average standard deviation of split frequencies: 0.013923

      210500 -- (-1150.779) (-1151.373) [-1152.654] (-1150.926) * (-1151.368) (-1158.134) (-1153.143) [-1150.590] -- 0:00:52
      211000 -- [-1150.843] (-1151.323) (-1148.980) (-1154.412) * (-1154.026) [-1158.084] (-1151.591) (-1152.389) -- 0:00:52
      211500 -- (-1151.670) [-1149.491] (-1151.789) (-1150.100) * (-1150.673) (-1152.929) [-1150.367] (-1151.051) -- 0:00:52
      212000 -- (-1150.916) (-1154.032) [-1151.342] (-1151.482) * [-1153.198] (-1153.524) (-1150.929) (-1150.158) -- 0:00:52
      212500 -- (-1149.441) (-1151.657) (-1150.197) [-1149.948] * (-1150.704) (-1158.734) (-1151.868) [-1152.486] -- 0:00:51
      213000 -- [-1150.118] (-1154.439) (-1156.432) (-1151.414) * (-1152.694) [-1149.959] (-1154.498) (-1150.489) -- 0:00:51
      213500 -- (-1149.921) [-1153.332] (-1150.545) (-1152.263) * (-1152.727) [-1150.689] (-1153.789) (-1150.050) -- 0:00:51
      214000 -- [-1149.173] (-1155.004) (-1153.280) (-1150.525) * (-1151.509) (-1150.822) [-1149.842] (-1150.128) -- 0:00:51
      214500 -- (-1151.287) (-1153.643) [-1149.899] (-1150.032) * [-1150.840] (-1153.090) (-1151.977) (-1148.938) -- 0:00:51
      215000 -- (-1152.868) [-1151.416] (-1150.619) (-1151.362) * [-1151.786] (-1149.458) (-1149.485) (-1149.821) -- 0:00:51

      Average standard deviation of split frequencies: 0.013337

      215500 -- [-1150.249] (-1150.942) (-1151.309) (-1153.521) * (-1150.359) (-1152.882) [-1150.406] (-1150.572) -- 0:00:50
      216000 -- [-1151.108] (-1150.431) (-1153.256) (-1154.078) * (-1150.612) [-1149.895] (-1152.098) (-1150.018) -- 0:00:50
      216500 -- (-1152.671) (-1150.948) (-1153.511) [-1150.192] * (-1150.214) [-1151.861] (-1151.042) (-1150.552) -- 0:00:50
      217000 -- (-1150.313) [-1150.660] (-1152.874) (-1149.933) * (-1152.726) (-1152.655) (-1154.133) [-1152.526] -- 0:00:50
      217500 -- (-1150.000) [-1151.933] (-1153.567) (-1151.432) * [-1151.528] (-1152.204) (-1151.235) (-1155.885) -- 0:00:50
      218000 -- (-1151.168) (-1152.010) [-1153.220] (-1150.594) * (-1151.204) [-1148.789] (-1151.140) (-1152.667) -- 0:00:50
      218500 -- (-1150.838) (-1151.904) [-1149.361] (-1151.337) * (-1149.187) [-1151.736] (-1152.521) (-1152.162) -- 0:00:50
      219000 -- (-1153.759) (-1152.598) (-1154.145) [-1151.592] * (-1150.379) [-1150.843] (-1154.242) (-1152.108) -- 0:00:49
      219500 -- (-1153.565) (-1152.233) [-1151.043] (-1151.003) * (-1151.866) (-1150.768) [-1150.671] (-1154.221) -- 0:00:49
      220000 -- (-1154.038) [-1152.386] (-1148.584) (-1151.790) * (-1155.575) (-1149.642) [-1153.122] (-1151.343) -- 0:00:49

      Average standard deviation of split frequencies: 0.014954

      220500 -- (-1154.819) (-1153.844) [-1148.303] (-1152.339) * (-1154.252) [-1149.432] (-1155.564) (-1151.942) -- 0:00:53
      221000 -- (-1157.457) (-1151.361) [-1151.285] (-1152.002) * (-1152.173) [-1151.711] (-1155.788) (-1155.699) -- 0:00:52
      221500 -- [-1150.914] (-1150.960) (-1152.370) (-1151.594) * (-1153.400) [-1151.846] (-1158.194) (-1152.895) -- 0:00:52
      222000 -- (-1149.768) (-1150.751) [-1150.863] (-1151.419) * (-1151.479) (-1151.676) (-1150.957) [-1152.364] -- 0:00:52
      222500 -- (-1152.527) (-1150.032) [-1154.978] (-1150.150) * [-1152.065] (-1152.375) (-1149.366) (-1150.433) -- 0:00:52
      223000 -- (-1150.649) (-1151.400) (-1155.647) [-1150.652] * (-1153.887) (-1151.284) [-1151.515] (-1153.431) -- 0:00:52
      223500 -- [-1150.410] (-1158.200) (-1154.299) (-1153.848) * [-1151.563] (-1155.467) (-1151.760) (-1150.464) -- 0:00:52
      224000 -- (-1151.623) [-1151.160] (-1157.516) (-1151.289) * (-1148.970) (-1154.214) (-1152.481) [-1150.487] -- 0:00:51
      224500 -- (-1151.712) (-1150.251) [-1152.032] (-1152.923) * [-1151.003] (-1154.399) (-1150.936) (-1150.349) -- 0:00:51
      225000 -- (-1150.931) (-1150.575) (-1154.202) [-1149.459] * (-1151.002) (-1154.081) [-1150.772] (-1149.594) -- 0:00:51

      Average standard deviation of split frequencies: 0.014949

      225500 -- (-1151.723) (-1150.067) (-1157.128) [-1153.464] * (-1150.516) (-1156.005) [-1149.409] (-1148.564) -- 0:00:51
      226000 -- [-1152.117] (-1154.395) (-1154.521) (-1152.926) * [-1148.647] (-1158.038) (-1149.839) (-1151.106) -- 0:00:51
      226500 -- (-1154.552) (-1149.789) [-1152.237] (-1150.979) * [-1153.948] (-1154.388) (-1151.670) (-1151.133) -- 0:00:51
      227000 -- (-1159.738) (-1151.105) (-1150.630) [-1150.581] * (-1151.073) [-1154.848] (-1151.432) (-1151.270) -- 0:00:51
      227500 -- (-1152.344) [-1150.963] (-1156.249) (-1150.122) * (-1150.138) [-1151.599] (-1153.294) (-1152.393) -- 0:00:50
      228000 -- [-1149.417] (-1151.747) (-1156.988) (-1159.095) * [-1153.648] (-1156.711) (-1152.014) (-1152.917) -- 0:00:50
      228500 -- (-1150.010) (-1155.734) (-1153.797) [-1151.095] * (-1154.271) [-1151.795] (-1153.943) (-1150.274) -- 0:00:50
      229000 -- [-1150.323] (-1149.916) (-1151.607) (-1151.666) * (-1150.961) (-1150.538) (-1152.804) [-1150.359] -- 0:00:50
      229500 -- (-1152.115) (-1151.157) [-1150.984] (-1150.674) * [-1149.080] (-1151.275) (-1152.707) (-1152.310) -- 0:00:50
      230000 -- (-1153.486) (-1152.515) [-1149.980] (-1150.766) * [-1152.999] (-1150.926) (-1150.736) (-1150.839) -- 0:00:50

      Average standard deviation of split frequencies: 0.014987

      230500 -- (-1149.268) (-1149.556) (-1151.610) [-1150.529] * [-1150.177] (-1150.953) (-1150.846) (-1150.761) -- 0:00:50
      231000 -- [-1153.665] (-1152.275) (-1151.892) (-1153.549) * (-1150.268) (-1150.482) (-1151.471) [-1151.179] -- 0:00:49
      231500 -- (-1150.479) (-1151.580) [-1149.077] (-1150.461) * [-1148.735] (-1150.592) (-1152.848) (-1151.378) -- 0:00:49
      232000 -- [-1153.093] (-1151.585) (-1151.065) (-1150.298) * (-1151.362) (-1150.607) (-1152.780) [-1151.324] -- 0:00:49
      232500 -- (-1152.752) (-1150.452) [-1152.236] (-1150.870) * (-1151.423) (-1152.393) (-1155.362) [-1151.224] -- 0:00:49
      233000 -- (-1156.891) [-1150.172] (-1151.247) (-1150.166) * (-1152.537) (-1152.455) (-1151.009) [-1150.224] -- 0:00:49
      233500 -- [-1151.669] (-1154.903) (-1152.657) (-1150.065) * (-1149.279) (-1150.892) [-1151.687] (-1150.850) -- 0:00:49
      234000 -- (-1149.696) (-1156.387) (-1150.637) [-1150.358] * (-1150.050) (-1150.855) (-1150.795) [-1152.647] -- 0:00:49
      234500 -- [-1151.135] (-1150.198) (-1152.458) (-1151.132) * [-1148.799] (-1152.142) (-1150.996) (-1149.910) -- 0:00:48
      235000 -- (-1150.728) (-1150.693) (-1149.855) [-1150.790] * (-1151.526) (-1152.613) (-1152.571) [-1149.898] -- 0:00:48

      Average standard deviation of split frequencies: 0.014426

      235500 -- (-1150.239) [-1150.733] (-1149.681) (-1150.505) * (-1149.800) (-1152.373) (-1151.441) [-1151.912] -- 0:00:48
      236000 -- [-1151.451] (-1151.249) (-1150.739) (-1151.632) * (-1149.092) [-1152.476] (-1151.308) (-1152.140) -- 0:00:51
      236500 -- (-1150.272) [-1152.284] (-1151.580) (-1150.874) * [-1152.473] (-1150.548) (-1150.560) (-1149.686) -- 0:00:51
      237000 -- (-1150.169) [-1153.354] (-1147.761) (-1151.668) * [-1149.271] (-1152.121) (-1155.412) (-1150.140) -- 0:00:51
      237500 -- (-1150.479) [-1150.960] (-1153.419) (-1155.092) * (-1152.197) [-1150.770] (-1153.989) (-1150.383) -- 0:00:51
      238000 -- (-1150.917) (-1150.244) [-1150.787] (-1152.001) * (-1152.667) [-1153.464] (-1152.033) (-1154.991) -- 0:00:51
      238500 -- (-1152.318) (-1154.249) [-1150.614] (-1151.676) * [-1152.592] (-1150.391) (-1151.259) (-1152.919) -- 0:00:51
      239000 -- (-1151.490) (-1149.972) [-1152.487] (-1154.376) * (-1150.863) (-1150.045) (-1151.792) [-1151.077] -- 0:00:50
      239500 -- (-1149.952) (-1150.264) [-1150.965] (-1156.504) * [-1150.130] (-1151.340) (-1150.112) (-1152.496) -- 0:00:50
      240000 -- [-1150.764] (-1152.148) (-1150.257) (-1150.263) * (-1151.648) (-1151.262) [-1150.120] (-1152.482) -- 0:00:50

      Average standard deviation of split frequencies: 0.013494

      240500 -- [-1150.988] (-1150.411) (-1150.976) (-1151.689) * (-1153.981) (-1151.995) [-1150.262] (-1152.816) -- 0:00:50
      241000 -- [-1153.644] (-1150.940) (-1149.706) (-1151.873) * (-1153.684) (-1152.253) [-1151.245] (-1153.053) -- 0:00:50
      241500 -- (-1151.305) (-1151.631) (-1150.476) [-1152.001] * [-1153.159] (-1155.478) (-1154.672) (-1151.063) -- 0:00:50
      242000 -- (-1151.001) (-1153.206) [-1149.151] (-1154.757) * (-1151.219) (-1149.158) (-1158.968) [-1149.668] -- 0:00:50
      242500 -- (-1153.353) (-1151.355) [-1149.108] (-1155.616) * (-1150.249) (-1152.981) (-1157.690) [-1152.137] -- 0:00:49
      243000 -- (-1152.745) (-1152.120) (-1152.274) [-1150.895] * (-1149.706) (-1151.550) [-1152.325] (-1152.459) -- 0:00:49
      243500 -- (-1149.771) (-1153.408) (-1153.060) [-1150.401] * [-1151.379] (-1151.890) (-1150.439) (-1157.533) -- 0:00:49
      244000 -- (-1148.986) (-1151.488) (-1157.088) [-1151.205] * (-1149.777) [-1151.012] (-1150.463) (-1153.132) -- 0:00:49
      244500 -- (-1150.144) [-1153.038] (-1151.375) (-1151.548) * (-1150.146) (-1149.787) (-1151.934) [-1153.774] -- 0:00:49
      245000 -- [-1150.383] (-1154.429) (-1151.642) (-1150.958) * [-1148.499] (-1149.784) (-1151.626) (-1153.034) -- 0:00:49

      Average standard deviation of split frequencies: 0.013515

      245500 -- (-1154.360) [-1150.311] (-1150.829) (-1151.051) * [-1148.794] (-1151.254) (-1152.439) (-1155.730) -- 0:00:49
      246000 -- (-1151.542) (-1150.426) (-1151.261) [-1149.308] * (-1150.035) [-1151.736] (-1151.966) (-1150.626) -- 0:00:49
      246500 -- (-1150.592) (-1152.769) [-1150.357] (-1148.598) * (-1149.290) (-1150.248) (-1151.761) [-1152.296] -- 0:00:48
      247000 -- (-1151.425) (-1148.602) (-1150.894) [-1151.866] * (-1148.818) (-1154.693) (-1150.340) [-1152.880] -- 0:00:48
      247500 -- [-1151.220] (-1153.278) (-1149.895) (-1153.897) * [-1151.636] (-1157.132) (-1151.881) (-1151.706) -- 0:00:48
      248000 -- (-1150.212) (-1152.390) [-1151.126] (-1155.416) * (-1149.554) (-1153.954) (-1149.875) [-1151.332] -- 0:00:48
      248500 -- [-1149.573] (-1149.457) (-1152.174) (-1155.818) * (-1151.065) (-1150.601) (-1151.918) [-1150.366] -- 0:00:48
      249000 -- (-1150.584) (-1151.766) [-1150.564] (-1151.231) * (-1149.890) [-1153.970] (-1150.162) (-1150.180) -- 0:00:48
      249500 -- (-1150.798) [-1149.348] (-1152.522) (-1153.445) * (-1148.959) [-1151.509] (-1150.442) (-1155.004) -- 0:00:48
      250000 -- (-1149.301) [-1152.052] (-1155.201) (-1151.055) * (-1149.717) (-1152.438) [-1149.980] (-1153.945) -- 0:00:48

      Average standard deviation of split frequencies: 0.014209

      250500 -- [-1154.916] (-1151.003) (-1157.539) (-1151.694) * (-1150.520) [-1150.327] (-1151.417) (-1154.555) -- 0:00:47
      251000 -- (-1156.135) (-1153.591) [-1152.235] (-1151.233) * (-1150.831) (-1151.515) (-1156.583) [-1152.787] -- 0:00:50
      251500 -- (-1150.762) (-1154.638) [-1149.139] (-1150.478) * (-1153.428) [-1151.642] (-1151.590) (-1154.979) -- 0:00:50
      252000 -- (-1150.671) (-1152.399) [-1151.257] (-1154.597) * (-1151.738) [-1151.867] (-1153.742) (-1151.527) -- 0:00:50
      252500 -- [-1149.195] (-1155.460) (-1150.233) (-1155.120) * (-1149.425) (-1155.679) (-1156.836) [-1149.725] -- 0:00:50
      253000 -- [-1150.107] (-1151.366) (-1153.632) (-1153.800) * (-1151.562) (-1152.863) (-1158.833) [-1149.849] -- 0:00:50
      253500 -- (-1150.050) (-1149.632) (-1149.115) [-1150.271] * [-1152.004] (-1150.784) (-1152.888) (-1150.620) -- 0:00:50
      254000 -- (-1153.431) (-1150.551) [-1153.241] (-1152.625) * (-1150.608) (-1150.291) (-1155.436) [-1152.299] -- 0:00:49
      254500 -- (-1151.940) (-1150.184) (-1152.618) [-1150.294] * (-1149.744) [-1155.023] (-1155.094) (-1152.558) -- 0:00:49
      255000 -- (-1150.182) (-1149.520) (-1151.514) [-1151.469] * (-1151.185) (-1150.307) [-1155.545] (-1151.571) -- 0:00:49

      Average standard deviation of split frequencies: 0.015381

      255500 -- [-1148.887] (-1150.782) (-1150.806) (-1151.212) * (-1149.558) (-1152.099) (-1150.808) [-1150.176] -- 0:00:49
      256000 -- (-1148.548) (-1151.696) [-1151.318] (-1151.573) * (-1150.226) (-1152.197) [-1151.226] (-1166.406) -- 0:00:49
      256500 -- (-1149.422) (-1151.938) [-1151.189] (-1151.813) * (-1149.532) [-1150.221] (-1149.134) (-1151.661) -- 0:00:49
      257000 -- (-1149.844) [-1150.617] (-1152.204) (-1154.034) * (-1149.570) [-1151.691] (-1150.426) (-1153.174) -- 0:00:49
      257500 -- (-1151.918) (-1152.209) [-1148.294] (-1150.506) * (-1150.514) (-1151.243) [-1151.179] (-1154.012) -- 0:00:49
      258000 -- [-1148.924] (-1151.220) (-1150.558) (-1151.759) * (-1150.621) (-1156.299) (-1155.360) [-1150.575] -- 0:00:48
      258500 -- (-1150.357) (-1150.131) [-1150.060] (-1151.641) * (-1150.702) [-1150.359] (-1153.791) (-1152.534) -- 0:00:48
      259000 -- (-1149.469) [-1149.150] (-1150.308) (-1152.436) * (-1151.888) [-1150.326] (-1152.885) (-1151.789) -- 0:00:48
      259500 -- (-1150.828) (-1154.811) (-1151.046) [-1149.285] * [-1148.913] (-1151.468) (-1151.758) (-1153.688) -- 0:00:48
      260000 -- [-1151.127] (-1153.449) (-1151.603) (-1150.743) * (-1148.821) (-1150.836) (-1153.879) [-1151.851] -- 0:00:48

      Average standard deviation of split frequencies: 0.014468

      260500 -- (-1149.183) (-1151.613) (-1152.316) [-1150.128] * (-1150.580) [-1149.166] (-1151.950) (-1151.799) -- 0:00:48
      261000 -- (-1150.447) (-1152.855) [-1150.564] (-1150.909) * (-1152.062) (-1149.410) [-1149.952] (-1159.198) -- 0:00:48
      261500 -- (-1149.536) [-1152.029] (-1151.553) (-1150.779) * (-1150.562) [-1148.931] (-1150.568) (-1156.835) -- 0:00:48
      262000 -- (-1149.393) (-1152.785) (-1149.979) [-1151.644] * (-1150.928) [-1152.583] (-1151.339) (-1149.795) -- 0:00:47
      262500 -- (-1151.567) (-1151.156) [-1154.088] (-1156.021) * (-1151.639) (-1151.963) (-1151.671) [-1152.001] -- 0:00:47
      263000 -- (-1150.760) (-1152.554) [-1151.081] (-1155.823) * (-1151.152) (-1151.226) (-1150.085) [-1151.887] -- 0:00:47
      263500 -- (-1150.628) (-1151.364) [-1151.897] (-1152.531) * (-1149.413) (-1150.509) [-1151.308] (-1151.764) -- 0:00:47
      264000 -- [-1150.493] (-1152.392) (-1150.735) (-1149.199) * (-1154.293) (-1151.527) (-1152.222) [-1150.156] -- 0:00:47
      264500 -- (-1151.574) [-1150.687] (-1150.974) (-1150.797) * (-1151.539) [-1150.052] (-1153.071) (-1152.485) -- 0:00:47
      265000 -- [-1150.877] (-1151.735) (-1151.938) (-1153.238) * (-1152.992) [-1149.878] (-1150.024) (-1149.065) -- 0:00:47

      Average standard deviation of split frequencies: 0.014282

      265500 -- (-1149.885) (-1152.982) [-1151.479] (-1151.907) * (-1152.658) (-1152.817) (-1152.746) [-1150.653] -- 0:00:47
      266000 -- (-1148.935) (-1152.675) [-1149.686] (-1152.468) * (-1152.981) (-1149.566) (-1150.824) [-1149.290] -- 0:00:49
      266500 -- (-1151.036) (-1151.156) [-1154.008] (-1150.523) * (-1151.380) [-1151.511] (-1151.855) (-1150.866) -- 0:00:49
      267000 -- (-1150.386) [-1150.277] (-1156.235) (-1150.396) * (-1151.830) [-1151.460] (-1150.214) (-1152.374) -- 0:00:49
      267500 -- [-1153.074] (-1149.397) (-1151.741) (-1150.790) * (-1151.282) [-1151.785] (-1151.371) (-1151.712) -- 0:00:49
      268000 -- [-1150.499] (-1149.635) (-1149.064) (-1148.669) * (-1151.382) (-1150.062) (-1150.497) [-1149.183] -- 0:00:49
      268500 -- (-1148.731) [-1149.965] (-1149.893) (-1151.746) * (-1151.686) (-1150.462) [-1150.989] (-1149.681) -- 0:00:49
      269000 -- (-1153.655) (-1151.161) [-1149.627] (-1150.459) * (-1150.601) (-1152.629) [-1151.609] (-1149.839) -- 0:00:48
      269500 -- (-1152.476) (-1150.143) (-1150.792) [-1153.041] * (-1153.242) (-1152.478) (-1150.015) [-1149.883] -- 0:00:48
      270000 -- [-1150.707] (-1150.710) (-1150.087) (-1151.636) * (-1151.519) (-1153.243) [-1150.116] (-1152.374) -- 0:00:48

      Average standard deviation of split frequencies: 0.012191

      270500 -- (-1152.727) [-1150.200] (-1149.488) (-1153.783) * [-1151.975] (-1150.780) (-1151.155) (-1153.458) -- 0:00:48
      271000 -- (-1152.607) (-1150.423) (-1151.872) [-1152.854] * [-1152.435] (-1151.126) (-1153.623) (-1149.430) -- 0:00:48
      271500 -- (-1151.116) (-1151.428) [-1150.611] (-1150.805) * (-1152.449) [-1150.547] (-1155.526) (-1154.031) -- 0:00:48
      272000 -- (-1157.113) (-1150.600) (-1152.541) [-1149.867] * (-1151.371) (-1151.973) (-1151.330) [-1150.271] -- 0:00:48
      272500 -- (-1151.483) (-1150.542) (-1153.799) [-1149.555] * (-1151.101) (-1150.488) [-1152.364] (-1151.472) -- 0:00:48
      273000 -- (-1151.532) (-1150.154) [-1151.444] (-1150.966) * (-1150.668) [-1152.083] (-1151.020) (-1152.568) -- 0:00:47
      273500 -- (-1151.357) [-1150.492] (-1152.121) (-1150.629) * [-1151.841] (-1151.638) (-1151.520) (-1153.893) -- 0:00:47
      274000 -- (-1153.048) (-1150.761) (-1153.283) [-1148.985] * (-1153.586) [-1152.859] (-1151.809) (-1150.139) -- 0:00:47
      274500 -- (-1152.964) (-1157.079) [-1153.397] (-1149.724) * (-1152.328) (-1150.782) (-1152.793) [-1151.570] -- 0:00:47
      275000 -- (-1152.249) [-1152.877] (-1151.712) (-1151.376) * (-1150.801) (-1149.845) [-1154.621] (-1151.282) -- 0:00:47

      Average standard deviation of split frequencies: 0.013162

      275500 -- (-1153.986) [-1149.414] (-1155.465) (-1152.899) * (-1156.872) (-1150.154) (-1152.093) [-1150.808] -- 0:00:47
      276000 -- (-1155.204) [-1149.737] (-1153.495) (-1150.192) * (-1151.525) [-1149.781] (-1150.848) (-1152.428) -- 0:00:47
      276500 -- (-1150.892) (-1148.896) (-1150.658) [-1151.190] * [-1152.172] (-1152.041) (-1152.214) (-1150.527) -- 0:00:47
      277000 -- [-1151.526] (-1152.331) (-1148.915) (-1153.811) * (-1150.429) [-1151.202] (-1151.156) (-1152.973) -- 0:00:46
      277500 -- [-1153.982] (-1153.470) (-1149.892) (-1150.289) * (-1152.885) (-1150.905) [-1151.068] (-1153.001) -- 0:00:46
      278000 -- (-1151.338) (-1151.441) (-1150.532) [-1149.964] * (-1150.144) (-1155.827) [-1149.384] (-1154.071) -- 0:00:46
      278500 -- (-1152.221) (-1156.134) [-1149.159] (-1150.643) * (-1150.906) (-1150.296) (-1152.417) [-1149.670] -- 0:00:46
      279000 -- (-1154.909) (-1152.586) [-1151.506] (-1153.464) * (-1151.445) (-1152.301) (-1152.460) [-1152.920] -- 0:00:46
      279500 -- (-1151.001) (-1151.183) [-1149.526] (-1157.197) * [-1152.626] (-1150.271) (-1151.609) (-1153.516) -- 0:00:46
      280000 -- (-1150.106) (-1150.121) [-1150.479] (-1151.269) * (-1157.253) (-1151.766) (-1153.939) [-1151.982] -- 0:00:46

      Average standard deviation of split frequencies: 0.014622

      280500 -- (-1150.341) (-1151.311) [-1149.460] (-1153.426) * (-1152.406) (-1151.404) [-1150.957] (-1152.667) -- 0:00:46
      281000 -- (-1149.941) (-1150.884) [-1150.457] (-1149.739) * (-1151.043) [-1151.949] (-1152.452) (-1151.404) -- 0:00:48
      281500 -- (-1150.822) (-1150.660) [-1151.731] (-1149.663) * [-1151.369] (-1152.585) (-1153.289) (-1157.981) -- 0:00:48
      282000 -- (-1151.164) (-1152.647) (-1151.974) [-1152.493] * (-1151.291) [-1151.349] (-1153.368) (-1152.700) -- 0:00:48
      282500 -- [-1150.675] (-1151.417) (-1150.786) (-1148.708) * (-1152.547) (-1151.109) (-1150.027) [-1150.691] -- 0:00:48
      283000 -- (-1157.631) [-1153.453] (-1153.289) (-1154.057) * (-1152.616) (-1149.849) [-1151.947] (-1154.226) -- 0:00:48
      283500 -- (-1150.688) (-1154.888) [-1150.607] (-1153.210) * (-1150.181) (-1154.124) [-1153.355] (-1153.540) -- 0:00:48
      284000 -- (-1151.048) (-1151.947) [-1150.259] (-1149.845) * (-1149.997) [-1150.419] (-1149.618) (-1149.748) -- 0:00:47
      284500 -- (-1151.855) (-1152.508) (-1150.848) [-1150.889] * [-1151.926] (-1150.151) (-1149.701) (-1149.096) -- 0:00:47
      285000 -- (-1149.796) (-1149.111) [-1150.339] (-1150.869) * [-1150.238] (-1150.314) (-1150.589) (-1152.182) -- 0:00:47

      Average standard deviation of split frequencies: 0.014350

      285500 -- (-1152.975) [-1150.731] (-1148.641) (-1153.436) * (-1152.861) [-1153.361] (-1149.862) (-1156.116) -- 0:00:47
      286000 -- (-1149.010) (-1151.278) (-1156.475) [-1151.088] * (-1152.988) (-1155.376) [-1149.871] (-1155.216) -- 0:00:47
      286500 -- (-1150.742) (-1153.636) (-1152.578) [-1151.095] * [-1150.551] (-1154.452) (-1152.096) (-1150.046) -- 0:00:47
      287000 -- (-1151.845) [-1150.695] (-1149.295) (-1152.071) * (-1152.112) [-1155.761] (-1149.444) (-1149.298) -- 0:00:47
      287500 -- (-1152.679) (-1150.504) (-1150.340) [-1149.570] * (-1152.774) (-1155.074) (-1149.903) [-1150.082] -- 0:00:47
      288000 -- [-1150.398] (-1150.446) (-1155.736) (-1150.253) * (-1151.860) [-1152.024] (-1151.387) (-1152.417) -- 0:00:46
      288500 -- (-1150.234) (-1151.488) (-1150.852) [-1150.940] * (-1156.079) (-1152.125) [-1152.251] (-1152.606) -- 0:00:46
      289000 -- (-1151.087) (-1151.997) [-1150.864] (-1154.452) * (-1151.605) [-1150.475] (-1149.684) (-1151.365) -- 0:00:46
      289500 -- (-1150.801) [-1149.220] (-1152.428) (-1151.560) * [-1150.459] (-1149.787) (-1151.492) (-1150.277) -- 0:00:46
      290000 -- (-1149.948) [-1150.025] (-1151.555) (-1152.146) * (-1151.440) [-1150.401] (-1151.287) (-1148.837) -- 0:00:46

      Average standard deviation of split frequencies: 0.014119

      290500 -- (-1149.599) (-1150.293) (-1151.882) [-1150.500] * (-1151.951) [-1149.510] (-1149.475) (-1151.314) -- 0:00:46
      291000 -- (-1154.231) (-1154.418) (-1154.513) [-1152.545] * [-1151.508] (-1151.441) (-1150.700) (-1151.485) -- 0:00:46
      291500 -- (-1150.273) [-1151.644] (-1153.726) (-1150.129) * (-1151.156) (-1150.001) [-1150.891] (-1155.574) -- 0:00:46
      292000 -- (-1151.187) [-1151.483] (-1151.043) (-1149.948) * (-1151.596) [-1151.058] (-1150.367) (-1149.721) -- 0:00:46
      292500 -- (-1151.356) (-1150.848) [-1154.995] (-1149.997) * (-1150.408) (-1149.578) [-1150.235] (-1149.944) -- 0:00:45
      293000 -- (-1151.124) (-1149.570) [-1150.143] (-1157.439) * (-1151.434) [-1149.200] (-1151.348) (-1150.327) -- 0:00:45
      293500 -- (-1151.075) [-1150.159] (-1151.098) (-1158.370) * (-1150.753) [-1148.429] (-1151.373) (-1151.767) -- 0:00:45
      294000 -- (-1150.671) (-1149.894) (-1149.490) [-1151.768] * (-1150.392) (-1151.046) [-1154.029] (-1153.774) -- 0:00:45
      294500 -- [-1149.945] (-1152.606) (-1153.493) (-1152.189) * [-1150.360] (-1150.305) (-1151.053) (-1153.782) -- 0:00:45
      295000 -- (-1151.832) [-1150.055] (-1149.451) (-1152.124) * (-1149.868) (-1152.880) [-1150.956] (-1151.702) -- 0:00:45

      Average standard deviation of split frequencies: 0.013865

      295500 -- (-1151.421) [-1149.677] (-1151.121) (-1153.187) * (-1150.691) [-1153.654] (-1152.070) (-1152.693) -- 0:00:45
      296000 -- (-1153.811) [-1149.355] (-1149.956) (-1152.656) * [-1152.629] (-1153.987) (-1149.085) (-1150.891) -- 0:00:45
      296500 -- (-1152.389) [-1149.910] (-1153.558) (-1150.674) * (-1150.314) (-1156.948) [-1149.918] (-1150.084) -- 0:00:47
      297000 -- (-1150.258) (-1150.302) [-1152.455] (-1148.596) * [-1153.576] (-1150.615) (-1149.257) (-1151.462) -- 0:00:47
      297500 -- [-1150.790] (-1149.401) (-1152.404) (-1153.978) * [-1153.069] (-1150.222) (-1152.065) (-1153.104) -- 0:00:47
      298000 -- (-1148.025) (-1149.327) (-1152.329) [-1153.318] * (-1149.952) (-1152.235) (-1149.383) [-1150.264] -- 0:00:47
      298500 -- (-1149.714) (-1150.077) [-1153.403] (-1157.585) * (-1152.788) (-1150.307) [-1150.429] (-1150.527) -- 0:00:47
      299000 -- [-1149.778] (-1152.448) (-1150.788) (-1149.300) * (-1150.364) (-1150.547) (-1151.994) [-1148.861] -- 0:00:46
      299500 -- (-1155.743) [-1148.825] (-1150.686) (-1151.823) * (-1150.703) [-1150.505] (-1151.700) (-1149.760) -- 0:00:46
      300000 -- (-1150.913) (-1152.961) (-1150.889) [-1149.829] * (-1149.808) (-1155.128) [-1148.909] (-1151.151) -- 0:00:46

      Average standard deviation of split frequencies: 0.014019

      300500 -- [-1153.345] (-1149.804) (-1150.858) (-1154.846) * (-1151.621) (-1151.715) (-1150.940) [-1149.944] -- 0:00:46
      301000 -- (-1152.592) (-1151.620) [-1151.746] (-1149.924) * (-1149.848) (-1154.342) [-1150.830] (-1150.360) -- 0:00:46
      301500 -- (-1151.205) (-1152.842) [-1151.628] (-1149.821) * (-1153.413) (-1154.004) [-1150.825] (-1149.530) -- 0:00:46
      302000 -- [-1151.960] (-1151.614) (-1151.973) (-1155.177) * (-1151.997) [-1153.666] (-1151.024) (-1154.962) -- 0:00:46
      302500 -- [-1151.406] (-1152.500) (-1153.476) (-1152.013) * (-1150.968) (-1151.250) (-1155.358) [-1153.402] -- 0:00:46
      303000 -- (-1151.558) (-1150.675) [-1150.434] (-1156.855) * [-1153.372] (-1151.341) (-1152.376) (-1150.596) -- 0:00:46
      303500 -- [-1151.831] (-1151.744) (-1149.940) (-1156.947) * (-1151.343) (-1153.581) (-1151.439) [-1150.105] -- 0:00:45
      304000 -- (-1150.189) (-1151.029) [-1153.933] (-1152.186) * [-1150.856] (-1151.281) (-1155.422) (-1154.669) -- 0:00:45
      304500 -- (-1154.127) (-1151.428) (-1154.645) [-1150.462] * [-1151.395] (-1153.580) (-1150.800) (-1150.020) -- 0:00:45
      305000 -- (-1149.976) (-1154.302) (-1153.523) [-1151.315] * (-1150.776) [-1150.769] (-1153.825) (-1150.836) -- 0:00:45

      Average standard deviation of split frequencies: 0.014227

      305500 -- (-1155.066) (-1155.637) [-1151.104] (-1151.525) * (-1153.411) [-1149.827] (-1151.448) (-1151.308) -- 0:00:45
      306000 -- (-1150.551) (-1152.558) (-1149.593) [-1150.461] * (-1154.156) (-1156.231) (-1148.704) [-1152.621] -- 0:00:45
      306500 -- (-1152.538) (-1153.554) [-1150.968] (-1149.311) * (-1150.271) (-1154.467) (-1150.341) [-1151.415] -- 0:00:45
      307000 -- (-1151.723) (-1151.250) [-1152.661] (-1150.554) * (-1151.120) (-1154.277) [-1152.553] (-1151.210) -- 0:00:45
      307500 -- (-1152.476) [-1151.818] (-1150.715) (-1153.136) * (-1153.065) (-1150.670) [-1154.434] (-1153.049) -- 0:00:45
      308000 -- [-1150.538] (-1151.806) (-1153.366) (-1151.051) * (-1152.831) (-1148.955) (-1153.613) [-1151.818] -- 0:00:44
      308500 -- (-1152.514) (-1152.665) [-1150.122] (-1155.669) * (-1153.376) (-1148.872) [-1150.239] (-1151.885) -- 0:00:44
      309000 -- (-1152.653) (-1150.641) [-1151.034] (-1153.669) * (-1154.422) (-1152.383) (-1149.781) [-1152.121] -- 0:00:44
      309500 -- (-1150.406) (-1150.692) (-1150.364) [-1149.725] * (-1150.836) [-1150.031] (-1151.114) (-1150.342) -- 0:00:44
      310000 -- (-1151.937) (-1152.006) (-1152.184) [-1150.948] * (-1151.108) (-1152.380) [-1150.297] (-1151.503) -- 0:00:44

      Average standard deviation of split frequencies: 0.013562

      310500 -- [-1151.383] (-1153.542) (-1150.320) (-1150.920) * (-1154.371) (-1150.273) [-1149.772] (-1152.792) -- 0:00:44
      311000 -- (-1152.294) (-1155.018) (-1150.419) [-1152.180] * (-1153.375) (-1152.566) [-1149.239] (-1152.734) -- 0:00:44
      311500 -- (-1151.154) (-1153.010) [-1152.102] (-1149.910) * [-1153.917] (-1151.029) (-1151.395) (-1152.167) -- 0:00:46
      312000 -- (-1151.091) [-1152.077] (-1151.136) (-1149.847) * (-1159.388) [-1152.533] (-1150.268) (-1150.007) -- 0:00:46
      312500 -- (-1150.815) (-1151.705) [-1152.480] (-1151.072) * (-1150.833) (-1150.107) (-1151.625) [-1149.766] -- 0:00:46
      313000 -- [-1149.783] (-1151.817) (-1152.961) (-1149.396) * (-1150.591) (-1152.990) [-1149.921] (-1150.236) -- 0:00:46
      313500 -- [-1150.204] (-1153.184) (-1153.151) (-1151.079) * (-1150.975) [-1153.352] (-1154.260) (-1148.814) -- 0:00:45
      314000 -- [-1152.273] (-1153.057) (-1151.481) (-1152.580) * (-1153.297) (-1149.317) [-1153.145] (-1150.874) -- 0:00:45
      314500 -- (-1150.025) [-1155.476] (-1151.330) (-1150.220) * (-1150.394) (-1150.749) [-1150.729] (-1149.376) -- 0:00:45
      315000 -- [-1154.530] (-1152.510) (-1155.510) (-1150.457) * (-1154.758) [-1153.470] (-1151.868) (-1151.953) -- 0:00:45

      Average standard deviation of split frequencies: 0.013146

      315500 -- (-1150.945) (-1154.527) (-1157.000) [-1149.902] * (-1149.474) (-1155.101) (-1152.556) [-1150.448] -- 0:00:45
      316000 -- (-1152.817) (-1156.771) [-1151.753] (-1150.098) * (-1150.792) [-1149.842] (-1149.177) (-1152.064) -- 0:00:45
      316500 -- [-1150.571] (-1157.075) (-1151.544) (-1150.147) * [-1150.614] (-1153.091) (-1152.807) (-1153.289) -- 0:00:45
      317000 -- (-1151.495) (-1152.731) [-1150.636] (-1155.585) * (-1153.809) (-1150.140) [-1149.206] (-1150.948) -- 0:00:45
      317500 -- (-1150.615) (-1150.998) (-1150.405) [-1152.331] * (-1150.531) [-1151.700] (-1149.822) (-1151.422) -- 0:00:45
      318000 -- (-1150.233) [-1150.208] (-1150.732) (-1154.797) * (-1151.882) (-1150.697) [-1149.673] (-1151.204) -- 0:00:45
      318500 -- [-1151.448] (-1150.186) (-1150.194) (-1152.746) * (-1152.641) (-1151.344) [-1148.905] (-1151.786) -- 0:00:44
      319000 -- (-1151.844) [-1150.081] (-1150.605) (-1152.639) * (-1152.813) (-1151.079) [-1152.197] (-1149.798) -- 0:00:44
      319500 -- [-1150.302] (-1151.167) (-1150.204) (-1151.363) * (-1151.452) (-1152.680) [-1150.030] (-1154.001) -- 0:00:44
      320000 -- (-1149.226) (-1151.512) [-1150.077] (-1156.103) * (-1152.611) [-1149.089] (-1152.615) (-1153.161) -- 0:00:44

      Average standard deviation of split frequencies: 0.012496

      320500 -- (-1151.402) (-1150.853) [-1150.260] (-1151.990) * [-1150.892] (-1148.817) (-1151.845) (-1151.279) -- 0:00:44
      321000 -- (-1153.826) (-1150.876) [-1151.330] (-1150.304) * (-1150.484) [-1150.543] (-1156.488) (-1150.939) -- 0:00:44
      321500 -- [-1150.425] (-1150.174) (-1154.846) (-1150.753) * (-1151.975) [-1150.392] (-1150.069) (-1150.539) -- 0:00:44
      322000 -- (-1151.378) (-1152.364) [-1150.701] (-1150.787) * (-1157.327) (-1150.595) (-1149.842) [-1154.304] -- 0:00:44
      322500 -- (-1151.647) (-1152.164) [-1150.069] (-1149.290) * (-1152.020) (-1150.835) (-1152.785) [-1150.019] -- 0:00:44
      323000 -- (-1153.306) (-1153.908) [-1149.733] (-1154.628) * (-1149.933) [-1153.162] (-1152.131) (-1152.466) -- 0:00:44
      323500 -- (-1151.060) (-1152.481) [-1149.422] (-1149.032) * (-1149.885) (-1149.809) (-1149.430) [-1151.806] -- 0:00:43
      324000 -- (-1150.598) [-1153.501] (-1150.442) (-1150.884) * [-1152.419] (-1149.950) (-1151.395) (-1155.503) -- 0:00:43
      324500 -- [-1149.963] (-1151.258) (-1150.936) (-1152.178) * (-1149.502) [-1151.445] (-1149.967) (-1153.075) -- 0:00:43
      325000 -- (-1152.261) (-1151.360) [-1151.713] (-1151.847) * (-1150.119) (-1150.688) (-1151.292) [-1151.159] -- 0:00:43

      Average standard deviation of split frequencies: 0.012472

      325500 -- [-1148.872] (-1150.775) (-1151.831) (-1152.598) * (-1151.543) (-1153.257) (-1157.289) [-1149.198] -- 0:00:43
      326000 -- (-1152.276) (-1150.811) (-1148.798) [-1150.809] * (-1154.574) [-1149.484] (-1150.593) (-1150.363) -- 0:00:43
      326500 -- [-1151.431] (-1151.707) (-1150.986) (-1153.854) * (-1159.780) [-1149.746] (-1150.449) (-1150.643) -- 0:00:45
      327000 -- (-1150.580) (-1150.056) [-1150.238] (-1154.606) * [-1149.055] (-1154.541) (-1150.723) (-1150.245) -- 0:00:45
      327500 -- (-1151.592) [-1152.279] (-1150.509) (-1150.117) * (-1150.154) (-1150.853) [-1150.694] (-1152.393) -- 0:00:45
      328000 -- (-1152.531) (-1150.292) [-1150.550] (-1149.987) * (-1151.569) (-1150.676) (-1153.025) [-1152.070] -- 0:00:45
      328500 -- (-1153.859) [-1150.465] (-1150.426) (-1149.422) * (-1151.823) (-1151.365) (-1151.849) [-1152.662] -- 0:00:44
      329000 -- (-1151.181) (-1152.917) (-1150.805) [-1149.149] * [-1149.896] (-1154.461) (-1151.077) (-1152.536) -- 0:00:44
      329500 -- (-1150.529) (-1151.265) [-1150.139] (-1150.740) * (-1152.934) (-1156.361) [-1151.995] (-1154.573) -- 0:00:44
      330000 -- (-1149.861) (-1151.810) (-1153.226) [-1151.392] * [-1150.255] (-1152.449) (-1150.274) (-1151.607) -- 0:00:44

      Average standard deviation of split frequencies: 0.012652

      330500 -- (-1151.500) [-1150.993] (-1150.993) (-1155.204) * (-1151.916) (-1150.275) [-1150.405] (-1150.303) -- 0:00:44
      331000 -- (-1151.184) [-1152.845] (-1150.810) (-1155.611) * (-1153.442) (-1151.508) (-1150.923) [-1151.401] -- 0:00:44
      331500 -- (-1154.240) (-1150.965) (-1150.055) [-1150.666] * (-1153.497) (-1150.235) [-1150.418] (-1152.122) -- 0:00:44
      332000 -- (-1150.504) (-1150.597) (-1149.567) [-1151.289] * (-1150.180) (-1150.410) (-1151.857) [-1152.844] -- 0:00:44
      332500 -- (-1150.708) [-1150.470] (-1154.277) (-1153.900) * (-1152.739) (-1150.063) [-1150.633] (-1157.108) -- 0:00:44
      333000 -- (-1151.238) (-1152.342) [-1152.328] (-1154.269) * (-1151.741) (-1150.218) [-1149.356] (-1152.996) -- 0:00:44
      333500 -- [-1151.702] (-1149.793) (-1151.893) (-1153.398) * [-1151.534] (-1150.284) (-1153.471) (-1152.202) -- 0:00:43
      334000 -- (-1149.481) [-1149.654] (-1150.747) (-1151.582) * (-1153.270) (-1150.439) [-1152.805] (-1151.889) -- 0:00:43
      334500 -- (-1150.377) [-1156.076] (-1152.590) (-1151.816) * (-1157.108) [-1152.861] (-1153.039) (-1150.973) -- 0:00:43
      335000 -- (-1149.447) (-1150.501) [-1149.584] (-1154.046) * [-1150.776] (-1151.653) (-1148.911) (-1153.369) -- 0:00:43

      Average standard deviation of split frequencies: 0.013241

      335500 -- (-1149.428) (-1149.972) [-1154.586] (-1153.074) * (-1149.787) (-1154.572) [-1150.721] (-1149.197) -- 0:00:43
      336000 -- (-1151.585) (-1154.801) (-1150.723) [-1149.991] * (-1151.395) (-1152.031) (-1150.944) [-1153.588] -- 0:00:43
      336500 -- (-1154.322) (-1152.949) [-1151.090] (-1150.021) * (-1150.960) (-1152.068) [-1150.172] (-1150.936) -- 0:00:43
      337000 -- (-1149.085) (-1149.087) [-1152.430] (-1155.449) * (-1151.970) (-1149.780) [-1148.735] (-1149.513) -- 0:00:43
      337500 -- (-1149.348) (-1150.724) [-1151.884] (-1155.728) * (-1152.802) (-1149.790) (-1153.020) [-1149.936] -- 0:00:43
      338000 -- (-1150.432) (-1150.065) [-1152.186] (-1150.449) * (-1152.263) (-1149.618) (-1151.504) [-1152.574] -- 0:00:43
      338500 -- (-1149.711) [-1151.142] (-1149.942) (-1154.326) * [-1151.540] (-1153.903) (-1152.578) (-1150.287) -- 0:00:42
      339000 -- (-1149.479) (-1149.678) (-1151.725) [-1149.611] * (-1151.812) (-1153.514) (-1151.211) [-1150.633] -- 0:00:42
      339500 -- (-1151.868) (-1148.893) [-1151.989] (-1150.188) * (-1151.541) [-1153.243] (-1150.939) (-1150.963) -- 0:00:42
      340000 -- (-1153.671) (-1151.742) [-1151.142] (-1151.399) * (-1151.666) (-1153.324) (-1150.500) [-1150.314] -- 0:00:42

      Average standard deviation of split frequencies: 0.013232

      340500 -- (-1152.067) [-1149.753] (-1151.079) (-1150.541) * (-1153.057) (-1157.005) (-1150.107) [-1150.662] -- 0:00:42
      341000 -- (-1150.551) (-1149.330) [-1150.473] (-1148.700) * (-1154.978) (-1152.373) (-1150.404) [-1150.027] -- 0:00:42
      341500 -- (-1150.489) (-1148.527) (-1151.120) [-1151.171] * (-1153.904) [-1151.957] (-1150.150) (-1152.115) -- 0:00:44
      342000 -- (-1150.833) (-1151.941) (-1151.453) [-1154.155] * [-1151.210] (-1153.953) (-1152.288) (-1150.549) -- 0:00:44
      342500 -- (-1152.746) [-1150.250] (-1150.003) (-1154.844) * (-1156.036) [-1150.720] (-1153.453) (-1149.393) -- 0:00:44
      343000 -- [-1149.206] (-1149.239) (-1150.830) (-1154.403) * (-1151.222) [-1150.798] (-1150.629) (-1151.602) -- 0:00:44
      343500 -- (-1150.008) [-1148.495] (-1156.767) (-1155.489) * (-1150.413) (-1151.903) (-1150.408) [-1150.693] -- 0:00:43
      344000 -- (-1151.814) [-1151.494] (-1154.715) (-1153.557) * (-1151.364) (-1151.980) (-1150.969) [-1151.510] -- 0:00:43
      344500 -- (-1149.795) (-1149.726) (-1153.579) [-1151.557] * [-1151.102] (-1148.905) (-1154.478) (-1151.284) -- 0:00:43
      345000 -- (-1151.921) [-1150.276] (-1152.085) (-1153.399) * [-1148.936] (-1149.266) (-1154.188) (-1151.353) -- 0:00:43

      Average standard deviation of split frequencies: 0.012773

      345500 -- (-1152.083) (-1152.009) (-1157.252) [-1154.189] * (-1152.812) (-1149.039) (-1151.094) [-1153.080] -- 0:00:43
      346000 -- (-1152.522) (-1153.508) (-1152.846) [-1151.028] * (-1154.456) (-1149.756) [-1153.382] (-1151.883) -- 0:00:43
      346500 -- (-1153.268) (-1152.302) [-1149.723] (-1150.447) * (-1156.258) (-1151.371) [-1153.202] (-1153.154) -- 0:00:43
      347000 -- (-1149.633) [-1151.156] (-1150.988) (-1150.822) * (-1155.328) [-1152.275] (-1150.759) (-1158.263) -- 0:00:43
      347500 -- (-1149.347) (-1152.086) [-1148.601] (-1152.644) * (-1149.620) (-1151.227) [-1151.100] (-1152.488) -- 0:00:43
      348000 -- [-1152.532] (-1159.657) (-1152.457) (-1151.525) * (-1150.515) (-1150.031) [-1150.619] (-1154.931) -- 0:00:43
      348500 -- (-1151.805) (-1152.108) [-1158.389] (-1150.736) * (-1155.438) [-1147.962] (-1150.732) (-1150.280) -- 0:00:42
      349000 -- (-1151.817) (-1150.099) (-1149.524) [-1150.560] * (-1150.121) (-1155.080) (-1150.141) [-1149.921] -- 0:00:42
      349500 -- (-1151.350) (-1152.914) (-1149.488) [-1150.540] * (-1150.141) [-1154.429] (-1155.331) (-1149.886) -- 0:00:42
      350000 -- (-1153.861) (-1154.902) [-1151.002] (-1148.898) * (-1151.852) [-1149.996] (-1151.592) (-1149.837) -- 0:00:42

      Average standard deviation of split frequencies: 0.012351

      350500 -- (-1153.475) (-1155.156) [-1151.310] (-1153.601) * (-1151.846) (-1149.992) [-1150.436] (-1150.167) -- 0:00:42
      351000 -- (-1153.136) [-1151.958] (-1150.541) (-1153.177) * [-1153.461] (-1151.501) (-1150.821) (-1150.148) -- 0:00:42
      351500 -- (-1151.037) (-1153.411) (-1151.270) [-1151.077] * (-1153.329) (-1151.087) (-1149.049) [-1150.271] -- 0:00:42
      352000 -- (-1148.138) (-1149.823) (-1149.533) [-1150.088] * (-1151.962) (-1150.171) (-1152.055) [-1154.712] -- 0:00:42
      352500 -- [-1151.957] (-1150.952) (-1150.386) (-1150.192) * (-1154.370) (-1153.202) (-1155.292) [-1150.014] -- 0:00:42
      353000 -- [-1151.949] (-1152.455) (-1149.899) (-1150.903) * (-1151.573) [-1154.400] (-1154.814) (-1151.447) -- 0:00:42
      353500 -- (-1153.401) (-1152.714) (-1150.255) [-1151.706] * [-1149.882] (-1150.484) (-1155.249) (-1150.681) -- 0:00:42
      354000 -- [-1149.502] (-1152.383) (-1148.333) (-1151.193) * [-1149.159] (-1151.040) (-1152.721) (-1150.901) -- 0:00:41
      354500 -- (-1150.227) (-1150.824) [-1150.068] (-1149.241) * (-1158.104) (-1153.503) (-1152.536) [-1149.020] -- 0:00:41
      355000 -- (-1154.062) (-1153.306) [-1148.814] (-1152.145) * (-1153.038) [-1151.245] (-1151.067) (-1151.826) -- 0:00:41

      Average standard deviation of split frequencies: 0.011918

      355500 -- (-1155.883) (-1152.781) (-1150.950) [-1150.341] * (-1149.995) [-1151.635] (-1150.891) (-1150.714) -- 0:00:41
      356000 -- (-1156.094) [-1152.772] (-1150.842) (-1153.184) * (-1152.960) (-1153.528) (-1149.885) [-1155.332] -- 0:00:41
      356500 -- (-1153.491) [-1149.503] (-1148.218) (-1151.511) * (-1148.731) (-1151.560) [-1151.015] (-1152.978) -- 0:00:43
      357000 -- (-1150.509) (-1152.366) [-1149.463] (-1151.075) * (-1151.503) [-1149.962] (-1152.487) (-1152.642) -- 0:00:43
      357500 -- [-1150.863] (-1152.814) (-1151.521) (-1150.361) * (-1151.489) [-1150.603] (-1151.032) (-1149.497) -- 0:00:43
      358000 -- (-1151.575) (-1150.741) [-1151.594] (-1151.148) * [-1152.574] (-1150.704) (-1150.345) (-1150.297) -- 0:00:43
      358500 -- [-1152.105] (-1150.925) (-1150.120) (-1149.557) * (-1152.922) [-1149.504] (-1149.795) (-1152.634) -- 0:00:42
      359000 -- (-1150.609) (-1150.387) [-1150.851] (-1149.996) * [-1148.814] (-1150.841) (-1160.423) (-1152.398) -- 0:00:42
      359500 -- (-1152.866) (-1151.238) [-1154.920] (-1149.068) * (-1150.703) [-1152.154] (-1154.870) (-1150.578) -- 0:00:42
      360000 -- [-1157.839] (-1151.894) (-1151.656) (-1151.001) * [-1150.726] (-1155.525) (-1151.155) (-1149.216) -- 0:00:42

      Average standard deviation of split frequencies: 0.012090

      360500 -- (-1155.390) [-1152.376] (-1150.889) (-1151.502) * (-1153.863) (-1152.120) [-1151.896] (-1150.903) -- 0:00:42
      361000 -- (-1150.845) (-1151.149) [-1148.969] (-1152.402) * [-1150.691] (-1148.988) (-1149.801) (-1152.506) -- 0:00:42
      361500 -- (-1150.641) [-1153.166] (-1153.807) (-1150.436) * (-1152.943) (-1150.253) (-1153.353) [-1150.934] -- 0:00:42
      362000 -- [-1151.243] (-1150.284) (-1153.392) (-1150.348) * (-1152.012) (-1154.870) [-1152.752] (-1155.726) -- 0:00:42
      362500 -- (-1151.594) (-1152.167) [-1152.012] (-1152.683) * (-1152.217) (-1151.988) [-1151.742] (-1151.156) -- 0:00:42
      363000 -- [-1150.275] (-1151.825) (-1151.346) (-1148.953) * (-1150.105) [-1150.986] (-1150.689) (-1153.375) -- 0:00:42
      363500 -- (-1148.999) (-1153.397) [-1148.387] (-1150.697) * [-1150.499] (-1154.508) (-1153.866) (-1152.422) -- 0:00:42
      364000 -- [-1150.158] (-1154.254) (-1148.755) (-1150.697) * [-1149.882] (-1152.744) (-1153.413) (-1148.810) -- 0:00:41
      364500 -- (-1154.656) [-1150.761] (-1149.611) (-1154.609) * (-1150.422) (-1151.437) [-1150.958] (-1150.085) -- 0:00:41
      365000 -- (-1149.782) (-1150.213) (-1150.520) [-1151.377] * [-1152.625] (-1150.382) (-1152.619) (-1150.602) -- 0:00:41

      Average standard deviation of split frequencies: 0.012960

      365500 -- (-1150.147) (-1150.649) [-1152.313] (-1150.412) * (-1153.061) (-1149.307) (-1154.309) [-1149.888] -- 0:00:41
      366000 -- (-1149.206) (-1151.000) (-1152.151) [-1151.010] * [-1150.616] (-1151.580) (-1151.470) (-1152.258) -- 0:00:41
      366500 -- (-1153.485) (-1153.164) (-1152.315) [-1152.129] * (-1150.735) (-1152.002) [-1151.923] (-1150.907) -- 0:00:41
      367000 -- (-1150.737) [-1152.685] (-1152.241) (-1150.794) * [-1151.184] (-1149.370) (-1149.730) (-1151.857) -- 0:00:41
      367500 -- (-1149.028) (-1154.540) [-1150.012] (-1151.064) * (-1150.357) (-1150.418) [-1152.392] (-1153.663) -- 0:00:41
      368000 -- (-1149.049) (-1150.994) [-1149.848] (-1151.328) * (-1149.865) (-1151.495) [-1150.362] (-1152.182) -- 0:00:41
      368500 -- (-1149.078) (-1151.535) (-1148.349) [-1150.052] * [-1153.966] (-1155.076) (-1153.769) (-1151.693) -- 0:00:41
      369000 -- (-1153.178) (-1151.235) (-1152.066) [-1150.247] * (-1154.423) [-1152.452] (-1154.483) (-1155.436) -- 0:00:41
      369500 -- (-1150.724) (-1152.296) [-1149.419] (-1151.688) * [-1150.948] (-1153.216) (-1151.864) (-1152.225) -- 0:00:40
      370000 -- (-1150.350) (-1151.523) [-1148.900] (-1154.528) * (-1154.380) [-1150.024] (-1152.728) (-1153.036) -- 0:00:40

      Average standard deviation of split frequencies: 0.012718

      370500 -- (-1151.659) (-1150.034) (-1150.855) [-1151.416] * [-1152.786] (-1154.991) (-1155.201) (-1152.516) -- 0:00:40
      371000 -- [-1150.336] (-1152.022) (-1150.277) (-1151.122) * (-1150.159) (-1150.588) (-1153.251) [-1152.204] -- 0:00:40
      371500 -- [-1148.328] (-1151.704) (-1156.946) (-1151.176) * [-1149.239] (-1151.441) (-1153.244) (-1153.652) -- 0:00:42
      372000 -- [-1150.267] (-1153.764) (-1149.906) (-1153.634) * (-1152.875) (-1151.631) (-1152.814) [-1152.339] -- 0:00:42
      372500 -- [-1150.191] (-1153.591) (-1152.177) (-1155.811) * (-1153.770) (-1149.104) (-1151.031) [-1150.983] -- 0:00:42
      373000 -- (-1153.920) (-1149.986) [-1150.301] (-1152.417) * (-1152.122) (-1151.351) (-1153.053) [-1151.286] -- 0:00:42
      373500 -- (-1151.992) (-1151.589) [-1151.372] (-1150.883) * (-1152.624) (-1150.487) [-1151.341] (-1155.420) -- 0:00:41
      374000 -- (-1150.567) [-1151.008] (-1150.787) (-1150.775) * [-1150.707] (-1153.077) (-1152.170) (-1151.847) -- 0:00:41
      374500 -- (-1150.853) [-1150.608] (-1151.305) (-1151.978) * (-1151.310) (-1155.612) (-1151.333) [-1151.643] -- 0:00:41
      375000 -- [-1151.055] (-1152.100) (-1152.801) (-1149.507) * [-1150.747] (-1150.159) (-1151.945) (-1149.871) -- 0:00:41

      Average standard deviation of split frequencies: 0.013164

      375500 -- (-1152.392) [-1149.807] (-1151.136) (-1152.919) * (-1152.703) (-1153.202) (-1150.006) [-1149.512] -- 0:00:41
      376000 -- (-1151.745) (-1149.868) [-1150.673] (-1154.774) * (-1156.175) (-1148.981) (-1150.526) [-1150.620] -- 0:00:41
      376500 -- [-1152.615] (-1149.117) (-1153.057) (-1152.953) * [-1151.125] (-1151.553) (-1148.424) (-1152.350) -- 0:00:41
      377000 -- (-1153.110) [-1148.135] (-1153.136) (-1154.093) * (-1152.131) (-1151.635) [-1148.944] (-1152.348) -- 0:00:41
      377500 -- [-1153.012] (-1150.997) (-1151.599) (-1152.860) * (-1150.401) (-1150.616) [-1151.571] (-1151.766) -- 0:00:41
      378000 -- (-1150.743) [-1150.886] (-1151.278) (-1151.847) * (-1151.028) (-1152.931) [-1150.294] (-1150.774) -- 0:00:41
      378500 -- (-1152.354) [-1149.857] (-1151.005) (-1150.144) * [-1149.942] (-1154.003) (-1150.560) (-1151.438) -- 0:00:41
      379000 -- (-1152.342) (-1150.894) [-1150.668] (-1150.408) * (-1149.334) (-1150.102) (-1149.589) [-1151.537] -- 0:00:40
      379500 -- (-1151.776) (-1152.811) (-1151.750) [-1152.356] * (-1150.730) [-1150.280] (-1148.894) (-1151.846) -- 0:00:40
      380000 -- (-1152.761) (-1151.539) (-1152.134) [-1151.639] * (-1150.597) (-1150.643) (-1154.391) [-1154.249] -- 0:00:40

      Average standard deviation of split frequencies: 0.013080

      380500 -- (-1150.623) (-1152.191) [-1151.459] (-1150.847) * (-1149.738) (-1150.657) (-1151.504) [-1153.072] -- 0:00:40
      381000 -- (-1149.766) [-1151.592] (-1151.758) (-1151.979) * (-1149.585) (-1149.799) [-1150.418] (-1153.166) -- 0:00:40
      381500 -- (-1152.540) (-1150.475) (-1150.880) [-1150.302] * (-1151.398) [-1149.447] (-1152.008) (-1151.215) -- 0:00:40
      382000 -- [-1151.830] (-1153.766) (-1152.239) (-1151.778) * [-1155.343] (-1149.758) (-1150.101) (-1148.956) -- 0:00:40
      382500 -- (-1151.684) [-1152.653] (-1151.249) (-1155.005) * (-1152.791) (-1149.201) [-1148.495] (-1152.485) -- 0:00:40
      383000 -- (-1150.367) (-1154.050) [-1155.160] (-1152.920) * (-1151.717) (-1150.721) (-1150.598) [-1150.550] -- 0:00:40
      383500 -- (-1150.243) (-1154.111) (-1151.897) [-1155.398] * [-1151.417] (-1150.406) (-1150.884) (-1154.023) -- 0:00:40
      384000 -- (-1150.837) (-1153.559) (-1151.444) [-1150.599] * (-1153.971) (-1151.545) (-1152.120) [-1152.738] -- 0:00:40
      384500 -- (-1152.177) (-1153.136) (-1152.148) [-1151.465] * (-1153.894) (-1148.887) (-1149.367) [-1150.954] -- 0:00:40
      385000 -- (-1151.947) (-1153.826) [-1151.900] (-1150.285) * [-1150.786] (-1150.328) (-1148.331) (-1152.160) -- 0:00:39

      Average standard deviation of split frequencies: 0.013281

      385500 -- (-1152.038) (-1151.601) (-1151.859) [-1151.332] * (-1151.993) [-1149.594] (-1151.568) (-1151.070) -- 0:00:39
      386000 -- [-1153.678] (-1151.408) (-1150.962) (-1150.604) * (-1153.381) [-1148.352] (-1152.645) (-1151.517) -- 0:00:39
      386500 -- (-1152.689) (-1149.178) (-1154.293) [-1150.588] * (-1158.065) (-1154.627) [-1149.214] (-1152.651) -- 0:00:41
      387000 -- (-1151.087) (-1149.089) (-1150.579) [-1151.064] * (-1150.546) (-1151.163) (-1152.040) [-1150.247] -- 0:00:41
      387500 -- [-1150.722] (-1149.532) (-1151.746) (-1150.302) * (-1152.564) [-1151.506] (-1152.773) (-1150.627) -- 0:00:41
      388000 -- [-1150.411] (-1152.107) (-1149.820) (-1149.589) * (-1152.158) [-1150.713] (-1155.192) (-1150.548) -- 0:00:41
      388500 -- (-1150.618) [-1152.577] (-1148.976) (-1151.110) * (-1150.637) (-1150.177) (-1151.130) [-1151.591] -- 0:00:40
      389000 -- (-1150.434) [-1151.140] (-1150.483) (-1155.056) * [-1151.359] (-1151.300) (-1152.633) (-1150.414) -- 0:00:40
      389500 -- [-1153.409] (-1150.554) (-1151.085) (-1151.430) * (-1152.065) (-1150.812) (-1153.402) [-1152.052] -- 0:00:40
      390000 -- (-1154.944) [-1149.124] (-1151.569) (-1150.854) * [-1151.285] (-1150.614) (-1154.313) (-1156.613) -- 0:00:40

      Average standard deviation of split frequencies: 0.014028

      390500 -- [-1151.800] (-1150.477) (-1152.344) (-1154.196) * [-1148.997] (-1151.383) (-1150.183) (-1151.617) -- 0:00:40
      391000 -- (-1152.841) (-1151.885) (-1155.229) [-1150.707] * [-1149.848] (-1153.461) (-1149.970) (-1149.317) -- 0:00:40
      391500 -- (-1153.417) [-1152.574] (-1153.694) (-1152.133) * [-1149.758] (-1154.612) (-1148.624) (-1149.836) -- 0:00:40
      392000 -- (-1151.880) (-1150.296) (-1150.230) [-1154.575] * (-1151.106) (-1149.109) (-1149.242) [-1149.607] -- 0:00:40
      392500 -- (-1151.241) (-1154.309) [-1152.770] (-1153.230) * [-1151.626] (-1156.828) (-1151.928) (-1152.144) -- 0:00:40
      393000 -- (-1151.783) (-1148.747) [-1157.242] (-1151.470) * (-1151.478) [-1150.569] (-1149.620) (-1152.835) -- 0:00:40
      393500 -- (-1150.573) (-1148.579) (-1157.258) [-1149.745] * (-1152.289) [-1152.165] (-1153.243) (-1152.001) -- 0:00:40
      394000 -- (-1152.708) (-1150.401) [-1151.237] (-1153.184) * (-1152.822) [-1151.649] (-1150.818) (-1150.434) -- 0:00:39
      394500 -- (-1150.676) [-1153.235] (-1150.107) (-1151.563) * [-1153.518] (-1153.926) (-1151.848) (-1154.970) -- 0:00:39
      395000 -- (-1152.251) [-1152.285] (-1150.643) (-1151.808) * (-1153.134) (-1153.255) [-1149.268] (-1150.572) -- 0:00:39

      Average standard deviation of split frequencies: 0.013987

      395500 -- [-1151.516] (-1153.987) (-1150.476) (-1150.542) * (-1150.030) (-1152.503) [-1150.418] (-1154.246) -- 0:00:39
      396000 -- (-1150.727) (-1152.456) [-1153.867] (-1151.136) * (-1150.601) (-1151.180) [-1149.619] (-1154.495) -- 0:00:39
      396500 -- (-1152.780) [-1148.966] (-1151.898) (-1152.763) * (-1150.285) (-1150.357) [-1150.036] (-1149.873) -- 0:00:39
      397000 -- (-1151.158) (-1149.770) [-1152.824] (-1152.071) * (-1154.603) (-1150.765) (-1153.328) [-1150.000] -- 0:00:39
      397500 -- [-1150.725] (-1150.128) (-1150.413) (-1154.500) * (-1153.120) (-1154.601) [-1150.475] (-1152.725) -- 0:00:39
      398000 -- (-1150.556) (-1152.177) (-1150.204) [-1152.956] * [-1148.159] (-1152.160) (-1149.724) (-1150.074) -- 0:00:39
      398500 -- (-1150.070) (-1152.664) [-1150.510] (-1150.997) * (-1153.530) (-1152.750) (-1150.825) [-1150.830] -- 0:00:39
      399000 -- (-1151.272) (-1152.760) [-1149.963] (-1152.410) * (-1150.231) [-1150.284] (-1152.297) (-1151.939) -- 0:00:39
      399500 -- (-1152.424) (-1153.459) [-1151.868] (-1150.958) * (-1147.673) (-1148.760) [-1150.584] (-1152.437) -- 0:00:39
      400000 -- (-1150.706) [-1151.812] (-1149.703) (-1151.533) * [-1147.747] (-1155.088) (-1151.231) (-1150.735) -- 0:00:39

      Average standard deviation of split frequencies: 0.012942

      400500 -- (-1151.831) (-1151.028) (-1151.054) [-1153.048] * (-1150.837) (-1155.687) (-1153.939) [-1152.039] -- 0:00:38
      401000 -- (-1150.632) (-1150.343) (-1150.782) [-1150.103] * (-1150.476) (-1151.592) [-1148.022] (-1151.763) -- 0:00:38
      401500 -- (-1152.352) [-1151.253] (-1150.346) (-1153.259) * (-1153.106) [-1149.898] (-1149.497) (-1150.869) -- 0:00:40
      402000 -- (-1153.253) (-1151.527) (-1149.775) [-1151.533] * (-1150.750) [-1150.812] (-1150.513) (-1150.364) -- 0:00:40
      402500 -- (-1151.490) [-1149.778] (-1152.464) (-1150.639) * [-1152.334] (-1151.541) (-1152.650) (-1159.226) -- 0:00:40
      403000 -- (-1150.520) (-1149.899) (-1152.454) [-1150.497] * (-1148.453) (-1149.483) [-1150.858] (-1151.117) -- 0:00:39
      403500 -- (-1150.911) [-1150.402] (-1155.105) (-1154.508) * (-1151.690) (-1161.527) [-1150.785] (-1150.405) -- 0:00:39
      404000 -- (-1149.574) (-1148.787) [-1154.360] (-1152.107) * (-1153.430) (-1152.881) (-1150.115) [-1150.661] -- 0:00:39
      404500 -- [-1150.933] (-1151.805) (-1153.809) (-1150.959) * (-1152.281) (-1151.632) (-1149.672) [-1150.212] -- 0:00:39
      405000 -- (-1151.040) (-1151.867) (-1156.531) [-1153.664] * [-1151.853] (-1152.634) (-1148.192) (-1154.465) -- 0:00:39

      Average standard deviation of split frequencies: 0.013353

      405500 -- (-1151.208) (-1154.063) [-1150.166] (-1153.744) * (-1151.698) [-1155.015] (-1150.841) (-1153.209) -- 0:00:39
      406000 -- [-1152.866] (-1154.754) (-1149.495) (-1151.308) * (-1154.518) (-1151.174) [-1152.400] (-1151.548) -- 0:00:39
      406500 -- (-1153.339) (-1155.267) [-1148.993] (-1150.021) * (-1150.902) (-1150.849) [-1152.428] (-1152.296) -- 0:00:39
      407000 -- [-1153.102] (-1152.876) (-1152.531) (-1154.070) * (-1150.208) (-1151.279) [-1152.474] (-1151.239) -- 0:00:39
      407500 -- (-1151.211) (-1151.880) (-1150.216) [-1150.257] * (-1150.396) (-1151.476) (-1150.336) [-1151.428] -- 0:00:39
      408000 -- (-1153.086) (-1151.005) [-1152.768] (-1150.453) * (-1151.152) (-1151.110) [-1150.508] (-1150.636) -- 0:00:39
      408500 -- (-1149.879) (-1152.108) (-1150.613) [-1151.917] * (-1150.774) (-1153.775) [-1150.516] (-1152.290) -- 0:00:39
      409000 -- (-1151.863) (-1152.344) (-1150.801) [-1150.449] * (-1152.794) (-1150.533) (-1150.303) [-1150.798] -- 0:00:39
      409500 -- (-1149.907) (-1150.392) [-1150.152] (-1151.398) * (-1152.211) [-1149.926] (-1153.000) (-1149.672) -- 0:00:38
      410000 -- (-1155.886) [-1150.757] (-1151.206) (-1152.615) * [-1150.187] (-1150.675) (-1150.647) (-1152.483) -- 0:00:38

      Average standard deviation of split frequencies: 0.013703

      410500 -- (-1150.822) [-1153.375] (-1150.912) (-1150.096) * (-1150.198) [-1149.776] (-1151.361) (-1150.625) -- 0:00:38
      411000 -- (-1152.379) [-1150.774] (-1153.707) (-1152.953) * (-1150.511) (-1156.048) (-1150.666) [-1152.362] -- 0:00:38
      411500 -- [-1151.679] (-1150.075) (-1154.105) (-1153.760) * [-1151.441] (-1153.356) (-1150.650) (-1150.502) -- 0:00:38
      412000 -- (-1150.831) [-1150.447] (-1150.860) (-1156.504) * (-1152.198) (-1155.026) [-1149.456] (-1151.553) -- 0:00:38
      412500 -- (-1150.645) [-1150.619] (-1151.404) (-1152.298) * (-1153.279) (-1154.514) (-1150.934) [-1154.166] -- 0:00:38
      413000 -- (-1150.098) [-1149.763] (-1150.756) (-1151.001) * (-1151.170) [-1151.296] (-1149.440) (-1151.651) -- 0:00:38
      413500 -- (-1151.212) (-1154.511) (-1149.693) [-1155.416] * (-1150.164) [-1149.790] (-1151.671) (-1151.333) -- 0:00:38
      414000 -- (-1154.051) [-1150.655] (-1150.257) (-1155.170) * (-1150.448) (-1149.847) [-1152.590] (-1150.903) -- 0:00:38
      414500 -- [-1151.722] (-1150.148) (-1149.436) (-1150.046) * (-1151.385) [-1151.884] (-1150.775) (-1153.247) -- 0:00:38
      415000 -- (-1152.245) [-1150.902] (-1150.925) (-1151.373) * (-1154.539) [-1151.517] (-1150.667) (-1151.519) -- 0:00:38

      Average standard deviation of split frequencies: 0.013598

      415500 -- (-1152.921) (-1150.637) (-1152.093) [-1150.730] * (-1150.804) (-1150.658) (-1150.195) [-1150.087] -- 0:00:37
      416000 -- (-1153.842) (-1151.055) [-1150.989] (-1151.408) * (-1153.302) (-1150.619) [-1152.577] (-1152.186) -- 0:00:37
      416500 -- (-1150.964) (-1151.515) (-1152.614) [-1151.257] * (-1153.605) (-1152.612) (-1148.722) [-1150.859] -- 0:00:39
      417000 -- (-1151.177) (-1153.482) [-1150.222] (-1149.765) * (-1154.842) (-1155.858) (-1149.190) [-1149.823] -- 0:00:39
      417500 -- (-1153.932) (-1150.792) [-1148.678] (-1154.190) * (-1150.253) [-1150.955] (-1149.288) (-1150.959) -- 0:00:39
      418000 -- [-1150.741] (-1152.167) (-1150.612) (-1153.753) * (-1149.891) (-1151.788) [-1150.995] (-1151.200) -- 0:00:38
      418500 -- [-1150.127] (-1151.264) (-1151.495) (-1152.715) * (-1150.036) (-1156.311) [-1148.951] (-1155.599) -- 0:00:38
      419000 -- [-1149.669] (-1152.639) (-1155.161) (-1153.928) * [-1149.153] (-1150.916) (-1154.961) (-1153.487) -- 0:00:38
      419500 -- [-1150.451] (-1152.909) (-1149.116) (-1154.303) * [-1151.043] (-1151.398) (-1150.592) (-1149.694) -- 0:00:38
      420000 -- [-1156.159] (-1150.971) (-1151.463) (-1155.107) * (-1150.495) (-1150.301) (-1149.902) [-1148.970] -- 0:00:38

      Average standard deviation of split frequencies: 0.013377

      420500 -- [-1150.554] (-1152.589) (-1149.952) (-1152.348) * (-1150.775) [-1150.800] (-1158.076) (-1150.797) -- 0:00:38
      421000 -- (-1151.907) (-1151.394) [-1149.903] (-1150.665) * (-1150.295) (-1154.351) [-1151.220] (-1149.701) -- 0:00:38
      421500 -- (-1154.848) (-1149.668) [-1154.161] (-1150.005) * (-1153.894) (-1157.132) [-1149.269] (-1150.964) -- 0:00:38
      422000 -- (-1150.662) (-1155.164) [-1152.555] (-1149.984) * (-1151.087) (-1150.653) [-1149.160] (-1150.031) -- 0:00:38
      422500 -- (-1155.167) [-1152.131] (-1148.029) (-1150.727) * [-1150.757] (-1153.585) (-1150.526) (-1152.579) -- 0:00:38
      423000 -- (-1150.984) (-1151.113) [-1149.694] (-1151.191) * (-1153.727) (-1152.489) (-1150.796) [-1149.069] -- 0:00:38
      423500 -- (-1152.388) [-1149.962] (-1153.004) (-1151.731) * [-1153.199] (-1154.012) (-1152.676) (-1151.610) -- 0:00:38
      424000 -- (-1151.843) (-1153.018) [-1150.460] (-1149.714) * (-1157.694) (-1151.154) (-1152.567) [-1150.425] -- 0:00:38
      424500 -- (-1151.400) [-1150.914] (-1151.852) (-1149.540) * (-1155.268) (-1153.828) [-1151.000] (-1150.571) -- 0:00:37
      425000 -- [-1149.315] (-1150.430) (-1155.697) (-1151.872) * (-1153.515) [-1153.116] (-1160.279) (-1152.535) -- 0:00:37

      Average standard deviation of split frequencies: 0.012518

      425500 -- [-1149.801] (-1150.258) (-1153.276) (-1150.429) * (-1151.839) [-1150.747] (-1156.564) (-1152.105) -- 0:00:37
      426000 -- (-1149.587) (-1149.123) (-1153.630) [-1149.438] * [-1150.165] (-1150.169) (-1157.319) (-1152.130) -- 0:00:37
      426500 -- [-1151.085] (-1152.047) (-1156.119) (-1149.768) * (-1149.482) [-1153.640] (-1150.899) (-1151.439) -- 0:00:37
      427000 -- (-1151.343) (-1151.401) (-1151.590) [-1150.924] * (-1153.869) [-1149.795] (-1150.555) (-1152.018) -- 0:00:37
      427500 -- [-1151.495] (-1152.567) (-1150.694) (-1150.781) * (-1150.355) (-1150.848) [-1152.696] (-1151.901) -- 0:00:37
      428000 -- (-1150.436) [-1150.800] (-1154.764) (-1149.302) * (-1152.500) [-1150.878] (-1151.223) (-1151.843) -- 0:00:37
      428500 -- [-1150.940] (-1151.266) (-1150.634) (-1150.220) * (-1151.986) [-1152.052] (-1150.596) (-1151.516) -- 0:00:37
      429000 -- (-1151.625) (-1150.848) (-1151.766) [-1150.564] * [-1152.153] (-1151.976) (-1151.859) (-1154.486) -- 0:00:37
      429500 -- [-1150.075] (-1150.551) (-1150.301) (-1148.825) * (-1152.513) (-1154.015) (-1152.201) [-1148.849] -- 0:00:37
      430000 -- (-1150.667) (-1152.381) (-1149.753) [-1150.367] * (-1152.771) [-1150.672] (-1152.055) (-1150.677) -- 0:00:37

      Average standard deviation of split frequencies: 0.012109

      430500 -- (-1150.322) (-1151.087) [-1151.792] (-1155.798) * (-1152.559) (-1154.608) [-1150.534] (-1149.759) -- 0:00:37
      431000 -- (-1154.233) (-1151.422) [-1151.007] (-1150.476) * (-1153.476) (-1150.871) (-1150.060) [-1149.998] -- 0:00:36
      431500 -- (-1150.239) (-1153.452) (-1152.832) [-1149.338] * (-1150.383) (-1151.825) (-1151.712) [-1148.434] -- 0:00:36
      432000 -- (-1157.208) [-1151.327] (-1149.663) (-1149.280) * (-1150.079) (-1149.854) (-1154.698) [-1150.424] -- 0:00:38
      432500 -- (-1155.532) [-1154.331] (-1154.006) (-1151.573) * (-1149.386) (-1148.934) [-1151.766] (-1148.932) -- 0:00:38
      433000 -- (-1151.091) (-1154.797) (-1150.526) [-1150.370] * (-1150.345) (-1152.203) (-1150.778) [-1148.670] -- 0:00:37
      433500 -- (-1151.031) (-1156.960) (-1152.065) [-1151.739] * [-1151.280] (-1152.598) (-1150.789) (-1150.019) -- 0:00:37
      434000 -- (-1152.341) (-1156.396) [-1150.318] (-1151.488) * (-1151.091) [-1151.055] (-1152.695) (-1156.218) -- 0:00:37
      434500 -- (-1152.281) (-1151.372) (-1148.653) [-1152.302] * [-1149.430] (-1150.488) (-1153.134) (-1152.619) -- 0:00:37
      435000 -- (-1153.308) [-1150.591] (-1152.338) (-1151.885) * [-1149.120] (-1150.554) (-1152.720) (-1153.067) -- 0:00:37

      Average standard deviation of split frequencies: 0.012028

      435500 -- [-1151.350] (-1152.835) (-1151.979) (-1151.983) * [-1149.157] (-1150.782) (-1151.511) (-1152.014) -- 0:00:37
      436000 -- (-1151.587) [-1155.181] (-1150.258) (-1150.633) * (-1150.264) (-1155.443) (-1151.354) [-1157.559] -- 0:00:37
      436500 -- [-1154.131] (-1153.581) (-1149.698) (-1149.743) * [-1150.618] (-1150.972) (-1150.225) (-1154.070) -- 0:00:37
      437000 -- (-1155.997) (-1154.648) (-1152.259) [-1152.357] * [-1151.446] (-1157.892) (-1153.156) (-1152.382) -- 0:00:37
      437500 -- (-1151.964) [-1155.397] (-1153.596) (-1151.700) * (-1148.705) [-1153.947] (-1155.114) (-1153.826) -- 0:00:37
      438000 -- (-1149.571) [-1151.278] (-1152.131) (-1150.940) * [-1148.643] (-1151.680) (-1151.670) (-1151.627) -- 0:00:37
      438500 -- [-1151.748] (-1150.497) (-1151.801) (-1151.298) * [-1150.019] (-1150.294) (-1151.890) (-1154.406) -- 0:00:37
      439000 -- (-1151.302) (-1152.255) [-1151.532] (-1150.763) * (-1149.635) [-1150.847] (-1149.965) (-1152.458) -- 0:00:37
      439500 -- [-1151.296] (-1151.234) (-1153.451) (-1150.823) * (-1151.133) (-1154.061) [-1151.398] (-1150.806) -- 0:00:36
      440000 -- (-1157.790) (-1153.574) (-1153.928) [-1149.964] * (-1156.001) (-1151.377) [-1150.020] (-1150.816) -- 0:00:36

      Average standard deviation of split frequencies: 0.012369

      440500 -- (-1150.237) (-1151.443) (-1150.523) [-1149.283] * (-1149.512) [-1150.717] (-1154.985) (-1153.150) -- 0:00:36
      441000 -- (-1150.128) [-1150.100] (-1150.395) (-1149.878) * (-1152.832) [-1150.617] (-1151.214) (-1150.764) -- 0:00:36
      441500 -- [-1151.267] (-1151.446) (-1149.056) (-1153.413) * (-1151.940) (-1150.957) (-1151.677) [-1149.422] -- 0:00:36
      442000 -- (-1152.885) [-1152.119] (-1152.844) (-1150.974) * (-1149.353) [-1149.172] (-1151.049) (-1153.944) -- 0:00:36
      442500 -- (-1152.342) [-1151.824] (-1150.158) (-1154.607) * [-1152.552] (-1149.655) (-1150.448) (-1152.042) -- 0:00:36
      443000 -- [-1150.640] (-1152.553) (-1151.585) (-1148.316) * (-1154.111) [-1154.281] (-1151.268) (-1155.578) -- 0:00:36
      443500 -- (-1152.972) [-1153.746] (-1149.370) (-1151.109) * [-1153.656] (-1153.214) (-1152.151) (-1150.684) -- 0:00:36
      444000 -- [-1149.632] (-1150.299) (-1149.947) (-1151.548) * [-1149.566] (-1149.829) (-1151.589) (-1154.398) -- 0:00:36
      444500 -- [-1149.261] (-1151.228) (-1148.897) (-1152.383) * [-1149.729] (-1155.582) (-1151.435) (-1154.644) -- 0:00:36
      445000 -- (-1152.526) (-1151.021) (-1154.855) [-1149.987] * (-1150.552) [-1152.369] (-1151.033) (-1148.607) -- 0:00:36

      Average standard deviation of split frequencies: 0.012485

      445500 -- [-1149.745] (-1151.743) (-1150.623) (-1151.474) * (-1150.128) [-1155.463] (-1151.603) (-1150.332) -- 0:00:36
      446000 -- [-1150.531] (-1149.790) (-1155.851) (-1151.679) * (-1152.050) (-1154.800) [-1149.946] (-1152.012) -- 0:00:36
      446500 -- [-1152.499] (-1151.404) (-1156.245) (-1150.326) * (-1153.943) [-1151.357] (-1150.190) (-1155.788) -- 0:00:35
      447000 -- (-1149.720) [-1153.077] (-1150.569) (-1151.543) * (-1150.749) [-1150.828] (-1151.393) (-1150.201) -- 0:00:37
      447500 -- (-1150.956) (-1157.386) [-1153.539] (-1150.161) * (-1149.188) [-1151.308] (-1152.503) (-1151.732) -- 0:00:37
      448000 -- (-1152.149) [-1150.741] (-1150.894) (-1155.418) * [-1149.951] (-1150.622) (-1152.238) (-1153.144) -- 0:00:36
      448500 -- (-1151.848) [-1150.593] (-1152.590) (-1150.845) * [-1150.350] (-1151.754) (-1151.512) (-1150.441) -- 0:00:36
      449000 -- (-1150.337) [-1150.558] (-1148.741) (-1150.242) * (-1150.470) (-1155.176) (-1157.014) [-1151.519] -- 0:00:36
      449500 -- (-1151.910) [-1149.494] (-1149.383) (-1152.402) * (-1153.113) (-1149.846) (-1150.079) [-1151.071] -- 0:00:36
      450000 -- (-1150.957) [-1149.923] (-1151.458) (-1153.617) * [-1149.269] (-1153.055) (-1150.954) (-1154.137) -- 0:00:36

      Average standard deviation of split frequencies: 0.012291

      450500 -- [-1149.968] (-1148.908) (-1151.229) (-1152.691) * [-1152.426] (-1151.781) (-1150.666) (-1150.949) -- 0:00:36
      451000 -- [-1149.744] (-1153.436) (-1154.503) (-1152.194) * [-1153.089] (-1152.761) (-1152.520) (-1152.268) -- 0:00:36
      451500 -- (-1149.687) (-1153.415) (-1154.843) [-1150.022] * (-1148.777) (-1150.799) (-1154.696) [-1148.269] -- 0:00:36
      452000 -- (-1149.985) (-1151.942) [-1152.104] (-1155.355) * (-1151.185) (-1151.664) (-1153.593) [-1149.973] -- 0:00:36
      452500 -- (-1150.867) [-1149.569] (-1152.253) (-1152.089) * (-1150.742) (-1151.851) (-1152.207) [-1152.747] -- 0:00:36
      453000 -- (-1152.549) (-1150.027) [-1150.080] (-1151.195) * (-1151.651) (-1150.082) (-1151.588) [-1151.701] -- 0:00:36
      453500 -- (-1152.857) [-1151.564] (-1149.648) (-1150.765) * (-1151.539) [-1153.250] (-1150.530) (-1153.304) -- 0:00:36
      454000 -- (-1150.922) [-1151.366] (-1149.434) (-1160.590) * (-1151.383) (-1151.916) [-1149.534] (-1155.038) -- 0:00:36
      454500 -- (-1150.680) [-1154.469] (-1152.358) (-1152.729) * (-1151.177) (-1152.818) (-1149.471) [-1148.844] -- 0:00:36
      455000 -- (-1151.803) (-1151.421) [-1151.908] (-1151.215) * (-1150.496) [-1154.364] (-1152.516) (-1149.821) -- 0:00:35

      Average standard deviation of split frequencies: 0.011992

      455500 -- (-1151.883) (-1150.910) [-1149.650] (-1148.644) * [-1149.099] (-1151.530) (-1153.058) (-1149.051) -- 0:00:35
      456000 -- (-1151.381) (-1150.941) [-1150.438] (-1150.469) * (-1152.146) (-1152.163) [-1149.984] (-1151.416) -- 0:00:35
      456500 -- [-1151.993] (-1150.762) (-1151.335) (-1151.315) * (-1150.019) [-1154.996] (-1149.997) (-1153.878) -- 0:00:35
      457000 -- [-1150.413] (-1152.081) (-1150.454) (-1150.795) * (-1148.493) [-1151.394] (-1150.373) (-1151.969) -- 0:00:35
      457500 -- (-1150.912) (-1153.066) (-1151.876) [-1152.552] * [-1150.125] (-1152.687) (-1151.521) (-1152.998) -- 0:00:35
      458000 -- [-1150.413] (-1151.278) (-1153.153) (-1151.435) * (-1152.036) (-1150.352) (-1150.776) [-1150.437] -- 0:00:35
      458500 -- (-1150.703) (-1152.280) (-1151.230) [-1150.584] * (-1152.513) [-1151.219] (-1152.666) (-1151.992) -- 0:00:35
      459000 -- (-1150.554) (-1154.233) [-1154.721] (-1150.633) * (-1152.296) (-1152.819) (-1155.348) [-1152.976] -- 0:00:35
      459500 -- (-1150.695) [-1151.554] (-1154.466) (-1151.039) * (-1149.700) (-1152.128) (-1151.129) [-1150.641] -- 0:00:35
      460000 -- (-1150.080) (-1150.112) (-1154.197) [-1150.799] * (-1148.819) (-1151.757) [-1151.944] (-1151.093) -- 0:00:35

      Average standard deviation of split frequencies: 0.012075

      460500 -- [-1153.663] (-1150.994) (-1156.554) (-1151.002) * (-1149.080) [-1149.290] (-1152.101) (-1150.423) -- 0:00:35
      461000 -- (-1152.261) [-1150.170] (-1156.697) (-1151.106) * (-1154.594) [-1149.767] (-1154.889) (-1150.641) -- 0:00:35
      461500 -- (-1149.352) (-1149.694) [-1152.209] (-1150.829) * (-1151.610) (-1150.611) [-1154.669] (-1150.754) -- 0:00:35
      462000 -- (-1149.791) (-1153.012) (-1150.557) [-1151.942] * (-1153.937) (-1150.917) [-1158.377] (-1151.342) -- 0:00:34
      462500 -- (-1151.407) [-1151.580] (-1150.442) (-1150.438) * (-1151.173) (-1156.220) (-1158.074) [-1152.071] -- 0:00:36
      463000 -- [-1148.927] (-1155.629) (-1153.085) (-1152.125) * (-1149.378) (-1151.037) [-1154.444] (-1151.733) -- 0:00:35
      463500 -- (-1153.895) (-1152.707) [-1151.897] (-1152.251) * [-1150.037] (-1150.822) (-1153.069) (-1150.957) -- 0:00:35
      464000 -- (-1152.625) (-1154.945) [-1149.903] (-1152.554) * (-1153.007) (-1150.412) (-1151.635) [-1150.006] -- 0:00:35
      464500 -- (-1152.928) (-1153.043) (-1151.171) [-1158.312] * (-1152.623) (-1150.657) [-1153.367] (-1150.349) -- 0:00:35
      465000 -- (-1151.213) (-1151.526) (-1151.508) [-1150.122] * (-1150.681) [-1151.388] (-1152.479) (-1151.730) -- 0:00:35

      Average standard deviation of split frequencies: 0.012409

      465500 -- (-1151.005) (-1150.694) [-1151.629] (-1150.063) * (-1152.744) (-1150.851) [-1150.215] (-1153.212) -- 0:00:35
      466000 -- (-1150.954) [-1150.093] (-1152.724) (-1150.556) * (-1153.936) [-1150.426] (-1151.897) (-1155.468) -- 0:00:35
      466500 -- (-1150.551) [-1151.443] (-1149.234) (-1149.776) * (-1155.166) (-1154.014) (-1151.577) [-1151.282] -- 0:00:35
      467000 -- (-1150.957) [-1148.461] (-1151.304) (-1150.862) * (-1155.407) (-1152.906) (-1149.687) [-1151.793] -- 0:00:35
      467500 -- (-1151.551) (-1155.062) (-1151.243) [-1150.186] * (-1152.299) (-1149.739) (-1151.180) [-1150.635] -- 0:00:35
      468000 -- (-1154.722) (-1154.038) (-1152.533) [-1151.672] * [-1148.432] (-1154.043) (-1151.899) (-1151.400) -- 0:00:35
      468500 -- (-1151.701) (-1151.342) [-1149.622] (-1151.463) * (-1151.828) (-1151.580) (-1150.553) [-1150.168] -- 0:00:35
      469000 -- [-1153.099] (-1152.184) (-1149.627) (-1151.920) * [-1151.297] (-1150.605) (-1151.744) (-1150.471) -- 0:00:35
      469500 -- (-1151.847) [-1150.383] (-1152.724) (-1150.371) * (-1151.262) [-1149.201] (-1149.735) (-1151.855) -- 0:00:35
      470000 -- (-1148.655) (-1149.487) [-1152.809] (-1151.529) * [-1149.517] (-1150.605) (-1149.712) (-1150.272) -- 0:00:34

      Average standard deviation of split frequencies: 0.012019

      470500 -- (-1149.925) [-1150.770] (-1149.795) (-1155.548) * [-1150.952] (-1148.906) (-1149.476) (-1150.592) -- 0:00:34
      471000 -- (-1153.817) (-1152.685) (-1150.263) [-1152.601] * (-1149.940) [-1152.311] (-1151.877) (-1151.540) -- 0:00:34
      471500 -- (-1150.532) (-1152.935) (-1150.494) [-1152.564] * (-1152.904) [-1151.829] (-1152.569) (-1152.137) -- 0:00:34
      472000 -- (-1150.770) (-1152.497) [-1149.782] (-1151.565) * [-1151.132] (-1149.487) (-1152.954) (-1151.486) -- 0:00:34
      472500 -- (-1152.463) (-1155.254) (-1154.230) [-1150.705] * (-1155.064) (-1151.728) [-1150.602] (-1153.111) -- 0:00:34
      473000 -- (-1150.607) (-1153.445) [-1157.243] (-1152.432) * (-1149.423) [-1151.436] (-1153.615) (-1154.345) -- 0:00:34
      473500 -- (-1149.117) (-1150.120) [-1151.817] (-1151.012) * (-1151.933) (-1153.155) (-1157.803) [-1149.554] -- 0:00:34
      474000 -- (-1150.597) (-1151.517) (-1151.642) [-1152.302] * [-1153.040] (-1150.498) (-1156.209) (-1150.466) -- 0:00:34
      474500 -- (-1151.457) (-1152.825) [-1149.848] (-1154.503) * (-1153.463) (-1149.674) [-1152.850] (-1149.911) -- 0:00:34
      475000 -- (-1153.989) (-1151.077) [-1151.951] (-1154.207) * (-1152.267) (-1149.703) (-1154.412) [-1150.543] -- 0:00:34

      Average standard deviation of split frequencies: 0.011554

      475500 -- (-1151.795) (-1153.239) (-1152.844) [-1150.028] * [-1153.129] (-1151.479) (-1152.094) (-1154.082) -- 0:00:34
      476000 -- (-1155.270) (-1156.970) (-1149.692) [-1150.346] * (-1151.773) (-1153.651) [-1153.105] (-1152.118) -- 0:00:34
      476500 -- (-1157.329) (-1160.745) [-1149.037] (-1152.057) * (-1153.364) (-1152.625) (-1157.682) [-1152.639] -- 0:00:34
      477000 -- (-1151.738) (-1153.084) (-1154.721) [-1150.975] * (-1150.577) (-1152.517) [-1151.741] (-1153.855) -- 0:00:33
      477500 -- (-1150.746) [-1153.822] (-1151.154) (-1151.451) * (-1150.733) (-1152.679) [-1149.128] (-1159.730) -- 0:00:35
      478000 -- (-1150.915) (-1152.760) [-1151.145] (-1151.571) * (-1151.304) (-1151.696) [-1151.782] (-1151.109) -- 0:00:34
      478500 -- (-1153.121) (-1152.759) (-1149.488) [-1150.102] * (-1152.311) [-1150.056] (-1150.603) (-1151.719) -- 0:00:34
      479000 -- [-1151.401] (-1151.509) (-1154.648) (-1151.218) * (-1152.119) [-1148.760] (-1152.873) (-1151.302) -- 0:00:34
      479500 -- (-1153.230) (-1149.690) (-1151.091) [-1150.308] * [-1153.265] (-1152.031) (-1151.064) (-1151.798) -- 0:00:34
      480000 -- (-1150.401) (-1151.366) [-1149.485] (-1150.214) * [-1153.190] (-1149.920) (-1153.525) (-1150.278) -- 0:00:34

      Average standard deviation of split frequencies: 0.011573

      480500 -- (-1151.494) (-1151.338) [-1150.451] (-1154.357) * (-1151.735) (-1150.627) [-1153.843] (-1152.276) -- 0:00:34
      481000 -- (-1150.422) (-1152.972) (-1149.356) [-1148.861] * [-1150.219] (-1150.248) (-1152.049) (-1151.426) -- 0:00:34
      481500 -- (-1151.860) (-1152.101) [-1149.553] (-1149.432) * (-1150.893) (-1150.329) (-1149.300) [-1152.457] -- 0:00:34
      482000 -- (-1150.342) (-1149.712) [-1150.439] (-1153.872) * (-1150.929) [-1151.007] (-1151.472) (-1153.778) -- 0:00:34
      482500 -- (-1153.262) [-1151.532] (-1149.917) (-1151.810) * [-1149.153] (-1152.332) (-1151.553) (-1154.933) -- 0:00:34
      483000 -- [-1151.241] (-1150.999) (-1152.211) (-1150.544) * (-1149.339) (-1153.192) [-1149.484] (-1153.152) -- 0:00:34
      483500 -- (-1151.684) (-1149.967) [-1149.549] (-1152.834) * [-1150.842] (-1152.554) (-1151.599) (-1152.016) -- 0:00:34
      484000 -- (-1151.946) [-1152.238] (-1151.068) (-1153.550) * (-1150.687) (-1154.838) (-1150.176) [-1150.840] -- 0:00:34
      484500 -- (-1154.124) [-1150.086] (-1151.678) (-1152.423) * (-1149.706) (-1151.057) (-1150.769) [-1150.077] -- 0:00:34
      485000 -- [-1152.062] (-1155.398) (-1152.249) (-1157.224) * (-1151.324) (-1150.376) (-1153.065) [-1150.652] -- 0:00:33

      Average standard deviation of split frequencies: 0.010993

      485500 -- [-1150.251] (-1153.545) (-1151.125) (-1150.929) * (-1153.507) (-1152.851) [-1148.994] (-1150.023) -- 0:00:33
      486000 -- [-1151.011] (-1153.058) (-1150.132) (-1150.550) * [-1151.588] (-1151.074) (-1151.217) (-1151.157) -- 0:00:33
      486500 -- (-1154.262) (-1154.365) (-1150.200) [-1151.090] * (-1150.992) [-1149.397] (-1151.378) (-1152.315) -- 0:00:33
      487000 -- (-1152.702) [-1150.653] (-1150.089) (-1150.545) * (-1152.026) (-1154.811) (-1149.538) [-1151.990] -- 0:00:33
      487500 -- (-1152.715) [-1150.476] (-1151.915) (-1152.019) * [-1149.591] (-1156.003) (-1149.986) (-1152.406) -- 0:00:33
      488000 -- (-1155.112) (-1149.740) (-1150.534) [-1152.017] * (-1150.600) (-1152.701) (-1150.868) [-1151.213] -- 0:00:33
      488500 -- (-1151.122) (-1154.340) (-1150.131) [-1150.244] * (-1150.467) [-1154.961] (-1153.633) (-1151.840) -- 0:00:33
      489000 -- (-1151.423) (-1155.783) (-1150.157) [-1154.652] * (-1152.584) [-1154.240] (-1155.233) (-1151.133) -- 0:00:33
      489500 -- (-1150.947) [-1151.512] (-1151.062) (-1153.877) * (-1152.728) (-1152.916) [-1151.510] (-1150.755) -- 0:00:33
      490000 -- (-1152.258) (-1149.911) (-1149.372) [-1153.486] * [-1152.081] (-1150.672) (-1149.942) (-1152.945) -- 0:00:33

      Average standard deviation of split frequencies: 0.010952

      490500 -- [-1154.136] (-1150.466) (-1151.235) (-1150.448) * (-1150.948) [-1151.055] (-1150.591) (-1151.400) -- 0:00:33
      491000 -- (-1150.887) (-1150.697) (-1150.320) [-1152.164] * (-1150.625) (-1154.814) [-1150.433] (-1151.102) -- 0:00:33
      491500 -- (-1151.919) [-1151.063] (-1149.716) (-1151.284) * (-1153.663) (-1151.145) (-1151.109) [-1150.139] -- 0:00:33
      492000 -- (-1151.954) (-1150.036) (-1150.546) [-1149.960] * [-1149.015] (-1150.540) (-1151.317) (-1153.175) -- 0:00:33
      492500 -- (-1153.097) [-1152.412] (-1148.886) (-1151.254) * (-1148.694) (-1153.146) [-1151.418] (-1149.225) -- 0:00:34
      493000 -- (-1151.062) (-1151.460) [-1148.984] (-1149.776) * (-1151.471) (-1153.623) [-1150.225] (-1150.260) -- 0:00:33
      493500 -- (-1150.632) (-1153.655) [-1153.826] (-1151.900) * [-1150.920] (-1154.222) (-1155.481) (-1151.892) -- 0:00:33
      494000 -- (-1152.188) (-1156.126) [-1149.191] (-1150.850) * (-1151.779) (-1153.709) [-1150.062] (-1150.853) -- 0:00:33
      494500 -- (-1154.536) (-1151.985) (-1148.229) [-1149.895] * (-1149.332) (-1153.519) (-1154.245) [-1151.167] -- 0:00:33
      495000 -- [-1150.103] (-1152.574) (-1149.601) (-1150.212) * [-1152.628] (-1153.842) (-1153.344) (-1149.976) -- 0:00:33

      Average standard deviation of split frequencies: 0.011468

      495500 -- (-1151.921) (-1152.077) (-1149.153) [-1150.039] * (-1151.107) [-1149.542] (-1151.213) (-1155.631) -- 0:00:33
      496000 -- [-1152.176] (-1152.072) (-1149.697) (-1151.347) * (-1150.495) [-1149.506] (-1151.779) (-1154.133) -- 0:00:33
      496500 -- [-1151.384] (-1153.931) (-1150.171) (-1151.481) * (-1150.627) [-1149.070] (-1155.007) (-1150.792) -- 0:00:33
      497000 -- (-1151.039) [-1150.946] (-1150.103) (-1153.148) * (-1150.237) (-1151.688) (-1151.626) [-1151.483] -- 0:00:33
      497500 -- (-1151.749) (-1152.860) [-1149.823] (-1151.092) * (-1148.853) [-1152.466] (-1153.070) (-1152.607) -- 0:00:33
      498000 -- (-1151.891) [-1150.022] (-1151.195) (-1151.458) * (-1149.342) [-1150.124] (-1150.711) (-1150.925) -- 0:00:33
      498500 -- [-1156.428] (-1149.936) (-1150.665) (-1151.086) * (-1149.093) (-1151.059) [-1150.362] (-1149.631) -- 0:00:33
      499000 -- (-1155.536) (-1151.241) (-1151.690) [-1149.964] * (-1150.095) (-1150.231) [-1149.893] (-1150.854) -- 0:00:33
      499500 -- (-1153.567) (-1151.392) (-1149.377) [-1150.666] * (-1154.886) (-1151.153) [-1151.640] (-1153.064) -- 0:00:33
      500000 -- (-1150.068) (-1151.259) (-1152.447) [-1150.583] * (-1150.892) [-1153.408] (-1151.984) (-1151.218) -- 0:00:33

      Average standard deviation of split frequencies: 0.011926

      500500 -- [-1151.765] (-1151.793) (-1152.341) (-1150.604) * (-1149.217) (-1154.380) (-1150.153) [-1151.285] -- 0:00:32
      501000 -- (-1153.920) [-1149.509] (-1152.935) (-1151.176) * (-1151.861) (-1150.865) (-1149.665) [-1152.384] -- 0:00:32
      501500 -- (-1152.098) (-1152.711) (-1151.382) [-1151.036] * (-1151.152) (-1151.355) [-1150.131] (-1149.364) -- 0:00:32
      502000 -- (-1150.636) [-1151.396] (-1153.328) (-1151.674) * (-1151.202) [-1149.497] (-1151.543) (-1150.143) -- 0:00:32
      502500 -- (-1152.133) (-1151.934) (-1152.313) [-1150.172] * (-1149.937) [-1150.957] (-1149.885) (-1154.539) -- 0:00:32
      503000 -- [-1152.333] (-1150.354) (-1152.297) (-1150.043) * (-1149.471) [-1148.938] (-1153.151) (-1148.667) -- 0:00:32
      503500 -- [-1147.691] (-1151.749) (-1155.084) (-1150.446) * (-1149.661) [-1149.893] (-1149.560) (-1149.269) -- 0:00:32
      504000 -- (-1151.618) (-1151.407) [-1151.580] (-1150.310) * (-1150.612) (-1152.157) (-1149.640) [-1150.379] -- 0:00:32
      504500 -- [-1151.483] (-1151.856) (-1158.707) (-1149.287) * [-1148.951] (-1151.171) (-1151.323) (-1151.520) -- 0:00:32
      505000 -- (-1149.644) (-1150.726) (-1154.521) [-1149.452] * (-1150.811) (-1150.397) (-1151.676) [-1151.651] -- 0:00:32

      Average standard deviation of split frequencies: 0.011428

      505500 -- [-1152.302] (-1151.011) (-1149.866) (-1149.262) * (-1150.654) (-1153.029) [-1149.917] (-1153.570) -- 0:00:32
      506000 -- (-1152.700) (-1151.315) (-1150.400) [-1151.011] * [-1150.885] (-1152.032) (-1150.708) (-1151.500) -- 0:00:32
      506500 -- (-1150.251) [-1148.737] (-1150.578) (-1151.414) * (-1153.059) (-1155.483) (-1151.965) [-1150.743] -- 0:00:32
      507000 -- [-1149.616] (-1149.952) (-1151.075) (-1156.447) * (-1153.087) [-1150.598] (-1154.841) (-1151.352) -- 0:00:32
      507500 -- (-1153.059) (-1151.164) [-1150.207] (-1150.829) * (-1150.644) [-1150.606] (-1153.601) (-1154.150) -- 0:00:32
      508000 -- (-1149.986) (-1149.291) [-1150.075] (-1150.115) * (-1150.582) [-1150.992] (-1150.374) (-1156.096) -- 0:00:32
      508500 -- [-1151.030] (-1150.860) (-1150.997) (-1150.562) * (-1150.201) (-1152.368) [-1151.145] (-1152.952) -- 0:00:32
      509000 -- (-1150.379) (-1150.945) (-1153.761) [-1150.734] * (-1149.201) (-1150.327) [-1149.456] (-1151.437) -- 0:00:32
      509500 -- (-1149.655) [-1150.718] (-1151.561) (-1153.297) * (-1149.640) [-1155.311] (-1150.730) (-1148.666) -- 0:00:32
      510000 -- (-1150.778) [-1154.690] (-1152.101) (-1153.973) * (-1150.958) (-1153.533) [-1149.349] (-1150.815) -- 0:00:32

      Average standard deviation of split frequencies: 0.011508

      510500 -- [-1150.007] (-1149.311) (-1151.636) (-1151.716) * [-1150.902] (-1151.514) (-1153.597) (-1148.707) -- 0:00:32
      511000 -- (-1153.268) [-1150.588] (-1153.291) (-1153.449) * [-1150.646] (-1151.574) (-1152.213) (-1151.814) -- 0:00:32
      511500 -- [-1151.841] (-1148.760) (-1152.931) (-1152.645) * (-1151.191) (-1153.615) (-1157.762) [-1151.033] -- 0:00:32
      512000 -- (-1151.035) (-1153.837) [-1151.308] (-1154.240) * [-1149.278] (-1154.608) (-1152.570) (-1150.867) -- 0:00:32
      512500 -- (-1151.279) [-1152.430] (-1151.934) (-1152.236) * (-1150.479) [-1150.042] (-1151.287) (-1149.898) -- 0:00:32
      513000 -- [-1152.719] (-1154.528) (-1152.320) (-1155.451) * [-1150.497] (-1151.833) (-1150.244) (-1151.292) -- 0:00:32
      513500 -- (-1151.349) (-1152.778) [-1150.355] (-1150.996) * (-1150.041) (-1149.979) (-1150.494) [-1154.347] -- 0:00:32
      514000 -- (-1150.984) (-1150.797) (-1149.822) [-1151.446] * (-1152.526) (-1150.687) [-1150.227] (-1150.436) -- 0:00:32
      514500 -- (-1149.452) (-1153.353) [-1151.952] (-1154.482) * (-1151.730) (-1149.895) (-1150.911) [-1150.529] -- 0:00:32
      515000 -- [-1153.057] (-1153.034) (-1149.054) (-1151.833) * (-1150.801) (-1151.003) (-1151.375) [-1150.557] -- 0:00:32

      Average standard deviation of split frequencies: 0.011511

      515500 -- (-1153.175) (-1156.125) [-1150.255] (-1152.754) * (-1154.903) (-1150.097) (-1148.988) [-1151.289] -- 0:00:31
      516000 -- (-1153.809) (-1156.787) (-1153.462) [-1152.041] * (-1149.151) (-1149.906) [-1151.224] (-1163.775) -- 0:00:31
      516500 -- (-1156.403) (-1157.134) [-1149.721] (-1150.745) * (-1153.951) (-1153.234) [-1150.748] (-1152.986) -- 0:00:31
      517000 -- (-1150.410) (-1155.046) [-1152.507] (-1151.593) * (-1152.990) (-1151.354) (-1152.859) [-1156.696] -- 0:00:31
      517500 -- [-1150.917] (-1154.139) (-1150.774) (-1150.546) * (-1153.646) [-1152.181] (-1151.260) (-1151.658) -- 0:00:31
      518000 -- (-1149.861) [-1150.858] (-1151.820) (-1150.962) * (-1152.885) [-1149.295] (-1150.452) (-1153.445) -- 0:00:31
      518500 -- (-1152.586) [-1150.175] (-1150.872) (-1150.904) * (-1150.333) (-1149.995) (-1148.906) [-1154.276] -- 0:00:31
      519000 -- (-1152.656) (-1150.815) [-1150.293] (-1150.902) * (-1150.321) [-1150.934] (-1150.102) (-1151.595) -- 0:00:31
      519500 -- (-1156.917) (-1151.264) (-1150.492) [-1152.057] * [-1150.465] (-1152.340) (-1149.200) (-1151.832) -- 0:00:31
      520000 -- (-1151.345) (-1150.184) [-1150.577] (-1151.728) * (-1151.181) (-1150.413) [-1151.668] (-1150.312) -- 0:00:31

      Average standard deviation of split frequencies: 0.010865

      520500 -- (-1152.576) [-1150.900] (-1152.163) (-1154.332) * (-1152.495) (-1150.359) (-1154.626) [-1150.537] -- 0:00:31
      521000 -- (-1149.231) (-1151.600) (-1151.165) [-1153.818] * (-1152.690) [-1149.489] (-1153.107) (-1151.306) -- 0:00:31
      521500 -- (-1153.694) [-1153.154] (-1149.566) (-1148.125) * (-1151.900) (-1154.071) (-1152.010) [-1148.910] -- 0:00:31
      522000 -- (-1148.703) (-1152.192) [-1150.074] (-1149.674) * [-1151.631] (-1150.805) (-1151.274) (-1149.057) -- 0:00:32
      522500 -- (-1151.245) (-1154.504) (-1154.093) [-1150.941] * (-1154.282) [-1152.582] (-1153.396) (-1150.120) -- 0:00:31
      523000 -- (-1152.067) (-1149.470) (-1152.446) [-1152.339] * [-1152.570] (-1149.105) (-1156.291) (-1150.916) -- 0:00:31
      523500 -- [-1154.200] (-1150.983) (-1150.463) (-1150.589) * (-1154.789) (-1152.018) (-1154.980) [-1148.898] -- 0:00:31
      524000 -- (-1150.225) (-1150.281) (-1152.635) [-1151.843] * [-1153.170] (-1150.481) (-1151.620) (-1150.646) -- 0:00:31
      524500 -- (-1152.049) (-1151.487) [-1151.430] (-1155.120) * (-1152.989) (-1149.597) (-1150.648) [-1150.506] -- 0:00:31
      525000 -- (-1149.678) [-1149.951] (-1151.953) (-1154.790) * (-1152.016) (-1151.465) [-1151.937] (-1149.405) -- 0:00:31

      Average standard deviation of split frequencies: 0.011113

      525500 -- [-1155.065] (-1150.970) (-1148.226) (-1154.398) * (-1154.531) [-1153.047] (-1149.862) (-1153.824) -- 0:00:31
      526000 -- (-1151.139) [-1151.098] (-1161.229) (-1152.726) * (-1154.130) (-1152.033) (-1150.425) [-1151.786] -- 0:00:31
      526500 -- (-1150.915) (-1150.062) (-1157.670) [-1152.568] * (-1150.851) [-1150.594] (-1150.770) (-1151.198) -- 0:00:31
      527000 -- [-1150.633] (-1149.823) (-1150.057) (-1150.174) * (-1151.595) [-1150.625] (-1151.055) (-1150.946) -- 0:00:31
      527500 -- [-1148.873] (-1150.787) (-1150.755) (-1149.036) * (-1151.941) (-1151.246) [-1150.501] (-1151.707) -- 0:00:31
      528000 -- (-1150.037) [-1148.313] (-1150.383) (-1152.883) * (-1153.171) [-1149.573] (-1149.861) (-1154.027) -- 0:00:31
      528500 -- [-1151.648] (-1149.293) (-1150.806) (-1151.378) * (-1154.643) (-1150.012) (-1152.162) [-1150.625] -- 0:00:31
      529000 -- (-1150.348) (-1149.975) (-1151.206) [-1150.793] * [-1150.814] (-1150.479) (-1151.188) (-1152.439) -- 0:00:31
      529500 -- (-1151.831) (-1149.866) [-1149.799] (-1153.396) * (-1152.597) [-1151.661] (-1151.093) (-1151.790) -- 0:00:31
      530000 -- (-1148.823) (-1151.197) [-1149.001] (-1150.730) * [-1156.705] (-1150.519) (-1148.633) (-1157.198) -- 0:00:31

      Average standard deviation of split frequencies: 0.011015

      530500 -- [-1149.395] (-1151.808) (-1151.233) (-1151.103) * (-1158.625) (-1152.728) (-1153.027) [-1150.685] -- 0:00:30
      531000 -- (-1150.413) [-1148.710] (-1151.095) (-1151.142) * (-1155.582) [-1150.201] (-1157.572) (-1152.476) -- 0:00:30
      531500 -- (-1149.839) (-1150.069) [-1151.709] (-1150.222) * (-1153.000) (-1153.034) (-1157.573) [-1150.480] -- 0:00:30
      532000 -- (-1148.844) [-1148.608] (-1149.923) (-1151.899) * (-1148.923) [-1152.346] (-1155.432) (-1150.511) -- 0:00:30
      532500 -- (-1148.583) [-1151.244] (-1150.147) (-1154.503) * (-1153.662) (-1151.943) (-1152.007) [-1152.048] -- 0:00:30
      533000 -- [-1151.370] (-1151.157) (-1150.700) (-1150.970) * (-1151.679) [-1150.746] (-1149.567) (-1156.009) -- 0:00:30
      533500 -- (-1152.207) (-1155.060) (-1150.320) [-1149.166] * (-1152.370) [-1150.406] (-1154.375) (-1154.201) -- 0:00:31
      534000 -- (-1152.048) (-1149.493) (-1153.188) [-1150.464] * [-1149.718] (-1151.742) (-1151.86