--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:17:41 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsG/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -640.42 -645.06
2 -640.40 -643.82
--------------------------------------
TOTAL -640.41 -644.62
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892415 0.091032 0.355124 1.477746 0.861720 1140.46 1316.30 1.000
r(A<->C){all} 0.165753 0.019930 0.000154 0.449120 0.127323 347.16 384.26 1.001
r(A<->G){all} 0.160250 0.019428 0.000035 0.452399 0.120356 215.27 244.68 1.002
r(A<->T){all} 0.176643 0.020718 0.000036 0.473890 0.142107 205.06 252.35 1.000
r(C<->G){all} 0.173149 0.020364 0.000114 0.457222 0.134270 256.74 314.55 1.000
r(C<->T){all} 0.165687 0.018281 0.000010 0.441788 0.132975 185.51 245.73 1.000
r(G<->T){all} 0.158518 0.020145 0.000030 0.450931 0.116352 229.45 230.14 1.007
pi(A){all} 0.205053 0.000336 0.171125 0.242320 0.204567 1367.99 1395.65 1.000
pi(C){all} 0.292264 0.000426 0.253733 0.334766 0.292107 1183.34 1282.18 1.000
pi(G){all} 0.309859 0.000467 0.266952 0.350134 0.309226 1360.72 1373.28 1.001
pi(T){all} 0.192825 0.000321 0.158556 0.228166 0.192522 1384.07 1438.30 1.000
alpha{1,2} 0.419939 0.241225 0.000303 1.414715 0.240487 1256.84 1325.64 1.000
alpha{3} 0.456309 0.244672 0.000374 1.470843 0.288106 1239.72 1324.69 1.000
pinvar{all} 0.996629 0.000016 0.989258 0.999997 0.997933 1224.09 1362.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -616.913514
Model 2: PositiveSelection -616.913487
Model 0: one-ratio -616.913511
Model 7: beta -616.913541
Model 8: beta&w>1 -616.913488
Model 0 vs 1 5.999999984851456E-6
Model 2 vs 1 5.3999999863663106E-5
Model 8 vs 7 1.059999999597494E-4
>C1
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C2
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C3
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C4
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C5
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C6
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=156
C1 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C2 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C3 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C4 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C5 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C6 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
**************************************************
C1 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C2 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C3 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C4 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C5 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C6 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
**************************************************
C1 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C2 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C3 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C4 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C5 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C6 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
**************************************************
C1 FAHYRW
C2 FAHYRW
C3 FAHYRW
C4 FAHYRW
C5 FAHYRW
C6 FAHYRW
******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 156 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 156 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4680]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4680]--->[4680]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.469 Mb, Max= 30.691 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C2 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C3 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C4 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C5 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C6 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
**************************************************
C1 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C2 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C3 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C4 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C5 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C6 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
**************************************************
C1 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C2 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C3 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C4 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C5 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C6 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
**************************************************
C1 FAHYRW
C2 FAHYRW
C3 FAHYRW
C4 FAHYRW
C5 FAHYRW
C6 FAHYRW
******
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
C2 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
C3 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
C4 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
C5 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
C6 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
**************************************************
C1 CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
C2 CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
C3 CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
C4 CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
C5 CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
C6 CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
**************************************************
C1 GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
C2 GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
C3 GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
C4 GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
C5 GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
C6 GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
**************************************************
C1 CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
C2 CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
C3 CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
C4 CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
C5 CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
C6 CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
**************************************************
C1 CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
C2 CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
C3 CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
C4 CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
C5 CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
C6 CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
**************************************************
C1 CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
C2 CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
C3 CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
C4 CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
C5 CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
C6 CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
**************************************************
C1 TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
C2 TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
C3 TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
C4 TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
C5 TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
C6 TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
**************************************************
C1 TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
C2 TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
C3 TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
C4 TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
C5 TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
C6 TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
**************************************************
C1 CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
C2 CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
C3 CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
C4 CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
C5 CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
C6 CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
**************************************************
C1 TTTGCGCACTATCGTTGG
C2 TTTGCGCACTATCGTTGG
C3 TTTGCGCACTATCGTTGG
C4 TTTGCGCACTATCGTTGG
C5 TTTGCGCACTATCGTTGG
C6 TTTGCGCACTATCGTTGG
******************
>C1
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C2
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C3
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C4
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C5
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C6
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C1
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C2
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C3
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C4
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C5
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C6
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 468 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792583
Setting output file names to "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 694780100
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0066157553
Seed = 35893060
Swapseed = 1579792583
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1047.406377 -- -24.965149
Chain 2 -- -1047.406437 -- -24.965149
Chain 3 -- -1047.406377 -- -24.965149
Chain 4 -- -1047.406377 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1047.406277 -- -24.965149
Chain 2 -- -1047.406437 -- -24.965149
Chain 3 -- -1047.406437 -- -24.965149
Chain 4 -- -1047.406277 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1047.406] (-1047.406) (-1047.406) (-1047.406) * [-1047.406] (-1047.406) (-1047.406) (-1047.406)
500 -- (-659.090) (-648.883) [-651.077] (-652.657) * (-660.143) [-648.164] (-657.648) (-656.237) -- 0:00:00
1000 -- (-650.719) (-648.489) (-648.884) [-648.318] * (-653.326) [-646.209] (-646.230) (-647.356) -- 0:00:00
1500 -- (-648.113) [-647.686] (-663.039) (-645.623) * (-660.566) [-651.523] (-651.769) (-655.117) -- 0:00:00
2000 -- [-649.078] (-644.168) (-650.894) (-657.672) * (-653.143) [-648.227] (-652.452) (-648.617) -- 0:00:00
2500 -- (-649.946) [-646.689] (-655.223) (-655.093) * (-656.912) (-649.700) [-645.699] (-647.902) -- 0:00:00
3000 -- (-645.742) [-646.561] (-660.662) (-644.071) * [-648.851] (-644.589) (-651.694) (-646.431) -- 0:00:00
3500 -- (-653.663) (-649.319) (-659.639) [-644.971] * (-651.207) [-647.115] (-654.623) (-650.714) -- 0:00:00
4000 -- (-649.519) (-656.847) [-647.528] (-655.970) * (-660.913) [-647.025] (-651.224) (-657.491) -- 0:00:00
4500 -- (-650.560) (-648.397) [-645.255] (-652.320) * (-646.495) [-649.258] (-652.973) (-650.565) -- 0:00:00
5000 -- (-662.307) [-652.167] (-646.978) (-647.240) * [-653.548] (-650.951) (-644.354) (-654.891) -- 0:00:00
Average standard deviation of split frequencies: 0.119722
5500 -- (-653.517) (-656.076) [-654.220] (-657.273) * [-644.645] (-649.269) (-650.839) (-645.150) -- 0:00:00
6000 -- [-645.052] (-649.986) (-652.647) (-656.567) * [-648.946] (-653.969) (-653.176) (-651.014) -- 0:00:00
6500 -- (-652.550) (-650.667) (-656.754) [-648.544] * [-645.503] (-655.765) (-657.349) (-651.588) -- 0:00:00
7000 -- (-651.517) [-648.837] (-653.805) (-651.028) * (-654.443) (-650.566) (-650.614) [-651.542] -- 0:00:00
7500 -- (-654.664) (-651.389) [-650.234] (-652.921) * (-652.713) (-652.016) (-649.297) [-650.400] -- 0:00:00
8000 -- (-649.825) (-651.816) [-647.692] (-654.472) * (-652.084) (-650.605) (-651.130) [-654.697] -- 0:00:00
8500 -- (-652.076) (-652.571) (-648.864) [-653.705] * (-651.017) (-648.335) [-655.878] (-646.858) -- 0:00:00
9000 -- (-649.795) [-644.922] (-646.507) (-656.572) * (-648.955) (-654.183) (-650.668) [-646.208] -- 0:01:50
9500 -- (-647.205) (-649.262) (-651.918) [-649.680] * (-654.664) [-648.593] (-645.973) (-655.397) -- 0:01:44
10000 -- (-649.994) [-647.264] (-645.672) (-651.679) * (-656.006) (-646.891) [-653.663] (-651.948) -- 0:01:39
Average standard deviation of split frequencies: 0.076112
10500 -- (-650.386) (-646.562) [-650.928] (-651.263) * (-667.674) [-667.494] (-650.813) (-653.433) -- 0:01:34
11000 -- (-657.069) (-650.276) [-649.534] (-651.773) * (-643.831) (-652.554) (-650.459) [-648.766] -- 0:01:29
11500 -- (-654.352) (-654.687) [-645.383] (-650.161) * (-642.182) (-653.988) (-647.142) [-646.304] -- 0:01:25
12000 -- (-645.900) (-643.096) (-651.769) [-645.912] * (-639.869) (-648.917) [-652.748] (-647.345) -- 0:01:22
12500 -- (-649.028) (-652.041) (-654.214) [-647.620] * (-643.067) [-648.516] (-652.883) (-660.909) -- 0:01:19
13000 -- (-657.574) (-653.046) (-654.312) [-646.614] * (-640.498) (-654.180) [-647.508] (-655.361) -- 0:01:15
13500 -- (-654.952) (-653.621) [-648.470] (-643.800) * (-640.251) (-652.315) [-649.627] (-654.614) -- 0:01:13
14000 -- [-646.024] (-643.933) (-659.192) (-645.221) * (-640.884) [-643.371] (-650.249) (-650.512) -- 0:01:10
14500 -- (-652.702) (-650.680) (-644.348) [-653.345] * (-643.108) (-651.543) [-646.587] (-656.425) -- 0:01:07
15000 -- (-649.434) (-649.238) (-649.013) [-649.478] * (-642.607) [-652.915] (-649.575) (-653.779) -- 0:01:05
Average standard deviation of split frequencies: 0.053314
15500 -- [-647.161] (-652.398) (-655.223) (-649.193) * (-641.594) [-653.970] (-648.134) (-648.066) -- 0:01:03
16000 -- [-644.413] (-646.875) (-646.589) (-645.479) * (-640.437) [-646.821] (-652.636) (-648.670) -- 0:01:01
16500 -- (-648.768) [-652.826] (-659.968) (-646.566) * [-640.749] (-645.417) (-648.627) (-659.604) -- 0:00:59
17000 -- [-647.003] (-648.525) (-653.586) (-648.693) * (-644.271) [-651.219] (-654.514) (-654.412) -- 0:00:57
17500 -- [-646.416] (-643.696) (-659.887) (-645.755) * [-642.294] (-649.153) (-652.413) (-645.053) -- 0:00:56
18000 -- (-662.433) (-648.695) [-649.679] (-657.785) * (-641.136) (-654.954) (-653.467) [-642.516] -- 0:00:54
18500 -- [-649.138] (-653.215) (-645.750) (-649.725) * (-649.408) (-653.072) (-647.771) [-641.378] -- 0:00:53
19000 -- [-646.812] (-649.909) (-651.993) (-646.961) * (-641.394) [-647.802] (-649.039) (-643.320) -- 0:00:51
19500 -- (-645.327) (-651.097) (-651.062) [-645.196] * (-641.898) (-644.879) [-643.470] (-646.095) -- 0:00:50
20000 -- (-655.780) [-651.451] (-644.322) (-659.238) * [-642.009] (-649.702) (-662.367) (-640.857) -- 0:00:49
Average standard deviation of split frequencies: 0.050422
20500 -- (-651.799) (-650.784) (-647.809) [-653.569] * (-640.523) (-650.078) [-644.804] (-643.447) -- 0:00:47
21000 -- [-649.849] (-659.535) (-648.988) (-660.905) * (-640.516) (-653.194) [-646.189] (-643.555) -- 0:00:46
21500 -- [-649.423] (-655.133) (-649.622) (-651.300) * (-644.235) [-648.339] (-647.596) (-640.897) -- 0:00:45
22000 -- [-654.743] (-645.406) (-650.058) (-650.790) * (-644.582) (-662.204) (-651.055) [-643.551] -- 0:00:44
22500 -- [-642.885] (-655.096) (-652.627) (-640.490) * (-642.137) [-648.986] (-643.203) (-644.689) -- 0:00:43
23000 -- [-640.108] (-647.367) (-652.148) (-640.629) * [-642.956] (-647.619) (-642.460) (-644.803) -- 0:00:42
23500 -- (-644.703) (-650.315) [-647.595] (-642.571) * (-642.654) (-650.983) [-641.976] (-640.115) -- 0:00:41
24000 -- (-643.661) [-645.392] (-646.546) (-640.382) * [-640.746] (-649.291) (-640.503) (-641.239) -- 0:00:40
24500 -- (-644.478) (-646.875) [-648.779] (-640.880) * (-639.441) (-649.110) [-640.814] (-642.158) -- 0:00:39
25000 -- (-639.940) (-660.036) (-649.001) [-642.091] * (-641.276) (-647.852) [-639.905] (-645.324) -- 0:00:39
Average standard deviation of split frequencies: 0.031945
25500 -- (-643.313) (-649.565) (-645.438) [-644.391] * (-641.364) (-649.742) [-639.038] (-642.852) -- 0:01:16
26000 -- (-645.373) (-641.055) (-647.746) [-641.069] * (-643.648) (-646.149) [-640.958] (-643.374) -- 0:01:14
26500 -- (-639.043) (-643.886) [-647.217] (-642.126) * (-643.805) (-646.868) [-642.117] (-641.680) -- 0:01:13
27000 -- (-641.770) (-639.204) [-644.416] (-642.294) * (-640.995) (-649.424) [-641.002] (-642.069) -- 0:01:12
27500 -- (-640.466) [-643.961] (-655.343) (-642.368) * (-642.046) (-653.803) (-639.452) [-641.146] -- 0:01:10
28000 -- [-639.699] (-644.984) (-646.802) (-640.838) * (-641.525) (-648.755) (-639.295) [-641.551] -- 0:01:09
28500 -- (-642.875) (-640.779) (-656.773) [-644.071] * (-645.075) (-658.773) [-639.068] (-639.948) -- 0:01:08
29000 -- [-642.748] (-639.827) (-659.698) (-643.246) * [-642.177] (-646.517) (-641.085) (-642.620) -- 0:01:06
29500 -- (-645.631) [-641.792] (-652.490) (-641.256) * (-642.902) (-646.942) (-638.934) [-642.250] -- 0:01:05
30000 -- (-642.706) (-641.774) (-650.599) [-641.424] * [-641.672] (-652.598) (-640.257) (-639.347) -- 0:01:04
Average standard deviation of split frequencies: 0.037661
30500 -- (-642.909) [-642.145] (-650.311) (-640.706) * (-641.050) [-653.513] (-639.229) (-638.972) -- 0:01:03
31000 -- [-640.143] (-640.780) (-660.698) (-642.929) * (-642.215) (-648.379) (-642.608) [-640.403] -- 0:01:02
31500 -- (-640.117) [-640.846] (-655.876) (-646.785) * (-643.805) (-645.966) (-641.744) [-641.271] -- 0:01:01
32000 -- (-641.160) (-640.024) [-650.389] (-643.490) * (-640.033) (-657.167) (-646.369) [-641.805] -- 0:01:00
32500 -- (-641.067) (-639.757) (-646.709) [-640.759] * (-639.175) (-651.316) (-643.961) [-640.994] -- 0:00:59
33000 -- (-645.682) (-639.885) [-647.441] (-639.363) * (-641.918) (-649.433) [-640.441] (-640.082) -- 0:00:58
33500 -- (-642.431) (-643.705) (-650.382) [-638.844] * [-639.041] (-646.953) (-640.091) (-644.949) -- 0:00:57
34000 -- (-639.627) (-639.472) (-645.050) [-638.758] * (-639.984) [-650.208] (-640.085) (-642.079) -- 0:00:56
34500 -- (-639.607) (-639.602) [-647.738] (-640.605) * (-639.929) [-647.638] (-644.591) (-638.893) -- 0:00:55
35000 -- (-642.719) (-639.738) (-661.417) [-641.648] * (-639.457) (-651.134) (-644.252) [-639.086] -- 0:00:55
Average standard deviation of split frequencies: 0.042921
35500 -- (-640.004) (-639.425) [-651.124] (-641.801) * [-640.492] (-646.529) (-642.126) (-639.249) -- 0:00:54
36000 -- (-640.598) (-641.123) [-647.725] (-641.081) * [-640.805] (-649.437) (-645.568) (-639.480) -- 0:00:53
36500 -- (-642.042) (-640.948) [-648.930] (-639.978) * [-642.848] (-645.200) (-647.874) (-641.966) -- 0:00:52
37000 -- [-641.399] (-641.463) (-654.215) (-640.616) * (-640.915) (-657.404) [-645.571] (-642.374) -- 0:00:52
37500 -- [-640.751] (-640.501) (-652.084) (-639.204) * [-640.407] (-651.816) (-642.415) (-640.123) -- 0:00:51
38000 -- [-641.591] (-639.553) (-652.540) (-639.825) * (-640.252) (-657.896) (-641.608) [-640.906] -- 0:00:50
38500 -- (-642.330) (-643.541) (-656.086) [-639.347] * (-644.895) [-646.707] (-642.856) (-640.372) -- 0:00:49
39000 -- (-641.986) (-641.920) (-662.284) [-641.356] * [-639.393] (-655.624) (-642.165) (-641.545) -- 0:00:49
39500 -- (-640.634) (-640.261) (-646.439) [-643.280] * [-642.740] (-656.916) (-640.182) (-640.986) -- 0:00:48
40000 -- [-639.303] (-644.215) (-643.329) (-641.344) * (-641.788) (-649.904) (-642.335) [-640.410] -- 0:00:48
Average standard deviation of split frequencies: 0.038185
40500 -- (-639.912) (-646.534) [-639.726] (-642.195) * (-642.630) (-652.551) (-641.599) [-640.368] -- 0:00:47
41000 -- (-640.253) (-641.444) [-639.092] (-641.608) * (-638.864) [-653.821] (-643.676) (-642.258) -- 0:00:46
41500 -- (-641.392) (-640.973) (-640.129) [-639.221] * [-639.526] (-648.566) (-645.971) (-640.192) -- 0:01:09
42000 -- (-639.487) (-640.639) [-640.042] (-639.233) * (-639.525) (-651.069) (-640.284) [-640.675] -- 0:01:08
42500 -- (-641.886) (-640.157) (-639.682) [-641.849] * (-639.985) [-650.756] (-640.918) (-638.951) -- 0:01:07
43000 -- (-640.227) (-640.576) [-643.093] (-640.324) * [-641.016] (-651.738) (-642.401) (-640.041) -- 0:01:06
43500 -- [-640.166] (-640.442) (-640.695) (-639.777) * (-640.656) (-653.050) (-642.067) [-642.565] -- 0:01:05
44000 -- (-643.502) (-644.619) (-639.238) [-639.725] * [-641.344] (-659.102) (-640.891) (-639.612) -- 0:01:05
44500 -- [-643.094] (-644.068) (-640.650) (-640.374) * (-641.321) (-659.218) (-642.051) [-639.250] -- 0:01:04
45000 -- (-641.615) (-640.221) (-642.810) [-641.039] * (-640.350) (-649.163) (-643.588) [-642.829] -- 0:01:03
Average standard deviation of split frequencies: 0.032793
45500 -- [-640.067] (-640.196) (-639.538) (-645.236) * (-640.837) [-640.234] (-643.061) (-641.912) -- 0:01:02
46000 -- (-643.118) [-641.920] (-641.702) (-639.974) * (-639.471) (-639.219) (-642.524) [-642.764] -- 0:01:02
46500 -- (-647.256) (-643.060) (-640.194) [-640.142] * [-639.128] (-642.216) (-641.751) (-644.541) -- 0:01:01
47000 -- (-645.111) [-641.703] (-643.215) (-640.741) * (-638.990) (-643.801) (-639.925) [-640.231] -- 0:01:00
47500 -- (-642.183) [-641.022] (-642.581) (-646.283) * (-639.334) [-639.499] (-642.853) (-642.081) -- 0:01:00
48000 -- (-642.419) (-640.693) (-640.092) [-640.514] * (-641.477) (-642.284) (-645.541) [-641.088] -- 0:00:59
48500 -- (-639.193) [-640.234] (-640.231) (-643.001) * [-641.244] (-642.913) (-643.573) (-642.241) -- 0:00:58
49000 -- [-641.656] (-641.233) (-644.334) (-640.249) * (-641.531) (-641.779) (-641.330) [-645.861] -- 0:00:58
49500 -- (-639.379) (-643.723) [-640.729] (-640.154) * (-642.287) [-642.026] (-640.331) (-642.565) -- 0:00:57
50000 -- [-643.069] (-639.940) (-640.626) (-641.985) * (-647.581) (-642.506) (-639.485) [-640.293] -- 0:00:57
Average standard deviation of split frequencies: 0.032047
50500 -- (-639.494) [-642.685] (-640.838) (-641.422) * (-640.271) (-642.800) [-639.851] (-639.793) -- 0:00:56
51000 -- (-640.338) (-641.430) [-640.857] (-641.093) * (-644.410) [-642.428] (-639.905) (-640.813) -- 0:00:55
51500 -- (-643.162) [-640.493] (-640.617) (-639.900) * (-641.513) (-643.447) (-641.168) [-639.722] -- 0:00:55
52000 -- [-640.167] (-643.399) (-644.291) (-644.823) * (-639.609) [-641.515] (-642.865) (-643.440) -- 0:00:54
52500 -- (-639.815) (-641.200) [-639.463] (-641.308) * (-640.988) [-642.260] (-641.934) (-645.258) -- 0:00:54
53000 -- (-640.362) [-641.025] (-641.078) (-644.929) * (-642.511) [-640.855] (-644.947) (-639.877) -- 0:00:53
53500 -- [-639.658] (-640.203) (-641.380) (-643.138) * (-641.350) [-641.485] (-644.414) (-639.036) -- 0:00:53
54000 -- (-639.328) [-640.597] (-640.617) (-642.410) * (-640.752) (-640.808) (-646.375) [-639.548] -- 0:00:52
54500 -- (-639.914) (-639.571) (-639.788) [-642.850] * [-644.143] (-641.135) (-641.998) (-640.875) -- 0:00:52
55000 -- (-639.789) [-639.459] (-639.725) (-639.778) * (-639.242) (-642.157) [-640.527] (-641.112) -- 0:00:51
Average standard deviation of split frequencies: 0.028995
55500 -- (-640.416) (-639.122) (-641.361) [-640.640] * [-639.998] (-640.143) (-642.059) (-646.738) -- 0:00:51
56000 -- (-640.920) [-646.430] (-640.139) (-646.830) * (-640.108) [-640.191] (-639.707) (-644.271) -- 0:00:50
56500 -- [-639.532] (-639.464) (-642.363) (-641.955) * (-640.341) [-639.764] (-638.970) (-641.420) -- 0:00:50
57000 -- (-641.550) [-643.146] (-641.104) (-645.573) * (-640.058) (-641.529) (-643.640) [-641.684] -- 0:00:49
57500 -- (-643.237) (-643.121) [-639.752] (-648.460) * (-639.869) [-642.120] (-640.219) (-640.861) -- 0:00:49
58000 -- [-641.058] (-644.125) (-638.957) (-641.222) * (-639.666) [-639.254] (-641.667) (-639.529) -- 0:01:04
58500 -- (-640.670) [-641.208] (-639.716) (-639.951) * (-644.099) (-639.835) (-639.510) [-640.805] -- 0:01:04
59000 -- (-643.526) (-643.688) [-640.475] (-643.701) * (-641.399) [-639.054] (-639.574) (-640.710) -- 0:01:03
59500 -- (-639.982) (-641.052) (-639.240) [-640.042] * (-641.420) (-641.844) (-639.957) [-644.756] -- 0:01:03
60000 -- (-644.815) (-643.541) [-643.254] (-640.030) * (-643.785) [-640.810] (-639.758) (-646.643) -- 0:01:02
Average standard deviation of split frequencies: 0.024606
60500 -- (-642.141) [-639.847] (-643.659) (-640.029) * (-645.812) [-640.523] (-639.403) (-644.021) -- 0:01:02
61000 -- (-642.032) (-640.247) (-645.165) [-640.613] * (-643.654) [-639.979] (-639.594) (-640.847) -- 0:01:01
61500 -- (-639.409) (-639.643) [-641.084] (-640.075) * (-641.752) (-641.524) (-639.282) [-640.065] -- 0:01:01
62000 -- (-640.759) (-644.015) (-642.431) [-639.370] * (-641.213) (-641.595) [-641.688] (-640.082) -- 0:01:00
62500 -- [-642.105] (-644.302) (-645.205) (-639.339) * [-640.202] (-641.472) (-641.479) (-641.010) -- 0:01:00
63000 -- (-641.759) [-639.923] (-642.128) (-639.339) * (-640.767) [-642.699] (-640.579) (-643.457) -- 0:00:59
63500 -- (-638.907) [-639.028] (-642.430) (-646.786) * [-639.387] (-640.022) (-640.788) (-640.700) -- 0:00:58
64000 -- [-639.385] (-639.635) (-640.863) (-643.262) * (-640.228) (-640.835) [-639.390] (-643.528) -- 0:00:58
64500 -- (-640.989) (-641.798) [-639.514] (-641.896) * (-645.172) (-640.617) (-641.201) [-644.658] -- 0:00:58
65000 -- (-641.580) (-639.855) [-639.830] (-642.951) * (-641.882) (-641.587) [-639.588] (-642.564) -- 0:00:57
Average standard deviation of split frequencies: 0.025939
65500 -- (-640.336) (-640.059) [-641.041] (-643.073) * (-641.581) (-640.510) [-641.254] (-641.126) -- 0:00:57
66000 -- (-643.235) [-641.018] (-643.986) (-642.386) * (-642.437) (-641.167) [-642.880] (-643.143) -- 0:00:56
66500 -- (-640.508) [-640.750] (-639.429) (-642.531) * [-640.634] (-640.601) (-644.247) (-640.068) -- 0:00:56
67000 -- (-642.323) [-642.497] (-641.915) (-641.905) * [-640.853] (-643.534) (-642.842) (-642.519) -- 0:00:55
67500 -- (-641.334) [-641.207] (-642.897) (-640.558) * (-639.424) (-640.588) [-641.094] (-644.192) -- 0:00:55
68000 -- (-641.974) (-642.207) [-643.408] (-639.432) * (-639.179) (-639.467) [-639.803] (-642.379) -- 0:00:54
68500 -- (-642.845) (-643.451) [-641.743] (-640.301) * (-639.245) (-641.141) (-640.617) [-642.285] -- 0:00:54
69000 -- (-643.009) (-644.977) (-643.269) [-640.679] * (-639.097) (-639.948) [-639.269] (-640.303) -- 0:00:53
69500 -- [-641.009] (-640.558) (-644.531) (-640.405) * (-640.599) [-641.182] (-639.678) (-640.118) -- 0:00:53
70000 -- (-641.193) (-643.237) [-639.751] (-640.057) * (-641.934) (-641.669) [-639.570] (-642.558) -- 0:00:53
Average standard deviation of split frequencies: 0.025942
70500 -- (-640.864) (-643.019) [-640.117] (-640.950) * [-639.738] (-643.320) (-641.225) (-640.793) -- 0:00:52
71000 -- (-642.490) [-642.386] (-639.418) (-640.728) * (-640.156) [-640.894] (-639.129) (-641.239) -- 0:00:52
71500 -- (-641.816) [-640.399] (-643.076) (-641.209) * (-639.448) [-639.193] (-642.229) (-639.226) -- 0:00:51
72000 -- (-640.892) (-640.483) [-645.011] (-639.495) * [-641.076] (-641.805) (-642.118) (-639.230) -- 0:00:51
72500 -- [-638.957] (-639.972) (-641.177) (-639.881) * (-641.663) (-642.873) [-640.785] (-640.899) -- 0:00:51
73000 -- (-639.885) (-640.134) (-642.068) [-639.674] * (-640.198) [-641.027] (-644.633) (-639.361) -- 0:00:50
73500 -- (-641.384) (-640.839) (-641.460) [-644.901] * (-642.179) (-639.465) [-639.575] (-640.325) -- 0:00:50
74000 -- (-648.042) (-640.778) (-643.316) [-641.299] * (-641.202) [-639.554] (-643.381) (-641.611) -- 0:00:50
74500 -- (-646.149) (-644.354) (-640.385) [-640.246] * (-641.687) (-640.003) [-645.426] (-641.752) -- 0:00:49
75000 -- [-641.241] (-646.439) (-644.337) (-641.872) * (-641.789) (-646.670) [-641.124] (-640.344) -- 0:01:01
Average standard deviation of split frequencies: 0.026878
75500 -- (-642.444) [-640.918] (-638.875) (-642.996) * (-642.209) (-644.060) (-640.469) [-643.805] -- 0:01:01
76000 -- [-641.201] (-640.471) (-638.806) (-640.685) * (-645.327) (-641.231) [-642.473] (-639.901) -- 0:01:00
76500 -- (-641.107) (-641.951) [-640.785] (-639.288) * (-640.958) [-640.726] (-642.041) (-641.783) -- 0:01:00
77000 -- [-641.962] (-641.975) (-640.884) (-641.345) * (-640.443) (-646.922) [-645.860] (-642.222) -- 0:00:59
77500 -- (-638.982) (-642.135) [-644.140] (-647.323) * (-642.523) [-639.271] (-643.611) (-642.908) -- 0:00:59
78000 -- [-640.896] (-640.880) (-641.870) (-639.710) * [-641.197] (-645.134) (-641.796) (-641.103) -- 0:00:59
78500 -- (-641.572) (-646.505) [-639.897] (-640.971) * (-639.552) (-639.555) [-641.469] (-641.394) -- 0:00:58
79000 -- (-643.596) (-642.232) [-639.395] (-641.210) * [-640.041] (-641.523) (-644.965) (-641.407) -- 0:00:58
79500 -- (-642.317) (-644.165) [-642.088] (-642.634) * (-640.071) (-641.465) [-641.807] (-641.077) -- 0:00:57
80000 -- (-640.105) (-641.808) (-640.484) [-641.367] * (-641.598) (-639.716) [-643.798] (-640.440) -- 0:00:57
Average standard deviation of split frequencies: 0.024106
80500 -- [-642.803] (-640.477) (-640.584) (-640.127) * (-644.208) (-640.391) [-643.647] (-646.848) -- 0:00:57
81000 -- [-640.527] (-641.892) (-643.859) (-643.520) * (-640.534) (-641.856) [-640.710] (-645.313) -- 0:00:56
81500 -- (-639.776) (-640.248) [-640.473] (-641.450) * (-642.544) (-642.039) (-639.807) [-641.699] -- 0:00:56
82000 -- [-639.395] (-640.063) (-645.809) (-639.487) * (-644.158) (-642.623) (-642.265) [-641.272] -- 0:00:55
82500 -- (-642.807) (-641.622) (-643.395) [-638.997] * (-643.089) (-641.063) [-642.345] (-645.250) -- 0:00:55
83000 -- (-644.469) (-640.396) [-641.350] (-641.604) * (-640.613) [-642.489] (-643.108) (-641.457) -- 0:00:55
83500 -- (-640.057) [-643.054] (-640.582) (-640.673) * (-640.574) [-642.112] (-640.498) (-640.524) -- 0:00:54
84000 -- (-640.887) (-639.342) [-639.510] (-640.766) * (-639.579) (-643.418) [-641.452] (-641.082) -- 0:00:54
84500 -- (-640.710) (-643.196) (-640.591) [-641.508] * (-641.077) (-642.589) [-641.172] (-646.128) -- 0:00:54
85000 -- (-641.726) [-643.337] (-641.855) (-640.815) * (-640.660) [-639.753] (-641.474) (-646.596) -- 0:00:53
Average standard deviation of split frequencies: 0.024667
85500 -- (-642.295) (-642.498) [-641.763] (-642.410) * (-643.203) (-640.189) [-641.197] (-646.633) -- 0:00:53
86000 -- (-642.425) (-639.908) (-640.174) [-641.675] * (-640.803) [-641.230] (-640.936) (-644.212) -- 0:00:53
86500 -- (-643.440) (-641.148) (-640.491) [-639.286] * (-640.086) [-641.990] (-641.234) (-639.429) -- 0:00:52
87000 -- [-643.402] (-639.705) (-644.228) (-642.879) * (-645.339) (-639.576) [-643.551] (-640.467) -- 0:00:52
87500 -- (-641.552) (-639.348) [-640.817] (-641.510) * (-640.166) [-642.634] (-641.745) (-643.032) -- 0:00:52
88000 -- (-640.999) (-645.409) [-640.799] (-640.401) * (-639.737) (-643.144) [-640.618] (-642.159) -- 0:00:51
88500 -- (-640.986) (-641.211) [-640.510] (-644.453) * (-639.488) [-640.733] (-639.188) (-639.192) -- 0:00:51
89000 -- (-642.821) [-641.596] (-642.589) (-641.207) * (-639.285) (-641.558) [-640.603] (-642.090) -- 0:00:51
89500 -- (-643.047) [-639.403] (-639.916) (-641.429) * (-639.251) (-640.745) [-640.528] (-639.647) -- 0:00:50
90000 -- (-643.446) (-641.475) [-642.347] (-640.105) * (-640.026) [-641.417] (-640.508) (-640.143) -- 0:00:50
Average standard deviation of split frequencies: 0.026302
90500 -- (-642.509) (-645.290) [-643.919] (-639.418) * [-639.674] (-641.546) (-640.003) (-640.423) -- 0:00:50
91000 -- (-640.186) (-641.062) (-642.654) [-640.551] * (-639.866) [-642.540] (-641.734) (-640.399) -- 0:00:49
91500 -- [-642.507] (-640.037) (-639.153) (-640.236) * (-640.116) (-643.801) (-640.394) [-639.699] -- 0:00:59
92000 -- [-646.899] (-641.267) (-639.013) (-641.001) * (-640.761) (-640.702) [-640.944] (-639.942) -- 0:00:59
92500 -- (-642.555) [-640.541] (-644.581) (-641.664) * (-642.388) (-640.074) (-645.485) [-642.445] -- 0:00:58
93000 -- (-642.417) (-640.994) (-643.595) [-639.803] * (-640.014) (-640.514) (-639.597) [-639.604] -- 0:00:58
93500 -- (-639.837) (-640.594) (-644.945) [-639.655] * (-641.206) (-644.143) [-642.542] (-640.573) -- 0:00:58
94000 -- (-640.366) [-641.086] (-639.998) (-641.702) * (-641.066) (-643.192) (-640.930) [-642.726] -- 0:00:57
94500 -- (-640.275) [-640.788] (-644.244) (-641.222) * (-640.546) [-641.236] (-644.709) (-642.671) -- 0:00:57
95000 -- (-639.022) (-639.360) [-641.176] (-645.734) * [-640.312] (-640.637) (-643.125) (-640.204) -- 0:00:57
Average standard deviation of split frequencies: 0.022915
95500 -- (-642.259) (-640.380) (-640.491) [-641.604] * (-643.173) [-639.954] (-640.832) (-639.998) -- 0:00:56
96000 -- (-641.601) (-644.607) (-643.651) [-642.236] * (-640.551) (-640.815) (-642.308) [-642.132] -- 0:00:56
96500 -- (-641.606) [-642.208] (-643.683) (-641.599) * (-640.848) (-642.705) [-641.929] (-639.829) -- 0:00:56
97000 -- (-642.822) (-642.872) (-641.430) [-640.012] * [-640.248] (-644.413) (-643.144) (-641.485) -- 0:00:55
97500 -- [-640.081] (-640.666) (-640.532) (-644.000) * [-641.420] (-646.018) (-640.513) (-639.292) -- 0:00:55
98000 -- (-641.792) [-640.499] (-642.371) (-640.778) * [-643.496] (-642.379) (-646.882) (-639.055) -- 0:00:55
98500 -- [-642.068] (-643.062) (-640.554) (-640.297) * [-641.408] (-641.314) (-639.778) (-641.739) -- 0:00:54
99000 -- (-643.526) (-639.837) (-640.615) [-639.948] * (-640.767) [-639.936] (-640.113) (-640.537) -- 0:00:54
99500 -- (-641.328) [-640.918] (-639.608) (-642.205) * (-639.349) (-642.731) [-642.325] (-643.408) -- 0:00:54
100000 -- (-640.214) (-641.647) [-642.437] (-639.733) * (-644.263) [-640.834] (-642.818) (-641.573) -- 0:00:54
Average standard deviation of split frequencies: 0.022588
100500 -- [-639.939] (-639.708) (-641.924) (-639.599) * (-638.938) (-642.493) [-642.855] (-640.049) -- 0:00:53
101000 -- (-641.828) (-641.241) (-640.936) [-639.696] * [-643.575] (-645.967) (-639.269) (-639.295) -- 0:00:53
101500 -- [-640.888] (-644.873) (-640.789) (-641.306) * (-640.952) [-642.332] (-643.393) (-640.858) -- 0:00:53
102000 -- (-641.658) (-639.876) (-640.001) [-642.496] * (-641.716) (-641.800) (-642.120) [-639.851] -- 0:00:52
102500 -- (-646.942) (-642.470) (-641.833) [-639.481] * (-641.486) (-641.761) [-641.838] (-642.209) -- 0:00:52
103000 -- (-645.011) [-639.752] (-643.961) (-644.273) * (-640.862) [-642.350] (-641.743) (-639.619) -- 0:00:52
103500 -- (-642.557) (-640.013) [-643.433] (-643.437) * (-639.690) [-641.049] (-642.447) (-639.312) -- 0:00:51
104000 -- [-641.129] (-641.940) (-643.609) (-640.771) * [-639.774] (-643.594) (-639.648) (-642.750) -- 0:00:51
104500 -- [-641.500] (-644.041) (-645.138) (-643.962) * (-640.076) (-640.073) [-639.418] (-641.080) -- 0:00:51
105000 -- (-640.713) (-642.442) (-639.283) [-640.805] * (-639.938) (-640.312) (-640.010) [-642.280] -- 0:00:51
Average standard deviation of split frequencies: 0.021248
105500 -- (-642.125) [-641.412] (-639.489) (-640.493) * (-644.839) (-639.989) [-639.939] (-639.630) -- 0:00:50
106000 -- (-645.673) [-642.869] (-641.921) (-639.236) * (-642.433) (-639.692) (-642.661) [-640.190] -- 0:00:50
106500 -- (-640.304) [-640.765] (-641.232) (-640.780) * (-641.994) [-641.755] (-641.083) (-640.146) -- 0:00:50
107000 -- (-640.419) (-642.842) [-639.003] (-642.189) * (-642.996) [-645.206] (-643.587) (-640.253) -- 0:00:50
107500 -- (-645.321) (-642.254) (-641.381) [-639.592] * (-641.442) [-643.202] (-640.197) (-642.277) -- 0:00:49
108000 -- [-640.001] (-643.303) (-640.468) (-641.532) * (-639.376) (-643.059) [-639.908] (-644.504) -- 0:00:57
108500 -- (-644.014) (-646.355) (-641.532) [-641.175] * (-639.788) (-643.857) (-641.731) [-642.027] -- 0:00:57
109000 -- (-641.112) (-641.608) (-641.327) [-639.619] * [-640.063] (-640.532) (-639.320) (-640.870) -- 0:00:57
109500 -- [-639.063] (-640.273) (-640.103) (-641.005) * (-640.980) [-639.382] (-639.439) (-641.243) -- 0:00:56
110000 -- [-641.699] (-640.120) (-642.646) (-641.679) * (-640.069) [-639.824] (-640.464) (-641.048) -- 0:00:56
Average standard deviation of split frequencies: 0.024611
110500 -- (-644.928) (-639.710) (-646.396) [-643.520] * (-639.772) [-639.431] (-640.761) (-639.784) -- 0:00:56
111000 -- [-641.140] (-641.175) (-642.769) (-639.729) * [-640.467] (-643.914) (-642.035) (-640.253) -- 0:00:56
111500 -- [-639.393] (-642.110) (-640.233) (-639.408) * [-641.460] (-645.918) (-640.047) (-642.250) -- 0:00:55
112000 -- [-643.321] (-640.833) (-640.114) (-638.861) * [-640.245] (-644.683) (-640.334) (-645.790) -- 0:00:55
112500 -- (-645.126) (-641.103) [-642.000] (-639.906) * (-640.892) (-639.241) [-640.855] (-646.624) -- 0:00:55
113000 -- [-642.345] (-642.959) (-642.988) (-644.613) * (-639.920) (-641.890) (-640.229) [-642.474] -- 0:00:54
113500 -- (-643.079) [-644.045] (-646.149) (-641.171) * (-640.566) (-644.555) (-641.387) [-642.867] -- 0:00:54
114000 -- (-639.887) (-643.386) (-640.833) [-640.708] * (-640.938) [-642.745] (-643.721) (-642.180) -- 0:00:54
114500 -- (-641.009) [-641.049] (-639.507) (-642.867) * (-640.478) (-640.480) [-641.293] (-640.074) -- 0:00:54
115000 -- (-638.912) (-649.687) [-642.393] (-646.380) * (-643.767) [-640.751] (-643.235) (-644.600) -- 0:00:53
Average standard deviation of split frequencies: 0.021514
115500 -- (-639.672) [-640.412] (-642.831) (-642.328) * [-643.269] (-641.273) (-641.087) (-640.482) -- 0:00:53
116000 -- (-640.623) (-639.523) (-640.857) [-639.830] * (-640.759) (-645.134) (-639.326) [-640.449] -- 0:00:53
116500 -- [-639.363] (-639.364) (-638.791) (-642.568) * (-639.268) [-641.696] (-641.175) (-648.390) -- 0:00:53
117000 -- (-641.032) [-640.011] (-640.290) (-642.599) * [-644.223] (-642.918) (-643.747) (-646.351) -- 0:00:52
117500 -- (-643.691) (-641.691) [-640.470] (-639.439) * (-642.131) (-647.114) (-644.415) [-646.209] -- 0:00:52
118000 -- (-640.129) (-644.315) [-639.662] (-641.003) * (-640.691) (-644.901) [-641.837] (-646.903) -- 0:00:52
118500 -- (-640.781) (-641.107) (-641.243) [-640.630] * (-641.244) [-643.061] (-643.658) (-640.991) -- 0:00:52
119000 -- (-641.972) (-641.495) (-641.640) [-639.586] * (-639.038) (-642.745) [-640.045] (-641.113) -- 0:00:51
119500 -- (-641.856) (-643.152) [-638.990] (-640.864) * (-639.880) (-640.310) [-641.813] (-642.337) -- 0:00:51
120000 -- (-646.826) (-643.187) [-639.491] (-639.533) * (-642.784) (-643.419) (-639.818) [-640.254] -- 0:00:51
Average standard deviation of split frequencies: 0.020619
120500 -- (-642.156) (-641.018) (-640.473) [-640.183] * [-642.341] (-641.066) (-641.779) (-642.395) -- 0:00:51
121000 -- (-642.760) (-644.842) (-643.051) [-641.764] * (-641.654) [-640.635] (-640.953) (-640.597) -- 0:00:50
121500 -- (-642.726) [-641.051] (-643.811) (-642.530) * (-647.074) (-640.081) (-641.247) [-639.774] -- 0:00:50
122000 -- (-641.433) (-643.346) [-640.229] (-642.536) * (-640.652) (-640.088) (-641.892) [-642.365] -- 0:00:50
122500 -- (-641.282) (-640.515) [-639.726] (-643.318) * (-639.636) (-641.993) (-641.971) [-641.467] -- 0:00:50
123000 -- [-640.490] (-644.382) (-643.818) (-641.390) * (-639.381) [-643.300] (-642.623) (-644.122) -- 0:00:49
123500 -- [-640.999] (-639.192) (-640.325) (-639.353) * (-640.069) (-639.849) [-642.640] (-640.013) -- 0:00:49
124000 -- (-641.005) (-640.087) (-639.561) [-640.421] * (-640.952) (-640.409) [-641.775] (-641.277) -- 0:00:49
124500 -- [-644.503] (-644.341) (-641.794) (-640.294) * (-641.677) [-640.877] (-640.211) (-645.202) -- 0:00:49
125000 -- (-643.382) (-641.003) [-640.900] (-641.529) * (-639.648) (-643.387) (-640.767) [-639.382] -- 0:00:56
Average standard deviation of split frequencies: 0.020676
125500 -- (-641.858) [-643.487] (-644.266) (-641.206) * (-641.231) (-645.203) [-640.762] (-640.609) -- 0:00:55
126000 -- [-643.438] (-643.661) (-640.791) (-641.123) * (-641.004) (-642.649) [-643.393] (-642.058) -- 0:00:55
126500 -- (-641.122) (-645.006) (-641.558) [-640.660] * (-639.844) (-641.990) [-641.813] (-639.744) -- 0:00:55
127000 -- (-642.347) [-640.373] (-641.430) (-644.436) * (-641.027) [-641.905] (-639.630) (-640.011) -- 0:00:54
127500 -- (-641.348) (-641.195) (-646.737) [-641.665] * (-641.026) (-640.147) (-641.732) [-641.875] -- 0:00:54
128000 -- [-639.859] (-641.288) (-644.558) (-642.589) * (-638.861) (-639.607) [-641.756] (-643.745) -- 0:00:54
128500 -- (-645.663) [-640.241] (-639.034) (-642.442) * (-640.549) (-641.683) (-639.500) [-645.260] -- 0:00:54
129000 -- (-643.545) [-640.624] (-641.887) (-641.382) * (-640.290) (-639.897) (-643.029) [-643.940] -- 0:00:54
129500 -- (-640.064) [-642.559] (-640.007) (-643.492) * [-640.260] (-642.667) (-643.139) (-640.366) -- 0:00:53
130000 -- (-640.504) (-642.543) (-639.535) [-641.923] * (-641.605) (-640.854) (-640.073) [-640.314] -- 0:00:53
Average standard deviation of split frequencies: 0.015916
130500 -- [-642.031] (-641.657) (-641.677) (-640.266) * (-639.820) [-640.514] (-641.681) (-642.595) -- 0:00:53
131000 -- (-641.193) [-641.050] (-641.243) (-642.532) * (-639.811) (-641.298) (-640.827) [-644.123] -- 0:00:53
131500 -- (-639.793) (-640.364) [-639.716] (-639.709) * (-639.955) (-639.710) [-640.350] (-643.425) -- 0:00:52
132000 -- (-638.926) (-641.783) (-639.786) [-640.204] * (-639.501) [-639.991] (-640.547) (-645.695) -- 0:00:52
132500 -- (-640.101) (-640.892) [-641.965] (-642.043) * (-639.077) (-645.147) (-639.883) [-641.356] -- 0:00:52
133000 -- (-641.701) (-640.526) [-641.007] (-642.790) * (-641.926) (-639.775) [-639.094] (-640.926) -- 0:00:52
133500 -- (-642.058) (-641.003) [-640.928] (-641.004) * (-639.580) (-642.243) [-641.032] (-639.567) -- 0:00:51
134000 -- (-639.955) (-640.889) [-642.521] (-642.981) * (-639.937) [-641.254] (-643.095) (-643.203) -- 0:00:51
134500 -- [-642.198] (-642.724) (-642.255) (-640.910) * (-642.633) [-639.323] (-640.280) (-640.928) -- 0:00:51
135000 -- (-642.532) (-643.641) [-640.401] (-642.417) * (-641.804) (-640.467) (-642.500) [-640.383] -- 0:00:51
Average standard deviation of split frequencies: 0.014443
135500 -- [-641.318] (-640.110) (-643.736) (-642.814) * (-641.275) (-639.731) (-641.050) [-639.805] -- 0:00:51
136000 -- (-644.222) [-641.466] (-639.829) (-642.708) * [-639.609] (-640.448) (-640.957) (-644.512) -- 0:00:50
136500 -- [-643.990] (-638.992) (-639.540) (-642.640) * (-642.272) (-644.737) [-641.281] (-640.553) -- 0:00:50
137000 -- (-639.868) (-641.133) [-640.650] (-646.338) * (-645.480) (-641.311) [-640.820] (-641.250) -- 0:00:50
137500 -- (-640.786) (-642.441) [-640.477] (-640.692) * (-639.750) (-641.523) [-639.590] (-640.859) -- 0:00:50
138000 -- (-642.400) [-640.470] (-640.595) (-646.708) * (-640.010) [-642.283] (-641.735) (-639.363) -- 0:00:49
138500 -- (-646.617) (-640.749) (-643.683) [-639.993] * (-643.037) [-640.377] (-641.275) (-640.158) -- 0:00:49
139000 -- [-640.314] (-642.989) (-639.538) (-641.342) * (-642.177) (-643.107) (-640.676) [-641.803] -- 0:00:49
139500 -- (-641.001) (-639.206) [-639.943] (-642.932) * [-641.121] (-643.798) (-642.840) (-641.357) -- 0:00:49
140000 -- (-640.464) [-641.157] (-640.731) (-645.265) * (-639.494) (-640.739) [-640.028] (-640.203) -- 0:00:49
Average standard deviation of split frequencies: 0.017128
140500 -- (-639.946) (-638.890) [-641.677] (-639.777) * (-640.073) [-642.193] (-642.055) (-643.944) -- 0:00:48
141000 -- [-640.035] (-642.807) (-642.105) (-639.588) * (-639.634) [-642.018] (-640.601) (-643.089) -- 0:00:48
141500 -- [-641.744] (-643.446) (-640.460) (-641.358) * (-640.559) (-643.297) (-640.279) [-642.302] -- 0:00:54
142000 -- [-639.833] (-640.723) (-642.640) (-643.533) * (-640.354) (-643.192) (-640.221) [-645.063] -- 0:00:54
142500 -- (-640.956) [-641.045] (-644.484) (-641.853) * (-641.570) [-640.190] (-641.080) (-642.651) -- 0:00:54
143000 -- (-641.172) (-639.741) (-644.771) [-645.294] * (-641.699) (-639.040) [-643.393] (-638.859) -- 0:00:53
143500 -- [-639.895] (-639.710) (-641.857) (-644.882) * [-640.012] (-641.228) (-641.218) (-640.667) -- 0:00:53
144000 -- (-641.575) (-646.300) (-640.272) [-639.825] * (-639.578) (-640.249) (-639.938) [-640.620] -- 0:00:53
144500 -- (-645.403) (-640.187) [-642.131] (-642.548) * (-642.477) (-640.154) [-642.891] (-641.847) -- 0:00:53
145000 -- [-642.782] (-640.425) (-642.171) (-641.582) * (-642.714) [-639.475] (-639.956) (-640.703) -- 0:00:53
Average standard deviation of split frequencies: 0.017164
145500 -- (-642.342) [-642.345] (-642.468) (-642.052) * (-640.221) [-639.913] (-642.067) (-644.147) -- 0:00:52
146000 -- [-640.885] (-644.135) (-641.918) (-638.997) * (-640.064) [-640.240] (-641.562) (-640.880) -- 0:00:52
146500 -- (-644.353) (-639.983) (-640.887) [-639.825] * [-642.010] (-645.894) (-642.084) (-641.347) -- 0:00:52
147000 -- (-642.588) [-642.440] (-641.554) (-642.258) * (-641.794) (-640.220) [-642.122] (-640.232) -- 0:00:52
147500 -- [-642.445] (-640.823) (-642.803) (-643.756) * (-643.506) (-642.080) [-640.059] (-639.474) -- 0:00:52
148000 -- (-644.914) [-640.361] (-640.738) (-641.385) * [-643.461] (-642.425) (-640.309) (-640.213) -- 0:00:51
148500 -- (-641.211) (-641.114) (-643.343) [-642.059] * [-640.781] (-641.745) (-639.548) (-642.063) -- 0:00:51
149000 -- [-643.378] (-645.085) (-641.347) (-642.125) * (-644.454) (-641.042) [-640.051] (-640.441) -- 0:00:51
149500 -- (-641.414) (-641.241) [-640.932] (-641.696) * (-640.246) [-641.691] (-644.733) (-641.520) -- 0:00:51
150000 -- (-641.219) (-639.897) (-641.222) [-642.493] * [-640.775] (-642.779) (-644.047) (-642.013) -- 0:00:51
Average standard deviation of split frequencies: 0.016961
150500 -- (-642.159) (-643.700) (-640.774) [-641.020] * (-642.405) [-640.425] (-640.269) (-639.529) -- 0:00:50
151000 -- (-641.245) [-640.967] (-643.149) (-641.118) * (-641.508) [-640.385] (-640.361) (-648.423) -- 0:00:50
151500 -- (-641.433) [-640.931] (-645.201) (-643.438) * [-644.554] (-643.897) (-641.475) (-645.837) -- 0:00:50
152000 -- [-642.629] (-640.500) (-640.197) (-644.460) * (-641.994) [-640.875] (-642.284) (-644.043) -- 0:00:50
152500 -- (-639.176) (-643.913) (-641.864) [-642.516] * (-644.454) (-638.929) [-640.198] (-644.453) -- 0:00:50
153000 -- (-639.013) (-644.288) (-642.292) [-641.945] * (-640.501) (-639.824) [-640.952] (-641.870) -- 0:00:49
153500 -- [-639.124] (-643.777) (-641.661) (-642.108) * [-640.443] (-639.705) (-641.656) (-639.633) -- 0:00:49
154000 -- (-639.333) (-642.547) [-642.360] (-642.087) * (-644.192) (-640.810) (-639.817) [-639.780] -- 0:00:49
154500 -- [-639.336] (-641.757) (-641.421) (-640.411) * (-648.879) [-641.084] (-640.756) (-642.507) -- 0:00:49
155000 -- [-640.368] (-644.266) (-645.409) (-640.097) * [-642.281] (-639.130) (-648.273) (-642.917) -- 0:00:49
Average standard deviation of split frequencies: 0.015268
155500 -- (-641.999) [-640.089] (-647.880) (-642.379) * (-641.253) [-640.079] (-652.884) (-641.612) -- 0:00:48
156000 -- (-641.259) [-640.233] (-642.344) (-644.922) * (-642.883) (-640.713) [-639.168] (-642.898) -- 0:00:48
156500 -- (-641.782) (-642.449) [-639.234] (-645.071) * (-641.111) (-640.533) [-639.842] (-643.353) -- 0:00:48
157000 -- (-642.359) (-638.797) [-640.849] (-642.440) * [-641.257] (-641.575) (-643.187) (-641.044) -- 0:00:48
157500 -- [-642.157] (-642.571) (-640.094) (-642.160) * (-644.935) (-640.807) (-641.185) [-640.965] -- 0:00:48
158000 -- (-641.083) (-640.593) [-640.511] (-640.478) * (-650.268) (-641.651) (-642.162) [-640.909] -- 0:00:53
158500 -- (-639.062) (-640.322) (-641.235) [-639.421] * [-644.238] (-640.300) (-641.680) (-643.558) -- 0:00:53
159000 -- (-640.301) [-641.572] (-641.512) (-644.803) * (-639.742) (-640.161) (-640.373) [-642.106] -- 0:00:52
159500 -- [-640.265] (-642.737) (-639.295) (-644.587) * (-639.628) (-640.011) (-641.472) [-641.558] -- 0:00:52
160000 -- [-640.328] (-640.625) (-639.287) (-640.849) * (-641.659) [-641.609] (-644.182) (-643.722) -- 0:00:52
Average standard deviation of split frequencies: 0.015597
160500 -- [-642.068] (-640.648) (-643.039) (-641.778) * (-639.452) (-639.922) [-641.845] (-642.479) -- 0:00:52
161000 -- (-639.909) [-641.014] (-640.428) (-642.201) * [-643.398] (-640.407) (-640.035) (-644.391) -- 0:00:52
161500 -- (-639.333) [-639.660] (-642.705) (-640.966) * [-640.663] (-640.838) (-641.810) (-644.292) -- 0:00:51
162000 -- (-640.478) [-639.756] (-643.384) (-639.672) * [-641.197] (-640.761) (-642.283) (-641.756) -- 0:00:51
162500 -- (-639.675) (-641.765) (-640.243) [-642.648] * (-640.392) [-642.028] (-641.190) (-643.872) -- 0:00:51
163000 -- (-642.114) (-641.498) (-640.717) [-641.305] * [-640.195] (-644.239) (-640.604) (-641.213) -- 0:00:51
163500 -- (-639.438) [-641.868] (-640.022) (-642.429) * (-639.114) [-644.609] (-640.357) (-642.199) -- 0:00:51
164000 -- (-640.542) (-642.297) [-643.571] (-642.683) * [-639.439] (-642.517) (-640.051) (-640.206) -- 0:00:50
164500 -- [-642.855] (-641.598) (-641.191) (-639.310) * (-639.422) [-642.854] (-639.170) (-638.867) -- 0:00:50
165000 -- (-641.087) [-641.258] (-639.815) (-640.091) * [-639.899] (-641.037) (-641.673) (-639.774) -- 0:00:50
Average standard deviation of split frequencies: 0.014348
165500 -- (-641.587) (-641.963) [-639.404] (-643.377) * [-642.512] (-641.331) (-644.335) (-641.681) -- 0:00:50
166000 -- (-639.966) (-641.499) (-639.474) [-641.854] * [-641.387] (-644.211) (-638.762) (-640.180) -- 0:00:50
166500 -- (-639.844) (-641.317) [-640.125] (-639.893) * [-643.841] (-641.428) (-642.180) (-641.819) -- 0:00:50
167000 -- (-640.662) (-641.278) [-638.919] (-640.533) * [-639.071] (-647.705) (-639.441) (-640.524) -- 0:00:49
167500 -- (-640.404) (-640.571) (-639.443) [-640.141] * (-644.867) (-643.340) [-639.468] (-643.001) -- 0:00:49
168000 -- (-643.931) [-639.486] (-641.880) (-641.635) * [-642.679] (-639.543) (-641.161) (-640.845) -- 0:00:49
168500 -- (-644.521) [-640.103] (-639.937) (-643.359) * (-640.512) (-639.809) [-639.312] (-643.877) -- 0:00:49
169000 -- (-643.079) [-639.985] (-640.075) (-639.085) * (-641.558) [-640.601] (-641.965) (-640.700) -- 0:00:49
169500 -- [-641.274] (-640.143) (-641.988) (-643.191) * [-642.273] (-642.033) (-642.627) (-640.576) -- 0:00:48
170000 -- [-642.308] (-641.841) (-639.688) (-640.927) * (-641.025) (-640.983) (-645.742) [-641.462] -- 0:00:48
Average standard deviation of split frequencies: 0.015744
170500 -- (-639.651) (-640.752) [-639.321] (-639.786) * [-639.596] (-640.253) (-639.713) (-650.989) -- 0:00:48
171000 -- (-642.666) [-644.023] (-639.710) (-639.805) * [-639.552] (-640.971) (-641.575) (-649.215) -- 0:00:48
171500 -- (-641.102) (-640.475) [-639.515] (-639.221) * (-640.408) (-640.898) [-641.055] (-640.881) -- 0:00:48
172000 -- (-640.655) [-641.140] (-640.315) (-639.354) * [-642.626] (-639.906) (-641.090) (-639.724) -- 0:00:48
172500 -- (-641.057) [-641.008] (-640.339) (-645.393) * (-649.493) [-641.899] (-643.607) (-639.526) -- 0:00:47
173000 -- (-640.210) (-640.699) [-642.200] (-645.008) * (-650.382) (-639.739) [-642.110] (-640.525) -- 0:00:47
173500 -- (-641.833) (-639.601) (-640.164) [-644.254] * (-641.629) [-640.751] (-640.283) (-643.209) -- 0:00:47
174000 -- [-639.099] (-641.737) (-641.371) (-643.096) * (-641.302) (-640.115) [-642.565] (-645.717) -- 0:00:52
174500 -- (-639.477) (-642.275) [-641.773] (-642.618) * (-642.396) (-640.384) (-641.705) [-641.994] -- 0:00:52
175000 -- [-640.701] (-642.855) (-641.033) (-640.078) * (-645.703) (-641.421) (-643.385) [-642.798] -- 0:00:51
Average standard deviation of split frequencies: 0.016071
175500 -- (-639.975) [-642.826] (-640.203) (-640.075) * (-643.980) (-642.120) (-641.205) [-642.436] -- 0:00:51
176000 -- (-642.926) [-640.467] (-639.733) (-645.795) * [-642.283] (-641.034) (-639.625) (-644.695) -- 0:00:51
176500 -- [-640.996] (-639.650) (-641.046) (-645.579) * [-638.923] (-639.716) (-639.423) (-642.570) -- 0:00:51
177000 -- (-640.039) (-642.469) (-640.997) [-640.059] * (-647.633) [-640.417] (-639.501) (-640.133) -- 0:00:51
177500 -- [-643.440] (-640.218) (-641.407) (-640.791) * (-646.227) [-638.744] (-638.899) (-641.149) -- 0:00:50
178000 -- (-640.452) (-639.406) [-639.566] (-639.412) * (-644.925) (-639.759) [-640.760] (-641.087) -- 0:00:50
178500 -- (-645.300) [-640.160] (-640.520) (-639.122) * (-642.556) [-640.226] (-640.163) (-639.113) -- 0:00:50
179000 -- (-640.514) (-639.892) [-639.550] (-640.588) * (-639.778) (-643.243) [-639.263] (-639.219) -- 0:00:50
179500 -- (-643.253) (-641.011) (-641.017) [-639.894] * (-642.867) [-642.588] (-639.287) (-639.219) -- 0:00:50
180000 -- (-642.311) [-641.442] (-639.299) (-643.090) * (-641.445) [-639.896] (-639.364) (-639.834) -- 0:00:50
Average standard deviation of split frequencies: 0.016342
180500 -- (-642.581) [-641.701] (-642.046) (-642.262) * [-641.608] (-640.938) (-643.845) (-641.002) -- 0:00:49
181000 -- [-642.035] (-642.057) (-641.360) (-644.241) * (-640.063) (-644.002) [-639.721] (-640.208) -- 0:00:49
181500 -- (-640.535) (-642.166) [-642.698] (-641.280) * (-643.486) [-640.391] (-642.621) (-638.938) -- 0:00:49
182000 -- (-641.237) (-644.081) (-642.134) [-641.675] * (-641.820) (-641.437) [-639.150] (-650.677) -- 0:00:49
182500 -- [-641.271] (-646.215) (-641.579) (-642.530) * (-644.040) (-642.841) (-640.993) [-645.975] -- 0:00:49
183000 -- (-646.400) [-640.486] (-640.193) (-640.145) * (-641.265) (-642.220) [-641.913] (-644.275) -- 0:00:49
183500 -- (-641.528) (-639.549) [-641.496] (-640.655) * (-646.450) (-642.537) (-640.211) [-643.305] -- 0:00:48
184000 -- (-639.715) (-641.370) [-641.746] (-639.773) * (-645.620) (-643.988) (-640.982) [-641.843] -- 0:00:48
184500 -- [-639.165] (-639.611) (-645.230) (-640.367) * (-639.284) (-641.246) (-639.546) [-640.721] -- 0:00:48
185000 -- (-640.119) (-640.687) (-640.783) [-642.515] * (-641.595) (-641.546) [-640.212] (-644.651) -- 0:00:48
Average standard deviation of split frequencies: 0.016407
185500 -- [-642.599] (-641.577) (-645.241) (-639.266) * (-641.657) [-640.820] (-639.871) (-645.712) -- 0:00:48
186000 -- (-644.302) (-641.774) (-640.812) [-642.375] * (-642.559) [-641.186] (-639.865) (-639.315) -- 0:00:48
186500 -- (-641.892) (-639.187) [-641.288] (-640.074) * (-645.090) [-643.266] (-638.884) (-639.900) -- 0:00:47
187000 -- (-640.998) [-640.367] (-639.653) (-640.653) * (-642.203) (-642.317) [-639.801] (-640.945) -- 0:00:47
187500 -- (-642.520) (-638.983) [-638.924] (-640.547) * (-640.510) [-640.965] (-639.381) (-641.051) -- 0:00:47
188000 -- (-644.788) (-644.620) [-639.467] (-641.922) * (-641.783) [-641.063] (-639.021) (-640.320) -- 0:00:47
188500 -- (-640.477) (-640.357) [-642.013] (-639.925) * (-645.358) (-642.366) (-642.510) [-639.816] -- 0:00:47
189000 -- (-640.979) [-640.291] (-646.818) (-639.816) * [-641.089] (-640.924) (-641.926) (-639.437) -- 0:00:47
189500 -- (-641.745) (-640.887) (-640.798) [-642.221] * [-639.581] (-640.091) (-641.897) (-642.740) -- 0:00:47
190000 -- (-641.912) (-640.152) (-640.480) [-641.018] * [-643.925] (-641.331) (-639.439) (-639.989) -- 0:00:46
Average standard deviation of split frequencies: 0.018608
190500 -- [-639.778] (-642.787) (-640.711) (-641.468) * (-640.397) [-642.207] (-640.552) (-639.288) -- 0:00:50
191000 -- (-641.199) [-642.517] (-642.772) (-645.610) * (-639.852) (-642.316) [-639.685] (-643.138) -- 0:00:50
191500 -- (-643.079) [-639.961] (-645.263) (-643.347) * (-639.798) (-644.102) [-640.213] (-640.935) -- 0:00:50
192000 -- (-640.760) (-639.677) [-645.891] (-644.613) * (-642.504) (-644.474) [-643.188] (-642.148) -- 0:00:50
192500 -- (-640.951) (-639.233) (-644.858) [-641.639] * (-641.985) [-642.977] (-639.857) (-641.057) -- 0:00:50
193000 -- [-642.954] (-645.128) (-640.080) (-639.393) * (-644.247) (-643.918) (-644.322) [-640.805] -- 0:00:50
193500 -- (-641.267) [-640.481] (-640.933) (-640.134) * (-642.801) [-640.284] (-645.119) (-639.817) -- 0:00:50
194000 -- (-641.386) [-639.664] (-640.661) (-639.032) * (-641.915) [-641.527] (-639.056) (-643.353) -- 0:00:49
194500 -- [-640.586] (-640.723) (-640.963) (-639.749) * (-644.208) (-639.659) (-639.542) [-645.669] -- 0:00:49
195000 -- (-639.749) (-640.649) [-640.689] (-639.913) * [-642.522] (-640.107) (-639.456) (-647.118) -- 0:00:49
Average standard deviation of split frequencies: 0.018988
195500 -- (-639.704) (-640.796) (-640.787) [-641.099] * [-643.662] (-641.629) (-639.949) (-644.529) -- 0:00:49
196000 -- (-643.859) (-639.849) [-639.331] (-641.835) * (-644.509) (-641.645) (-642.461) [-640.743] -- 0:00:49
196500 -- (-642.943) [-639.539] (-639.217) (-644.557) * (-641.822) [-643.838] (-639.517) (-643.069) -- 0:00:49
197000 -- (-642.007) [-643.195] (-641.236) (-641.689) * [-640.248] (-643.074) (-640.602) (-641.026) -- 0:00:48
197500 -- (-639.599) (-641.826) (-639.944) [-644.384] * (-642.738) (-640.817) [-643.301] (-640.236) -- 0:00:48
198000 -- (-644.389) (-643.595) [-641.690] (-644.368) * [-643.222] (-641.718) (-640.570) (-640.966) -- 0:00:48
198500 -- (-639.509) (-642.171) [-640.155] (-642.417) * (-640.438) (-642.360) (-639.445) [-642.481] -- 0:00:48
199000 -- [-639.487] (-645.945) (-639.337) (-643.424) * (-644.146) (-640.170) [-639.732] (-641.928) -- 0:00:48
199500 -- (-638.831) [-641.922] (-639.537) (-640.324) * [-640.524] (-642.644) (-639.139) (-641.985) -- 0:00:48
200000 -- [-639.589] (-641.886) (-639.989) (-645.894) * (-641.311) [-643.489] (-639.129) (-643.550) -- 0:00:48
Average standard deviation of split frequencies: 0.020154
200500 -- (-643.276) (-640.585) [-641.469] (-640.251) * (-640.823) (-641.073) (-640.972) [-639.531] -- 0:00:47
201000 -- (-641.689) [-641.186] (-640.049) (-643.188) * (-644.891) [-641.702] (-639.986) (-640.522) -- 0:00:47
201500 -- [-640.534] (-644.715) (-639.381) (-640.021) * (-640.803) [-642.185] (-642.740) (-640.512) -- 0:00:47
202000 -- (-640.829) (-641.042) (-639.641) [-640.284] * (-639.389) [-643.118] (-639.492) (-639.427) -- 0:00:47
202500 -- (-644.705) (-641.238) (-639.195) [-640.715] * (-639.198) (-640.349) [-640.052] (-640.425) -- 0:00:47
203000 -- (-641.588) (-641.112) (-641.801) [-643.755] * [-639.699] (-641.210) (-640.309) (-640.372) -- 0:00:47
203500 -- [-644.372] (-640.804) (-642.069) (-640.349) * (-641.709) (-642.203) (-640.956) [-639.634] -- 0:00:46
204000 -- (-640.126) (-641.373) (-645.283) [-643.320] * (-641.001) (-642.295) [-642.987] (-641.077) -- 0:00:46
204500 -- (-640.231) (-644.083) [-641.785] (-641.011) * (-639.172) (-640.872) (-640.490) [-639.512] -- 0:00:46
205000 -- (-640.744) (-643.863) [-639.786] (-640.116) * (-639.162) (-644.767) (-642.712) [-638.928] -- 0:00:46
Average standard deviation of split frequencies: 0.021679
205500 -- (-643.602) (-640.021) (-642.083) [-641.227] * (-639.687) (-642.230) (-639.840) [-639.082] -- 0:00:46
206000 -- [-640.718] (-641.806) (-640.415) (-640.279) * [-641.274] (-645.472) (-643.003) (-639.557) -- 0:00:46
206500 -- [-645.407] (-641.156) (-641.814) (-640.731) * (-640.542) [-645.465] (-643.749) (-640.317) -- 0:00:46
207000 -- (-647.158) (-644.253) [-642.240] (-643.087) * [-640.302] (-643.381) (-643.044) (-640.519) -- 0:00:49
207500 -- (-641.170) (-639.292) (-644.307) [-640.897] * (-643.124) [-640.150] (-640.800) (-639.248) -- 0:00:49
208000 -- (-641.624) [-640.860] (-639.786) (-640.113) * (-642.297) (-641.423) [-640.577] (-639.084) -- 0:00:49
208500 -- (-643.174) (-639.466) (-648.960) [-640.085] * [-641.511] (-639.848) (-644.612) (-639.299) -- 0:00:49
209000 -- [-640.207] (-639.741) (-645.159) (-639.396) * (-638.837) (-642.528) (-639.931) [-640.269] -- 0:00:49
209500 -- (-640.005) (-640.546) [-640.268] (-641.588) * (-639.850) [-642.444] (-640.209) (-640.583) -- 0:00:49
210000 -- (-642.169) [-641.338] (-640.774) (-646.813) * (-642.267) [-640.781] (-639.923) (-639.335) -- 0:00:48
Average standard deviation of split frequencies: 0.021146
210500 -- (-644.371) [-640.118] (-640.318) (-639.855) * (-641.419) (-640.384) [-639.970] (-640.625) -- 0:00:48
211000 -- (-642.516) (-640.836) [-640.248] (-639.880) * [-641.779] (-641.822) (-639.276) (-640.492) -- 0:00:48
211500 -- [-638.800] (-642.392) (-644.318) (-643.745) * (-643.174) (-643.978) (-642.110) [-640.390] -- 0:00:48
212000 -- [-638.902] (-640.819) (-642.955) (-643.594) * (-642.542) (-645.219) [-639.547] (-643.499) -- 0:00:48
212500 -- (-639.547) (-639.529) (-641.107) [-641.389] * (-640.582) (-647.210) [-641.889] (-641.296) -- 0:00:48
213000 -- (-640.681) [-641.565] (-648.501) (-645.064) * (-641.673) (-647.829) [-642.047] (-641.970) -- 0:00:48
213500 -- [-641.006] (-641.183) (-644.784) (-640.532) * (-641.177) (-644.771) (-640.445) [-639.605] -- 0:00:47
214000 -- (-640.960) (-641.092) (-641.006) [-639.598] * [-643.384] (-641.672) (-642.291) (-647.507) -- 0:00:47
214500 -- (-641.988) [-640.396] (-642.443) (-639.178) * (-640.638) (-642.230) [-641.495] (-650.260) -- 0:00:47
215000 -- (-641.242) (-643.693) [-639.938] (-639.545) * (-640.764) [-640.977] (-642.360) (-641.777) -- 0:00:47
Average standard deviation of split frequencies: 0.022188
215500 -- (-640.602) (-640.181) [-639.067] (-641.613) * (-641.877) (-642.084) (-641.422) [-640.199] -- 0:00:47
216000 -- (-640.213) (-639.442) [-641.654] (-639.093) * [-641.902] (-640.833) (-640.399) (-639.296) -- 0:00:47
216500 -- [-639.607] (-641.852) (-643.635) (-640.734) * [-641.602] (-639.586) (-639.827) (-640.466) -- 0:00:47
217000 -- (-641.352) (-640.354) [-642.327] (-639.682) * (-639.522) (-644.729) (-641.945) [-642.203] -- 0:00:46
217500 -- [-640.797] (-640.515) (-642.362) (-642.502) * [-644.049] (-640.298) (-642.051) (-642.255) -- 0:00:46
218000 -- (-639.758) (-640.207) [-640.947] (-641.738) * (-643.923) (-639.534) (-642.267) [-639.598] -- 0:00:46
218500 -- (-641.272) (-640.206) [-640.147] (-640.320) * (-639.770) (-639.921) [-640.272] (-641.932) -- 0:00:46
219000 -- (-642.280) (-641.839) (-641.238) [-641.840] * [-641.905] (-640.637) (-639.056) (-641.352) -- 0:00:46
219500 -- (-640.415) [-641.652] (-642.640) (-640.868) * (-643.527) (-642.048) [-645.867] (-641.008) -- 0:00:46
220000 -- (-640.523) (-640.261) [-639.750] (-643.161) * (-641.479) (-643.994) [-646.795] (-642.174) -- 0:00:46
Average standard deviation of split frequencies: 0.019867
220500 -- [-641.794] (-642.201) (-640.003) (-641.546) * (-644.438) (-639.782) (-641.664) [-641.802] -- 0:00:45
221000 -- (-640.976) (-642.200) [-639.136] (-640.855) * (-643.822) [-640.858] (-641.848) (-640.439) -- 0:00:45
221500 -- [-640.145] (-643.147) (-641.768) (-641.292) * (-641.801) (-641.569) (-645.665) [-639.571] -- 0:00:45
222000 -- [-640.736] (-642.106) (-643.041) (-640.933) * [-639.914] (-648.543) (-641.047) (-640.316) -- 0:00:45
222500 -- [-642.498] (-640.770) (-639.331) (-640.931) * (-639.706) (-639.347) (-640.526) [-640.961] -- 0:00:45
223000 -- (-643.981) (-640.626) [-639.099] (-643.059) * (-639.732) (-639.099) (-642.252) [-641.348] -- 0:00:45
223500 -- (-639.666) [-640.987] (-640.805) (-638.824) * (-642.086) [-639.926] (-641.788) (-641.193) -- 0:00:48
224000 -- (-641.537) [-640.320] (-640.348) (-641.724) * (-640.334) (-640.687) (-639.431) [-640.668] -- 0:00:48
224500 -- (-641.389) (-641.627) (-641.229) [-643.299] * (-640.758) (-639.367) [-640.111] (-639.863) -- 0:00:48
225000 -- [-640.266] (-639.202) (-639.726) (-642.360) * (-640.384) (-640.702) (-647.082) [-641.644] -- 0:00:48
Average standard deviation of split frequencies: 0.019816
225500 -- (-639.597) (-639.282) [-639.192] (-642.611) * (-640.455) (-640.515) (-641.054) [-639.255] -- 0:00:48
226000 -- (-638.752) [-639.481] (-640.072) (-644.816) * (-650.378) (-643.648) [-640.384] (-640.828) -- 0:00:47
226500 -- (-638.795) [-640.733] (-642.014) (-640.682) * (-642.343) [-640.331] (-642.821) (-642.478) -- 0:00:47
227000 -- (-640.517) (-642.066) [-642.728] (-639.158) * (-642.551) (-643.019) (-643.489) [-642.806] -- 0:00:47
227500 -- (-643.538) (-640.417) [-639.046] (-639.678) * (-641.705) (-640.512) (-640.243) [-639.464] -- 0:00:47
228000 -- (-640.925) (-641.204) (-639.728) [-639.285] * (-641.621) [-639.552] (-639.564) (-640.314) -- 0:00:47
228500 -- [-640.363] (-642.836) (-642.209) (-640.521) * (-642.553) (-640.691) (-641.159) [-643.072] -- 0:00:47
229000 -- [-639.178] (-641.841) (-641.749) (-640.399) * (-641.914) (-640.894) [-640.170] (-642.110) -- 0:00:47
229500 -- (-638.969) (-640.597) (-642.206) [-639.632] * (-639.637) (-642.673) [-640.377] (-640.877) -- 0:00:47
230000 -- (-639.805) (-642.181) (-643.223) [-641.359] * (-641.606) [-641.748] (-642.611) (-640.962) -- 0:00:46
Average standard deviation of split frequencies: 0.018904
230500 -- [-639.882] (-640.113) (-641.756) (-642.923) * (-640.339) (-639.003) [-640.054] (-641.406) -- 0:00:46
231000 -- [-639.568] (-639.496) (-641.100) (-639.305) * (-639.579) [-642.936] (-640.211) (-640.211) -- 0:00:46
231500 -- (-640.460) (-639.299) (-641.550) [-642.809] * (-641.888) (-642.849) [-644.867] (-642.716) -- 0:00:46
232000 -- (-641.352) (-639.893) (-640.850) [-642.010] * [-640.552] (-641.736) (-641.226) (-641.359) -- 0:00:46
232500 -- (-642.236) [-638.847] (-639.927) (-642.242) * (-640.681) [-640.316] (-640.693) (-641.970) -- 0:00:46
233000 -- (-642.419) [-638.990] (-641.428) (-643.387) * (-640.478) [-641.014] (-640.001) (-640.359) -- 0:00:46
233500 -- (-642.354) (-642.183) (-640.673) [-643.511] * (-646.008) (-641.938) [-642.105] (-640.804) -- 0:00:45
234000 -- (-645.159) (-643.731) [-641.444] (-641.584) * (-642.390) [-639.709] (-646.273) (-641.644) -- 0:00:45
234500 -- (-639.434) [-641.098] (-640.344) (-641.272) * [-641.629] (-640.245) (-644.010) (-640.604) -- 0:00:45
235000 -- (-641.301) [-640.742] (-642.497) (-642.260) * (-643.641) [-639.945] (-641.680) (-643.166) -- 0:00:45
Average standard deviation of split frequencies: 0.018776
235500 -- (-644.589) (-641.427) [-642.035] (-641.107) * [-645.109] (-641.194) (-639.290) (-640.256) -- 0:00:45
236000 -- (-646.346) (-640.407) (-642.018) [-641.566] * [-640.686] (-644.141) (-640.670) (-641.475) -- 0:00:45
236500 -- [-642.896] (-643.110) (-640.777) (-639.163) * (-641.204) (-646.548) (-641.267) [-640.692] -- 0:00:45
237000 -- (-641.528) [-640.353] (-641.726) (-641.827) * (-645.181) (-640.758) (-640.727) [-642.759] -- 0:00:45
237500 -- [-640.621] (-643.187) (-639.764) (-641.721) * (-641.128) (-641.104) (-644.148) [-639.863] -- 0:00:44
238000 -- (-642.107) [-640.479] (-640.328) (-640.644) * (-643.184) [-641.341] (-643.607) (-642.375) -- 0:00:44
238500 -- (-646.019) (-642.121) (-646.661) [-643.902] * (-643.296) (-640.767) [-641.949] (-644.826) -- 0:00:44
239000 -- [-642.728] (-642.024) (-644.107) (-642.309) * [-641.605] (-646.742) (-639.718) (-642.488) -- 0:00:44
239500 -- (-640.601) (-643.317) (-643.492) [-643.372] * (-641.087) (-644.747) [-640.974] (-639.719) -- 0:00:44
240000 -- (-641.536) (-643.068) [-639.883] (-640.349) * [-640.991] (-640.640) (-641.627) (-640.428) -- 0:00:44
Average standard deviation of split frequencies: 0.017629
240500 -- [-640.593] (-642.964) (-639.175) (-642.466) * (-641.361) (-640.502) (-641.464) [-640.832] -- 0:00:47
241000 -- (-641.455) (-641.585) (-642.913) [-641.092] * (-639.527) [-641.704] (-643.399) (-640.435) -- 0:00:47
241500 -- (-641.061) [-642.342] (-645.598) (-641.926) * (-642.587) (-641.489) [-640.598] (-640.114) -- 0:00:47
242000 -- [-646.251] (-641.245) (-642.104) (-641.748) * [-639.565] (-641.543) (-646.988) (-643.372) -- 0:00:46
242500 -- [-640.512] (-641.265) (-641.185) (-640.433) * (-640.270) (-644.034) (-639.860) [-642.663] -- 0:00:46
243000 -- [-639.178] (-643.392) (-641.237) (-641.839) * (-639.632) [-640.021] (-639.239) (-641.988) -- 0:00:46
243500 -- (-646.545) [-639.988] (-642.889) (-645.428) * (-644.534) (-641.198) (-638.936) [-639.141] -- 0:00:46
244000 -- (-645.119) [-640.522] (-640.977) (-645.121) * (-640.821) (-639.542) (-641.602) [-639.112] -- 0:00:46
244500 -- (-640.992) (-644.673) (-640.130) [-639.943] * (-640.020) (-641.535) [-639.946] (-640.330) -- 0:00:46
245000 -- [-640.057] (-640.743) (-641.045) (-643.444) * (-644.831) (-640.208) (-646.188) [-639.641] -- 0:00:46
Average standard deviation of split frequencies: 0.017726
245500 -- (-641.271) (-641.899) (-648.195) [-643.325] * (-641.286) [-639.497] (-643.489) (-641.564) -- 0:00:46
246000 -- (-643.524) (-641.073) (-645.903) [-644.278] * (-640.526) [-640.459] (-644.734) (-639.766) -- 0:00:45
246500 -- (-641.901) (-641.327) (-645.036) [-642.595] * (-640.613) (-639.419) (-641.749) [-640.377] -- 0:00:45
247000 -- [-643.172] (-641.095) (-645.012) (-642.808) * [-640.256] (-642.488) (-640.477) (-640.195) -- 0:00:45
247500 -- (-641.156) (-640.950) (-641.292) [-640.329] * (-639.187) [-641.963] (-643.285) (-645.063) -- 0:00:45
248000 -- (-640.512) (-641.892) [-642.828] (-640.586) * (-639.481) (-644.482) [-639.379] (-643.414) -- 0:00:45
248500 -- [-639.489] (-641.477) (-643.944) (-640.984) * (-642.286) [-640.074] (-640.939) (-643.786) -- 0:00:45
249000 -- (-640.711) (-643.649) [-641.330] (-641.412) * [-641.253] (-643.308) (-641.760) (-642.396) -- 0:00:45
249500 -- (-643.535) (-645.097) (-643.023) [-643.221] * (-640.671) (-642.936) [-641.556] (-644.023) -- 0:00:45
250000 -- (-639.121) (-642.728) (-640.486) [-641.278] * (-640.608) (-640.479) [-642.337] (-642.010) -- 0:00:45
Average standard deviation of split frequencies: 0.018242
250500 -- [-640.015] (-644.108) (-640.724) (-641.150) * (-641.237) (-642.090) [-640.392] (-645.300) -- 0:00:44
251000 -- (-641.031) (-640.466) [-641.571] (-640.234) * (-641.918) [-640.404] (-641.129) (-640.118) -- 0:00:44
251500 -- (-640.371) (-642.757) (-640.301) [-642.303] * (-641.998) (-641.948) [-640.381] (-639.815) -- 0:00:44
252000 -- (-640.456) (-639.214) [-639.548] (-641.122) * (-640.214) [-644.234] (-642.059) (-641.201) -- 0:00:44
252500 -- [-639.497] (-640.007) (-645.148) (-641.931) * (-641.891) [-642.042] (-641.754) (-640.037) -- 0:00:44
253000 -- [-645.106] (-647.566) (-643.576) (-642.011) * (-642.375) (-640.383) [-640.826] (-640.194) -- 0:00:44
253500 -- (-641.018) (-639.603) [-641.666] (-640.541) * [-641.901] (-639.763) (-639.474) (-640.260) -- 0:00:44
254000 -- [-643.857] (-641.466) (-643.908) (-640.842) * [-643.086] (-640.216) (-640.270) (-640.634) -- 0:00:44
254500 -- [-642.209] (-639.783) (-641.050) (-640.511) * (-639.976) (-641.685) (-639.101) [-640.591] -- 0:00:43
255000 -- (-642.913) (-639.803) [-641.485] (-639.491) * (-644.111) (-640.080) (-641.813) [-639.864] -- 0:00:43
Average standard deviation of split frequencies: 0.020051
255500 -- [-639.992] (-643.026) (-640.077) (-640.332) * (-641.868) [-642.124] (-641.711) (-640.656) -- 0:00:43
256000 -- [-640.026] (-639.217) (-639.452) (-639.350) * (-640.437) (-640.115) [-641.967] (-640.492) -- 0:00:43
256500 -- (-640.562) (-639.921) (-643.367) [-641.287] * (-641.519) [-643.305] (-640.792) (-643.031) -- 0:00:43
257000 -- [-640.765] (-642.570) (-644.416) (-643.972) * [-640.139] (-647.250) (-644.660) (-641.518) -- 0:00:46
257500 -- (-641.568) [-642.403] (-644.130) (-645.364) * [-639.845] (-643.810) (-640.753) (-640.477) -- 0:00:46
258000 -- (-638.847) (-640.510) (-644.232) [-643.513] * (-642.120) [-641.313] (-641.142) (-641.770) -- 0:00:46
258500 -- (-639.348) [-640.619] (-641.209) (-642.322) * (-641.410) (-640.823) (-640.525) [-639.952] -- 0:00:45
259000 -- [-643.697] (-640.866) (-641.984) (-640.877) * (-641.519) (-641.587) (-641.888) [-639.515] -- 0:00:45
259500 -- (-641.715) (-639.843) (-642.354) [-644.806] * (-645.398) (-643.276) (-641.098) [-639.662] -- 0:00:45
260000 -- [-640.940] (-639.872) (-643.872) (-640.702) * (-639.045) [-640.035] (-641.400) (-639.860) -- 0:00:45
Average standard deviation of split frequencies: 0.019290
260500 -- (-641.964) (-640.447) (-641.076) [-641.493] * [-640.593] (-642.385) (-643.324) (-640.314) -- 0:00:45
261000 -- (-642.520) (-641.846) (-644.210) [-639.739] * (-639.494) (-639.574) [-645.744] (-639.605) -- 0:00:45
261500 -- [-640.572] (-640.877) (-641.002) (-639.481) * (-640.750) (-642.183) [-640.370] (-643.268) -- 0:00:45
262000 -- [-643.543] (-640.273) (-640.355) (-641.916) * (-642.630) (-639.979) [-640.276] (-641.642) -- 0:00:45
262500 -- (-641.842) (-640.497) [-643.119] (-640.562) * [-639.373] (-642.135) (-640.453) (-642.637) -- 0:00:44
263000 -- (-643.723) (-640.350) [-640.846] (-642.169) * (-640.854) [-642.175] (-640.612) (-640.856) -- 0:00:44
263500 -- (-641.733) (-639.852) (-638.929) [-641.452] * (-641.362) (-641.636) (-644.954) [-640.145] -- 0:00:44
264000 -- [-639.835] (-639.535) (-641.797) (-640.628) * (-647.348) (-641.927) (-642.559) [-640.686] -- 0:00:44
264500 -- [-641.989] (-638.940) (-641.062) (-645.887) * (-644.924) (-641.694) (-640.404) [-640.511] -- 0:00:44
265000 -- [-640.595] (-643.101) (-640.229) (-639.360) * (-640.453) (-639.282) [-642.224] (-643.669) -- 0:00:44
Average standard deviation of split frequencies: 0.018095
265500 -- [-641.454] (-640.045) (-641.009) (-643.415) * [-639.591] (-640.277) (-641.675) (-645.112) -- 0:00:44
266000 -- [-641.655] (-643.363) (-640.078) (-643.084) * (-642.928) (-640.870) (-642.254) [-642.733] -- 0:00:44
266500 -- [-640.672] (-643.053) (-640.569) (-640.117) * (-639.528) (-639.695) [-638.994] (-640.994) -- 0:00:44
267000 -- [-641.455] (-639.238) (-639.884) (-639.691) * [-646.631] (-644.782) (-640.111) (-640.100) -- 0:00:43
267500 -- (-642.639) [-642.187] (-640.786) (-639.069) * [-643.755] (-641.231) (-640.055) (-640.298) -- 0:00:43
268000 -- (-642.644) (-639.972) [-639.548] (-639.008) * (-642.411) [-640.645] (-640.265) (-641.476) -- 0:00:43
268500 -- [-642.501] (-642.995) (-641.089) (-639.173) * [-640.071] (-645.777) (-643.082) (-648.089) -- 0:00:43
269000 -- (-640.079) (-644.721) [-641.419] (-639.749) * (-639.570) (-640.125) [-644.057] (-641.599) -- 0:00:43
269500 -- [-639.983] (-643.718) (-640.606) (-640.801) * [-641.588] (-640.591) (-642.317) (-642.182) -- 0:00:43
270000 -- (-641.008) (-643.117) [-639.652] (-641.283) * (-640.864) [-639.221] (-640.264) (-641.629) -- 0:00:43
Average standard deviation of split frequencies: 0.017329
270500 -- (-643.188) [-641.379] (-641.151) (-640.670) * (-642.051) (-641.707) (-640.664) [-642.459] -- 0:00:43
271000 -- (-641.164) [-641.883] (-642.553) (-639.911) * (-639.863) [-642.790] (-642.227) (-641.880) -- 0:00:43
271500 -- (-640.382) (-643.580) [-639.361] (-640.812) * (-645.834) (-641.133) [-640.307] (-642.669) -- 0:00:42
272000 -- (-642.769) (-642.022) (-641.281) [-642.374] * (-643.472) [-642.322] (-641.116) (-645.687) -- 0:00:42
272500 -- (-640.573) (-647.340) (-641.912) [-641.062] * [-639.720] (-640.851) (-639.033) (-643.460) -- 0:00:42
273000 -- [-640.958] (-641.625) (-644.785) (-642.038) * (-639.145) (-641.100) (-639.822) [-641.738] -- 0:00:45
273500 -- (-639.923) (-642.636) (-641.447) [-641.096] * (-640.770) [-640.196] (-640.614) (-645.150) -- 0:00:45
274000 -- (-640.520) (-639.924) (-640.316) [-641.233] * (-643.976) (-643.581) (-640.591) [-642.540] -- 0:00:45
274500 -- [-641.415] (-639.368) (-640.721) (-641.828) * (-643.525) (-642.286) (-642.687) [-643.699] -- 0:00:44
275000 -- (-639.372) [-641.155] (-641.004) (-641.833) * (-642.168) (-640.678) (-641.328) [-640.661] -- 0:00:44
Average standard deviation of split frequencies: 0.017619
275500 -- (-642.240) (-643.442) [-641.560] (-640.440) * (-642.109) (-640.519) [-641.506] (-643.159) -- 0:00:44
276000 -- (-641.149) (-640.650) (-643.332) [-646.582] * (-642.292) (-641.915) [-641.121] (-643.398) -- 0:00:44
276500 -- [-639.311] (-643.377) (-641.884) (-642.030) * (-640.446) (-644.391) (-639.569) [-642.285] -- 0:00:44
277000 -- [-642.434] (-642.625) (-640.436) (-640.362) * (-639.505) (-642.142) (-640.565) [-639.715] -- 0:00:44
277500 -- (-641.715) (-643.096) [-640.253] (-640.214) * (-641.189) (-641.758) [-641.399] (-640.856) -- 0:00:44
278000 -- (-640.673) (-641.803) (-644.032) [-642.047] * (-642.297) (-643.480) [-640.531] (-643.146) -- 0:00:44
278500 -- (-640.962) (-640.422) (-641.416) [-639.253] * (-642.735) (-639.496) [-641.982] (-640.831) -- 0:00:44
279000 -- (-641.376) (-639.624) [-639.968] (-639.635) * (-641.032) (-642.156) (-640.474) [-641.682] -- 0:00:43
279500 -- (-642.697) (-640.618) (-644.904) [-642.318] * (-646.468) (-641.939) (-640.725) [-642.100] -- 0:00:43
280000 -- (-644.032) [-640.695] (-640.327) (-643.213) * (-642.561) (-640.663) (-640.132) [-640.637] -- 0:00:43
Average standard deviation of split frequencies: 0.016619
280500 -- [-644.650] (-644.338) (-642.355) (-644.908) * (-643.226) [-641.256] (-639.413) (-644.034) -- 0:00:43
281000 -- [-642.842] (-640.419) (-640.126) (-644.072) * (-644.814) (-640.908) [-642.110] (-642.221) -- 0:00:43
281500 -- (-643.618) (-641.614) (-638.720) [-639.860] * (-640.071) (-639.167) (-640.770) [-641.493] -- 0:00:43
282000 -- [-650.140] (-642.241) (-639.789) (-642.956) * (-640.771) [-640.803] (-643.749) (-640.394) -- 0:00:43
282500 -- (-640.941) (-639.896) [-641.193] (-642.202) * (-643.379) [-639.634] (-640.369) (-640.382) -- 0:00:43
283000 -- (-639.262) [-640.354] (-643.227) (-641.961) * [-642.653] (-639.588) (-640.347) (-644.963) -- 0:00:43
283500 -- (-642.502) [-638.957] (-642.139) (-641.734) * (-643.848) [-642.340] (-640.091) (-642.067) -- 0:00:42
284000 -- (-643.166) (-641.000) [-642.820] (-644.010) * [-642.537] (-645.732) (-640.080) (-642.155) -- 0:00:42
284500 -- (-639.816) [-639.416] (-639.483) (-645.675) * (-641.892) (-643.067) [-639.577] (-643.887) -- 0:00:42
285000 -- (-642.505) (-641.195) [-639.977] (-643.209) * [-642.036] (-640.798) (-639.074) (-640.456) -- 0:00:42
Average standard deviation of split frequencies: 0.017003
285500 -- [-638.891] (-640.399) (-639.758) (-639.243) * [-639.490] (-641.208) (-641.480) (-640.749) -- 0:00:42
286000 -- (-643.546) (-641.765) [-639.794] (-639.482) * (-641.534) (-648.514) [-639.896] (-640.848) -- 0:00:42
286500 -- (-643.655) (-641.543) (-639.701) [-640.991] * (-641.477) (-640.795) (-639.379) [-640.441] -- 0:00:42
287000 -- (-640.881) (-640.135) [-640.718] (-643.382) * [-640.793] (-640.016) (-640.520) (-640.359) -- 0:00:42
287500 -- (-642.913) (-642.358) (-639.795) [-641.105] * (-642.208) [-639.682] (-641.955) (-639.033) -- 0:00:42
288000 -- [-642.074] (-639.832) (-640.114) (-641.915) * [-639.085] (-644.350) (-642.664) (-643.270) -- 0:00:42
288500 -- (-642.494) [-642.140] (-641.346) (-640.923) * (-642.339) (-641.896) [-641.253] (-640.775) -- 0:00:41
289000 -- [-641.539] (-641.635) (-640.123) (-649.105) * (-640.015) (-644.476) (-640.109) [-641.887] -- 0:00:41
289500 -- [-646.605] (-639.559) (-641.262) (-640.288) * (-642.496) [-640.423] (-641.264) (-640.631) -- 0:00:41
290000 -- (-640.747) [-641.511] (-642.452) (-643.310) * (-640.499) [-641.303] (-640.721) (-641.081) -- 0:00:44
Average standard deviation of split frequencies: 0.016056
290500 -- (-643.231) [-640.782] (-642.881) (-642.185) * (-643.407) [-639.999] (-640.126) (-640.754) -- 0:00:43
291000 -- [-642.348] (-642.100) (-643.980) (-641.938) * (-639.854) (-639.410) (-643.269) [-641.038] -- 0:00:43
291500 -- (-641.255) [-641.206] (-645.133) (-640.234) * (-641.178) (-640.765) (-641.999) [-641.584] -- 0:00:43
292000 -- (-640.137) (-639.687) (-644.628) [-642.497] * (-639.208) [-640.244] (-640.301) (-640.122) -- 0:00:43
292500 -- [-639.478] (-644.618) (-639.266) (-639.270) * (-643.788) (-640.530) (-641.968) [-642.346] -- 0:00:43
293000 -- (-643.809) (-640.734) [-639.680] (-640.026) * (-640.491) (-643.386) (-640.147) [-641.064] -- 0:00:43
293500 -- [-642.054] (-640.312) (-640.348) (-639.701) * (-639.793) [-642.543] (-643.818) (-642.204) -- 0:00:43
294000 -- (-640.744) [-644.281] (-643.353) (-639.807) * (-640.878) (-645.172) (-639.869) [-640.049] -- 0:00:43
294500 -- (-639.901) (-642.133) (-644.121) [-639.392] * (-641.357) (-644.123) [-639.250] (-643.466) -- 0:00:43
295000 -- (-643.013) [-645.295] (-639.624) (-641.712) * (-644.361) (-643.670) [-640.601] (-648.629) -- 0:00:43
Average standard deviation of split frequencies: 0.016642
295500 -- [-640.259] (-640.370) (-639.472) (-640.783) * (-644.278) (-642.996) (-642.209) [-641.269] -- 0:00:42
296000 -- (-643.969) (-640.956) [-641.760] (-639.119) * (-640.977) [-644.394] (-648.638) (-640.645) -- 0:00:42
296500 -- (-645.882) [-639.920] (-639.841) (-641.266) * (-639.671) [-640.130] (-640.902) (-641.770) -- 0:00:42
297000 -- (-642.074) (-639.972) [-642.656] (-643.619) * (-640.665) (-644.622) (-642.088) [-644.282] -- 0:00:42
297500 -- [-643.691] (-641.560) (-640.520) (-644.577) * [-639.434] (-641.185) (-642.951) (-641.286) -- 0:00:42
298000 -- (-642.463) (-643.605) [-640.011] (-641.898) * [-640.606] (-641.256) (-644.230) (-645.121) -- 0:00:42
298500 -- [-639.616] (-641.733) (-640.159) (-639.628) * (-641.436) (-644.125) (-642.830) [-639.305] -- 0:00:42
299000 -- (-642.588) [-640.029] (-640.983) (-640.547) * (-640.787) [-641.623] (-645.433) (-643.631) -- 0:00:42
299500 -- (-642.181) (-644.787) [-642.236] (-642.425) * (-643.190) (-642.259) [-639.328] (-640.622) -- 0:00:42
300000 -- (-642.756) (-640.833) [-640.529] (-643.830) * (-640.229) [-640.516] (-639.317) (-639.972) -- 0:00:42
Average standard deviation of split frequencies: 0.016999
300500 -- (-641.984) (-639.133) [-639.733] (-641.659) * (-642.515) [-643.044] (-640.583) (-640.505) -- 0:00:41
301000 -- (-639.764) (-639.957) [-640.121] (-642.046) * (-643.963) (-642.521) [-640.331] (-640.529) -- 0:00:41
301500 -- (-642.483) [-640.603] (-642.536) (-642.278) * (-642.700) (-645.348) [-642.152] (-641.706) -- 0:00:41
302000 -- [-641.187] (-640.322) (-640.706) (-643.576) * (-642.560) (-642.512) (-643.946) [-641.176] -- 0:00:41
302500 -- (-640.639) (-639.067) [-644.067] (-639.475) * [-639.909] (-640.908) (-648.862) (-640.495) -- 0:00:41
303000 -- (-642.311) (-639.622) (-649.046) [-640.627] * (-639.083) [-641.266] (-649.069) (-644.867) -- 0:00:41
303500 -- [-642.156] (-638.853) (-643.808) (-640.501) * [-641.568] (-642.061) (-641.666) (-641.054) -- 0:00:41
304000 -- (-644.554) (-640.603) (-640.424) [-640.280] * [-640.069] (-641.999) (-641.946) (-642.405) -- 0:00:41
304500 -- (-642.008) (-640.075) [-640.858] (-642.668) * (-641.397) (-641.146) (-640.695) [-641.588] -- 0:00:41
305000 -- (-641.999) (-641.003) (-640.982) [-642.013] * (-639.907) (-641.683) [-640.107] (-640.527) -- 0:00:41
Average standard deviation of split frequencies: 0.017108
305500 -- (-639.106) [-640.042] (-641.463) (-639.185) * (-645.410) (-642.070) [-640.893] (-642.731) -- 0:00:40
306000 -- [-639.692] (-639.331) (-643.873) (-640.042) * (-641.304) (-642.902) (-640.810) [-641.622] -- 0:00:43
306500 -- (-641.628) [-639.053] (-648.074) (-641.789) * (-641.114) [-640.866] (-640.087) (-640.724) -- 0:00:42
307000 -- (-641.170) [-640.541] (-641.598) (-643.853) * [-641.114] (-641.041) (-639.848) (-639.783) -- 0:00:42
307500 -- [-641.540] (-646.352) (-642.239) (-640.721) * (-639.190) [-640.614] (-641.113) (-641.872) -- 0:00:42
308000 -- (-639.353) (-646.855) (-641.416) [-640.682] * (-643.099) (-642.509) (-644.379) [-642.366] -- 0:00:42
308500 -- (-639.279) (-643.758) [-640.360] (-643.367) * (-643.239) (-641.164) (-641.947) [-643.781] -- 0:00:42
309000 -- (-638.978) (-639.601) [-639.623] (-642.145) * [-639.391] (-641.434) (-639.158) (-641.515) -- 0:00:42
309500 -- (-640.405) (-641.701) [-643.382] (-639.878) * (-639.410) (-641.169) [-640.365] (-640.211) -- 0:00:42
310000 -- (-642.879) (-641.922) (-640.347) [-640.075] * (-643.217) (-642.580) (-641.375) [-639.134] -- 0:00:42
Average standard deviation of split frequencies: 0.017250
310500 -- (-645.762) [-643.183] (-640.612) (-641.743) * (-640.530) (-639.901) (-643.373) [-643.958] -- 0:00:42
311000 -- (-640.927) (-639.943) (-640.396) [-640.783] * (-639.856) (-639.267) [-640.258] (-640.628) -- 0:00:42
311500 -- (-642.614) (-639.334) [-641.908] (-642.725) * [-641.033] (-640.011) (-640.644) (-640.860) -- 0:00:41
312000 -- (-642.966) [-641.899] (-640.875) (-639.012) * (-641.143) [-640.231] (-644.772) (-641.616) -- 0:00:41
312500 -- (-638.940) [-640.613] (-643.584) (-639.911) * (-640.059) [-639.926] (-640.910) (-641.905) -- 0:00:41
313000 -- [-641.870] (-646.269) (-640.861) (-641.320) * [-640.170] (-639.456) (-645.834) (-640.041) -- 0:00:41
313500 -- (-640.000) (-641.022) (-642.060) [-640.797] * (-641.157) (-640.057) (-639.691) [-640.067] -- 0:00:41
314000 -- (-640.008) (-641.117) (-641.224) [-640.509] * (-638.940) (-639.528) (-639.882) [-639.645] -- 0:00:41
314500 -- (-639.795) (-643.056) [-644.035] (-640.312) * (-642.246) (-639.959) [-639.615] (-643.924) -- 0:00:41
315000 -- [-640.301] (-639.490) (-641.063) (-643.437) * (-642.562) (-643.127) [-643.701] (-639.347) -- 0:00:41
Average standard deviation of split frequencies: 0.017273
315500 -- (-640.849) (-641.016) (-644.506) [-639.851] * (-644.385) [-642.842] (-640.176) (-642.489) -- 0:00:41
316000 -- [-641.125] (-641.254) (-645.540) (-639.683) * (-642.094) (-644.677) [-640.253] (-642.193) -- 0:00:41
316500 -- (-642.850) [-641.475] (-645.200) (-639.860) * (-640.224) [-643.191] (-641.645) (-641.707) -- 0:00:41
317000 -- [-640.810] (-639.382) (-643.071) (-643.722) * [-643.126] (-641.483) (-639.570) (-644.444) -- 0:00:40
317500 -- (-639.162) [-639.884] (-641.623) (-641.887) * [-642.285] (-640.012) (-641.347) (-644.076) -- 0:00:40
318000 -- (-640.619) [-639.353] (-642.077) (-643.961) * [-641.179] (-640.941) (-641.050) (-643.575) -- 0:00:40
318500 -- [-640.738] (-641.417) (-642.273) (-643.864) * (-640.885) [-640.915] (-640.054) (-640.649) -- 0:00:40
319000 -- (-639.155) (-641.155) (-643.325) [-647.060] * [-639.822] (-645.670) (-639.511) (-639.819) -- 0:00:40
319500 -- (-639.952) [-640.683] (-641.152) (-643.658) * (-642.544) (-641.084) [-645.305] (-641.190) -- 0:00:40
320000 -- (-641.087) (-641.918) [-640.200] (-642.080) * (-642.744) (-639.453) (-644.437) [-639.396] -- 0:00:40
Average standard deviation of split frequencies: 0.018028
320500 -- [-639.908] (-641.922) (-642.524) (-640.685) * (-639.717) [-641.041] (-641.073) (-639.110) -- 0:00:40
321000 -- (-641.093) [-639.603] (-643.459) (-641.546) * (-639.477) [-640.373] (-641.166) (-638.994) -- 0:00:40
321500 -- [-640.893] (-640.581) (-639.483) (-642.455) * (-641.731) (-646.745) (-641.450) [-640.225] -- 0:00:40
322000 -- (-642.297) (-644.298) (-643.735) [-641.045] * (-641.599) (-644.551) [-644.291] (-640.123) -- 0:00:40
322500 -- [-640.638] (-640.068) (-640.832) (-639.864) * (-640.459) (-645.320) (-643.474) [-640.362] -- 0:00:39
323000 -- (-641.753) (-639.107) (-639.895) [-641.515] * (-640.839) (-641.108) [-640.047] (-641.290) -- 0:00:41
323500 -- (-640.196) (-639.606) [-642.494] (-646.686) * [-640.902] (-640.839) (-640.168) (-642.003) -- 0:00:41
324000 -- (-640.859) [-639.406] (-641.159) (-648.237) * (-642.067) (-641.825) [-644.244] (-642.648) -- 0:00:41
324500 -- (-642.069) [-639.441] (-641.186) (-642.176) * (-639.676) (-639.889) (-649.744) [-643.023] -- 0:00:41
325000 -- [-640.141] (-641.675) (-644.334) (-639.805) * (-641.211) (-643.808) [-642.987] (-641.895) -- 0:00:41
Average standard deviation of split frequencies: 0.017208
325500 -- (-640.531) (-640.928) [-641.415] (-639.162) * (-641.810) (-642.921) [-641.091] (-641.940) -- 0:00:41
326000 -- (-639.465) (-642.489) [-641.764] (-640.392) * (-642.174) (-639.372) (-639.152) [-643.539] -- 0:00:41
326500 -- (-641.295) (-641.011) (-640.953) [-641.846] * (-644.277) (-641.520) (-640.698) [-640.142] -- 0:00:41
327000 -- (-643.180) (-646.258) (-641.905) [-644.482] * [-640.418] (-639.158) (-639.166) (-641.776) -- 0:00:41
327500 -- (-639.019) (-640.029) (-642.914) [-641.076] * (-641.376) [-639.005] (-639.673) (-642.023) -- 0:00:41
328000 -- (-639.196) (-645.266) [-641.477] (-643.220) * (-640.432) (-640.465) (-640.813) [-639.606] -- 0:00:40
328500 -- [-638.982] (-639.775) (-641.254) (-645.049) * (-639.706) (-639.234) [-640.075] (-639.281) -- 0:00:40
329000 -- [-639.052] (-647.349) (-642.621) (-642.440) * (-642.276) [-641.229] (-643.303) (-642.390) -- 0:00:40
329500 -- [-638.859] (-642.081) (-640.370) (-645.891) * (-639.983) [-640.441] (-642.141) (-640.357) -- 0:00:40
330000 -- [-639.021] (-641.282) (-640.319) (-644.987) * (-642.608) (-639.185) (-642.615) [-641.369] -- 0:00:40
Average standard deviation of split frequencies: 0.017257
330500 -- [-641.470] (-640.538) (-641.483) (-651.368) * [-641.353] (-643.426) (-643.229) (-643.208) -- 0:00:40
331000 -- (-642.217) [-641.156] (-643.084) (-651.286) * (-640.226) (-643.078) (-641.375) [-641.123] -- 0:00:40
331500 -- (-642.652) (-643.867) [-639.883] (-642.448) * (-641.602) [-640.334] (-645.098) (-642.683) -- 0:00:40
332000 -- [-641.866] (-641.984) (-640.923) (-641.455) * (-641.657) (-639.826) (-642.789) [-641.136] -- 0:00:40
332500 -- [-642.391] (-640.216) (-643.487) (-639.301) * (-640.766) [-640.030] (-640.597) (-641.163) -- 0:00:40
333000 -- (-640.534) [-641.725] (-641.062) (-639.719) * [-640.621] (-641.952) (-647.719) (-642.880) -- 0:00:40
333500 -- [-639.764] (-640.932) (-640.074) (-642.495) * (-641.305) (-643.706) [-641.373] (-639.828) -- 0:00:39
334000 -- [-639.292] (-642.927) (-642.325) (-641.216) * (-640.766) [-639.441] (-640.786) (-642.140) -- 0:00:39
334500 -- (-639.628) (-644.276) [-639.656] (-641.455) * [-640.496] (-644.763) (-641.721) (-644.075) -- 0:00:39
335000 -- [-640.307] (-643.461) (-639.312) (-645.923) * (-641.874) (-642.293) (-645.759) [-642.982] -- 0:00:39
Average standard deviation of split frequencies: 0.017722
335500 -- (-643.884) (-643.346) (-642.275) [-639.671] * [-639.441] (-642.497) (-643.918) (-640.865) -- 0:00:39
336000 -- (-641.024) (-648.655) [-643.269] (-641.912) * (-641.400) (-644.440) [-641.935] (-640.872) -- 0:00:39
336500 -- (-641.723) [-644.737] (-641.439) (-640.003) * (-643.863) (-642.837) [-643.944] (-639.534) -- 0:00:39
337000 -- [-643.209] (-640.330) (-642.003) (-638.800) * (-646.823) (-648.461) (-640.861) [-639.828] -- 0:00:39
337500 -- (-641.094) [-639.741] (-641.075) (-643.125) * (-642.432) (-639.136) (-643.185) [-641.354] -- 0:00:39
338000 -- (-644.193) [-644.587] (-640.698) (-640.323) * (-640.898) [-640.805] (-643.318) (-643.146) -- 0:00:39
338500 -- (-643.542) [-644.204] (-642.340) (-642.600) * (-638.906) (-643.919) [-641.681] (-643.770) -- 0:00:39
339000 -- (-643.251) [-643.602] (-643.174) (-642.230) * (-641.891) [-641.316] (-640.217) (-643.935) -- 0:00:38
339500 -- (-641.296) (-641.921) (-640.527) [-644.763] * (-642.643) (-639.968) [-640.295] (-645.741) -- 0:00:40
340000 -- (-640.662) [-640.743] (-640.695) (-640.931) * (-639.311) (-639.514) [-640.010] (-640.123) -- 0:00:40
Average standard deviation of split frequencies: 0.018450
340500 -- [-639.604] (-644.127) (-642.629) (-639.690) * [-643.480] (-642.672) (-641.620) (-643.334) -- 0:00:40
341000 -- (-639.886) [-639.455] (-641.210) (-640.255) * (-642.114) (-643.883) (-641.127) [-640.591] -- 0:00:40
341500 -- (-641.061) (-640.780) [-644.079] (-640.671) * (-643.348) [-641.627] (-642.413) (-640.624) -- 0:00:40
342000 -- (-642.653) [-639.491] (-643.796) (-644.857) * (-640.310) (-640.527) (-640.433) [-640.586] -- 0:00:40
342500 -- (-641.992) [-643.449] (-644.588) (-644.345) * (-640.687) [-640.080] (-640.173) (-640.653) -- 0:00:40
343000 -- (-641.852) (-643.207) (-642.049) [-639.465] * (-639.525) (-640.148) [-640.336] (-639.013) -- 0:00:40
343500 -- [-643.170] (-642.545) (-645.854) (-640.039) * (-644.204) (-640.932) (-641.979) [-638.947] -- 0:00:40
344000 -- (-642.892) (-641.838) (-642.317) [-640.603] * (-649.366) (-639.785) (-640.681) [-641.011] -- 0:00:40
344500 -- (-640.303) (-645.640) [-640.411] (-640.033) * (-640.905) (-639.695) (-641.241) [-640.537] -- 0:00:39
345000 -- (-641.736) (-643.051) [-639.846] (-640.867) * (-639.615) (-642.256) [-640.732] (-640.535) -- 0:00:39
Average standard deviation of split frequencies: 0.017568
345500 -- (-642.677) (-644.536) (-641.699) [-641.725] * (-644.677) (-648.094) [-647.314] (-642.665) -- 0:00:39
346000 -- (-640.970) (-649.995) [-639.357] (-641.731) * [-642.055] (-649.833) (-642.134) (-644.877) -- 0:00:39
346500 -- (-639.635) (-639.976) [-639.572] (-642.356) * (-647.472) [-648.389] (-642.503) (-642.090) -- 0:00:39
347000 -- (-642.123) [-641.971] (-640.162) (-641.751) * (-640.223) (-643.455) [-639.509] (-642.756) -- 0:00:39
347500 -- (-643.353) (-643.207) (-642.261) [-641.712] * (-641.437) [-640.496] (-640.636) (-643.170) -- 0:00:39
348000 -- (-647.057) (-640.383) [-642.395] (-642.205) * (-640.602) (-639.652) (-640.992) [-639.278] -- 0:00:39
348500 -- (-642.360) [-639.124] (-642.749) (-641.369) * (-641.907) (-642.206) (-640.048) [-639.899] -- 0:00:39
349000 -- (-644.518) (-641.442) (-642.925) [-639.726] * (-639.324) (-639.702) [-639.223] (-639.917) -- 0:00:39
349500 -- [-641.159] (-640.595) (-643.660) (-640.162) * (-641.535) (-639.798) (-642.138) [-641.131] -- 0:00:39
350000 -- (-640.407) (-640.954) [-641.802] (-643.134) * (-642.980) [-642.386] (-642.269) (-641.004) -- 0:00:39
Average standard deviation of split frequencies: 0.018298
350500 -- [-640.760] (-641.483) (-639.967) (-642.961) * (-644.673) [-639.401] (-643.989) (-641.302) -- 0:00:38
351000 -- [-639.989] (-644.456) (-638.835) (-640.785) * (-641.878) [-643.984] (-642.013) (-644.499) -- 0:00:38
351500 -- (-639.741) (-642.359) [-640.424] (-641.392) * (-641.471) (-642.187) [-643.326] (-643.582) -- 0:00:38
352000 -- (-641.708) (-641.002) (-639.247) [-639.395] * (-645.039) (-645.724) [-641.046] (-642.684) -- 0:00:38
352500 -- [-640.735] (-640.907) (-643.762) (-639.824) * (-641.821) [-639.396] (-640.835) (-640.080) -- 0:00:38
353000 -- (-640.363) [-640.558] (-641.727) (-641.880) * [-639.884] (-639.719) (-639.224) (-640.519) -- 0:00:38
353500 -- (-642.854) (-640.804) [-640.992] (-642.200) * (-639.202) (-642.622) (-640.452) [-644.073] -- 0:00:38
354000 -- (-640.585) (-643.632) [-639.144] (-644.714) * (-640.087) (-641.706) [-642.592] (-641.137) -- 0:00:38
354500 -- (-641.792) [-644.602] (-642.490) (-640.252) * (-643.181) (-645.874) (-641.942) [-640.068] -- 0:00:38
355000 -- [-641.290] (-641.991) (-641.254) (-641.588) * (-641.023) (-642.561) [-640.367] (-642.028) -- 0:00:38
Average standard deviation of split frequencies: 0.017759
355500 -- [-639.907] (-641.818) (-640.874) (-640.203) * [-640.471] (-642.321) (-641.400) (-639.393) -- 0:00:39
356000 -- (-640.141) (-643.065) [-640.101] (-641.012) * (-646.476) [-642.487] (-644.732) (-639.447) -- 0:00:39
356500 -- (-641.045) (-641.850) [-640.178] (-643.119) * (-641.108) [-641.370] (-642.128) (-639.115) -- 0:00:39
357000 -- (-640.919) (-641.438) (-644.392) [-641.141] * (-642.049) [-640.341] (-641.954) (-643.019) -- 0:00:39
357500 -- (-641.038) (-639.493) (-640.519) [-639.708] * (-646.944) [-642.815] (-639.466) (-639.728) -- 0:00:39
358000 -- (-643.540) (-643.868) [-639.921] (-643.049) * [-644.287] (-639.786) (-641.070) (-640.797) -- 0:00:39
358500 -- (-641.612) (-641.996) [-643.880] (-644.148) * [-640.606] (-642.945) (-641.359) (-641.172) -- 0:00:39
359000 -- (-639.284) [-640.626] (-640.118) (-640.137) * (-640.383) (-649.661) (-640.848) [-640.238] -- 0:00:39
359500 -- (-640.262) (-642.345) [-640.868] (-640.706) * (-641.670) (-644.908) (-640.409) [-639.899] -- 0:00:39
360000 -- [-641.557] (-645.633) (-642.671) (-639.251) * (-641.778) (-641.475) [-639.550] (-640.540) -- 0:00:39
Average standard deviation of split frequencies: 0.018662
360500 -- (-641.019) (-640.088) (-642.870) [-641.135] * [-642.310] (-642.613) (-641.753) (-644.743) -- 0:00:39
361000 -- [-641.992] (-639.465) (-641.700) (-641.189) * (-640.889) (-646.104) (-642.238) [-640.710] -- 0:00:38
361500 -- (-642.587) (-642.472) (-641.644) [-640.260] * (-641.687) (-642.568) [-641.054] (-643.160) -- 0:00:38
362000 -- (-641.723) [-639.355] (-640.618) (-643.973) * (-641.930) (-640.979) [-641.762] (-639.190) -- 0:00:38
362500 -- (-642.473) [-642.015] (-641.224) (-642.376) * [-639.836] (-642.620) (-642.360) (-642.096) -- 0:00:38
363000 -- (-639.581) [-642.778] (-640.893) (-640.914) * (-640.732) [-641.578] (-641.115) (-641.588) -- 0:00:38
363500 -- [-640.300] (-639.384) (-640.038) (-639.569) * [-639.760] (-641.863) (-639.739) (-641.053) -- 0:00:38
364000 -- (-639.968) (-641.163) (-640.387) [-640.015] * (-641.770) [-640.338] (-641.206) (-643.907) -- 0:00:38
364500 -- (-639.627) [-641.337] (-641.603) (-642.687) * (-644.052) [-641.170] (-644.880) (-642.582) -- 0:00:38
365000 -- (-641.190) (-641.976) (-640.964) [-641.320] * [-640.300] (-640.660) (-642.717) (-640.352) -- 0:00:38
Average standard deviation of split frequencies: 0.017531
365500 -- (-641.167) [-640.870] (-640.073) (-639.464) * (-645.750) (-641.618) (-640.092) [-642.199] -- 0:00:38
366000 -- (-642.902) (-640.868) [-640.693] (-641.848) * (-640.536) [-640.951] (-641.247) (-641.382) -- 0:00:38
366500 -- (-641.550) (-645.190) (-643.214) [-641.384] * (-639.644) (-646.127) (-639.018) [-640.282] -- 0:00:38
367000 -- (-641.507) [-644.267] (-644.111) (-641.096) * (-640.795) [-640.341] (-642.115) (-643.489) -- 0:00:37
367500 -- (-642.948) [-647.373] (-643.655) (-641.780) * (-640.955) [-641.767] (-642.362) (-644.607) -- 0:00:37
368000 -- (-644.122) (-643.921) [-643.863] (-640.408) * (-644.072) (-641.773) (-638.939) [-642.295] -- 0:00:37
368500 -- [-643.417] (-640.551) (-640.278) (-644.498) * [-639.362] (-641.377) (-647.580) (-640.235) -- 0:00:37
369000 -- (-640.074) (-639.258) (-639.439) [-640.009] * (-643.475) (-641.948) [-641.473] (-640.221) -- 0:00:37
369500 -- [-640.087] (-640.076) (-640.109) (-641.027) * [-642.616] (-642.255) (-641.116) (-640.462) -- 0:00:37
370000 -- (-645.855) (-639.083) [-641.246] (-642.066) * (-640.090) (-643.552) [-644.183] (-639.973) -- 0:00:37
Average standard deviation of split frequencies: 0.017664
370500 -- (-643.643) (-639.082) [-640.645] (-639.800) * (-640.356) (-641.250) [-639.248] (-641.140) -- 0:00:37
371000 -- [-642.810] (-645.011) (-642.723) (-641.891) * (-641.744) [-640.307] (-642.282) (-639.524) -- 0:00:37
371500 -- (-639.481) (-642.010) [-639.801] (-642.973) * (-645.673) (-640.536) (-641.354) [-639.832] -- 0:00:37
372000 -- [-639.758] (-639.327) (-639.848) (-638.908) * [-642.678] (-641.178) (-639.114) (-640.715) -- 0:00:37
372500 -- [-640.024] (-640.195) (-640.055) (-641.876) * (-644.473) (-640.362) [-639.513] (-642.794) -- 0:00:38
373000 -- [-639.038] (-639.767) (-640.685) (-641.584) * [-646.636] (-641.599) (-641.126) (-643.120) -- 0:00:38
373500 -- [-640.612] (-642.432) (-639.851) (-639.631) * [-640.691] (-640.050) (-642.992) (-641.448) -- 0:00:38
374000 -- (-639.844) [-641.815] (-640.092) (-644.406) * [-639.629] (-641.149) (-640.302) (-643.135) -- 0:00:38
374500 -- (-639.636) (-641.870) [-640.391] (-642.202) * (-642.262) (-640.035) [-639.225] (-639.520) -- 0:00:38
375000 -- (-643.093) (-641.164) [-639.224] (-641.810) * [-643.857] (-641.731) (-641.897) (-639.964) -- 0:00:38
Average standard deviation of split frequencies: 0.017901
375500 -- (-640.692) (-641.522) [-641.548] (-639.958) * (-642.611) (-639.902) (-641.316) [-641.515] -- 0:00:38
376000 -- (-642.680) (-639.940) [-642.007] (-641.060) * (-640.634) [-640.574] (-642.588) (-639.281) -- 0:00:38
376500 -- (-644.135) [-639.129] (-639.530) (-640.690) * (-639.745) (-642.259) (-639.828) [-639.283] -- 0:00:38
377000 -- (-642.506) (-639.539) [-640.185] (-640.397) * (-639.677) [-641.187] (-639.871) (-640.571) -- 0:00:38
377500 -- (-641.334) [-642.960] (-640.839) (-641.901) * [-642.179] (-639.229) (-639.112) (-641.084) -- 0:00:37
378000 -- [-645.245] (-642.885) (-641.501) (-641.916) * (-641.027) [-639.096] (-641.071) (-640.645) -- 0:00:37
378500 -- (-646.149) [-641.220] (-648.018) (-641.197) * (-639.705) [-640.053] (-639.841) (-643.004) -- 0:00:37
379000 -- [-641.479] (-643.580) (-640.532) (-640.244) * [-640.258] (-640.614) (-641.974) (-640.868) -- 0:00:37
379500 -- (-641.127) (-641.876) [-638.923] (-639.705) * [-645.227] (-644.289) (-641.571) (-639.262) -- 0:00:37
380000 -- (-642.351) [-644.198] (-640.345) (-639.374) * [-645.757] (-642.370) (-645.758) (-639.195) -- 0:00:37
Average standard deviation of split frequencies: 0.017264
380500 -- [-640.216] (-644.772) (-639.776) (-639.318) * [-640.172] (-644.100) (-640.016) (-639.893) -- 0:00:37
381000 -- (-642.570) [-644.198] (-642.127) (-642.730) * (-643.697) (-641.114) (-640.360) [-640.482] -- 0:00:37
381500 -- [-641.699] (-640.292) (-641.867) (-639.952) * (-640.408) (-641.943) (-644.717) [-646.948] -- 0:00:37
382000 -- (-641.090) (-640.553) [-639.357] (-639.908) * (-640.890) (-641.529) (-643.463) [-642.353] -- 0:00:37
382500 -- (-644.188) (-642.869) [-642.187] (-639.845) * [-641.015] (-640.179) (-642.921) (-641.424) -- 0:00:37
383000 -- (-643.630) [-639.990] (-642.010) (-642.293) * [-639.038] (-639.740) (-643.406) (-646.473) -- 0:00:37
383500 -- (-640.320) (-641.109) [-639.335] (-645.645) * [-644.301] (-639.097) (-641.787) (-642.168) -- 0:00:36
384000 -- (-639.886) (-642.574) (-639.948) [-641.409] * (-638.911) [-639.783] (-639.626) (-641.418) -- 0:00:36
384500 -- (-641.139) (-641.709) (-641.488) [-640.561] * [-641.529] (-639.773) (-641.231) (-639.846) -- 0:00:36
385000 -- (-641.926) (-639.151) [-640.168] (-640.791) * (-642.323) (-641.801) (-641.838) [-640.855] -- 0:00:36
Average standard deviation of split frequencies: 0.017529
385500 -- (-641.179) (-640.217) [-643.128] (-641.421) * (-641.548) (-640.914) (-642.824) [-639.763] -- 0:00:38
386000 -- (-641.005) [-640.359] (-641.140) (-638.882) * [-640.033] (-641.193) (-639.666) (-639.626) -- 0:00:38
386500 -- (-643.027) (-642.994) [-640.846] (-641.537) * (-640.296) (-639.191) [-641.246] (-640.590) -- 0:00:38
387000 -- (-642.505) [-640.101] (-643.090) (-639.658) * (-640.154) (-639.127) (-641.842) [-640.602] -- 0:00:38
387500 -- (-643.381) [-643.019] (-642.111) (-641.823) * (-641.751) [-640.572] (-641.575) (-640.716) -- 0:00:37
388000 -- [-639.409] (-640.834) (-644.261) (-640.201) * (-641.761) [-640.613] (-640.241) (-640.293) -- 0:00:37
388500 -- (-639.079) (-641.592) [-641.714] (-641.980) * (-641.116) (-646.608) [-640.273] (-639.979) -- 0:00:37
389000 -- (-641.585) (-641.044) (-639.923) [-642.391] * (-639.881) (-645.497) [-639.823] (-640.977) -- 0:00:37
389500 -- [-639.275] (-640.537) (-641.581) (-641.944) * (-640.131) [-644.985] (-641.476) (-641.659) -- 0:00:37
390000 -- [-639.339] (-640.868) (-642.170) (-639.848) * [-639.030] (-641.804) (-642.253) (-639.115) -- 0:00:37
Average standard deviation of split frequencies: 0.017319
390500 -- [-641.145] (-641.384) (-645.179) (-641.374) * (-643.103) (-640.639) (-643.401) [-640.505] -- 0:00:37
391000 -- (-640.871) (-639.624) (-639.582) [-642.152] * (-639.878) (-639.147) [-643.240] (-639.297) -- 0:00:37
391500 -- [-642.295] (-639.742) (-642.929) (-650.630) * [-638.983] (-640.865) (-644.239) (-641.289) -- 0:00:37
392000 -- (-642.306) (-642.906) (-640.640) [-640.818] * (-643.656) [-640.046] (-645.897) (-641.381) -- 0:00:37
392500 -- (-639.243) [-640.121] (-640.750) (-639.190) * (-640.745) [-640.634] (-647.967) (-640.862) -- 0:00:37
393000 -- [-640.633] (-639.732) (-643.595) (-644.275) * (-643.252) (-641.579) (-645.187) [-639.243] -- 0:00:37
393500 -- (-642.429) (-641.216) (-642.976) [-641.834] * (-640.060) [-640.882] (-640.639) (-641.603) -- 0:00:36
394000 -- (-641.713) (-639.331) (-643.188) [-639.891] * (-641.526) [-640.144] (-641.825) (-647.980) -- 0:00:36
394500 -- [-642.576] (-639.544) (-639.454) (-640.883) * (-642.000) (-640.664) [-641.966] (-641.054) -- 0:00:36
395000 -- (-639.394) (-640.674) [-641.486] (-639.721) * (-638.921) (-646.020) [-639.522] (-641.257) -- 0:00:36
Average standard deviation of split frequencies: 0.017786
395500 -- (-641.442) (-643.007) [-639.961] (-642.779) * (-644.270) (-640.951) [-640.451] (-639.618) -- 0:00:36
396000 -- [-643.811] (-642.550) (-642.621) (-642.577) * (-641.856) (-643.737) (-640.347) [-642.199] -- 0:00:36
396500 -- (-639.916) (-644.047) (-640.090) [-644.123] * [-640.515] (-642.289) (-639.848) (-643.147) -- 0:00:36
397000 -- (-643.300) [-639.496] (-641.314) (-642.584) * (-639.157) (-639.639) [-639.642] (-641.364) -- 0:00:36
397500 -- (-639.619) [-639.737] (-639.660) (-641.983) * (-641.590) (-641.099) (-640.434) [-641.115] -- 0:00:36
398000 -- [-642.555] (-642.318) (-641.523) (-640.283) * [-645.895] (-641.960) (-639.530) (-641.069) -- 0:00:36
398500 -- (-640.455) [-639.436] (-643.375) (-645.675) * (-641.372) (-643.754) [-642.189] (-642.802) -- 0:00:36
399000 -- [-641.728] (-641.908) (-639.263) (-643.679) * [-639.632] (-643.448) (-641.644) (-640.636) -- 0:00:36
399500 -- [-639.799] (-643.716) (-641.581) (-646.747) * (-641.266) (-641.548) (-640.159) [-639.694] -- 0:00:36
400000 -- (-641.870) [-640.268] (-642.266) (-644.706) * (-639.367) (-642.322) (-647.897) [-639.140] -- 0:00:36
Average standard deviation of split frequencies: 0.017583
400500 -- [-641.507] (-642.864) (-639.857) (-649.564) * (-644.830) [-639.938] (-649.249) (-641.949) -- 0:00:35
401000 -- (-641.302) (-640.941) (-644.262) [-643.016] * [-642.029] (-639.455) (-646.437) (-641.131) -- 0:00:35
401500 -- (-640.549) [-639.367] (-643.419) (-643.190) * [-642.413] (-642.091) (-641.064) (-639.776) -- 0:00:35
402000 -- (-640.847) [-640.277] (-642.404) (-649.851) * (-640.149) [-643.401] (-644.982) (-640.775) -- 0:00:37
402500 -- (-639.460) (-642.975) (-640.254) [-641.259] * (-639.404) (-642.056) (-642.972) [-639.112] -- 0:00:37
403000 -- (-639.611) [-640.533] (-643.731) (-641.796) * (-639.443) (-641.152) (-642.102) [-639.727] -- 0:00:37
403500 -- (-640.352) (-639.328) [-644.461] (-642.834) * [-640.739] (-641.437) (-643.189) (-644.470) -- 0:00:36
404000 -- (-640.733) (-641.978) [-643.077] (-642.062) * [-640.797] (-643.036) (-645.326) (-640.944) -- 0:00:36
404500 -- [-640.369] (-645.079) (-642.906) (-640.424) * [-644.753] (-641.235) (-639.854) (-644.332) -- 0:00:36
405000 -- (-640.813) (-642.346) [-641.143] (-641.515) * (-645.167) [-640.067] (-643.900) (-642.118) -- 0:00:36
Average standard deviation of split frequencies: 0.017997
405500 -- (-644.581) (-641.795) (-642.675) [-640.973] * (-647.397) [-647.211] (-640.878) (-640.170) -- 0:00:36
406000 -- (-641.501) [-642.047] (-640.691) (-640.431) * (-645.741) [-644.067] (-640.003) (-642.192) -- 0:00:36
406500 -- (-643.114) [-641.010] (-639.819) (-639.593) * [-639.549] (-644.434) (-640.002) (-647.098) -- 0:00:36
407000 -- [-642.771] (-644.509) (-646.010) (-640.895) * (-640.259) (-641.655) (-641.357) [-640.302] -- 0:00:36
407500 -- [-640.098] (-640.330) (-640.622) (-641.053) * (-641.271) [-645.819] (-639.700) (-640.084) -- 0:00:36
408000 -- [-641.915] (-645.779) (-643.899) (-646.098) * [-641.418] (-640.762) (-642.372) (-647.057) -- 0:00:36
408500 -- (-649.556) (-639.736) (-640.730) [-641.167] * (-640.304) (-640.061) (-640.619) [-642.168] -- 0:00:36
409000 -- (-639.658) (-641.167) [-639.845] (-645.076) * (-639.736) [-638.811] (-640.891) (-642.007) -- 0:00:36
409500 -- (-643.382) (-644.734) [-641.382] (-642.480) * (-641.576) (-640.267) (-641.883) [-639.630] -- 0:00:36
410000 -- (-642.226) (-641.632) (-639.792) [-642.811] * (-643.166) (-641.063) (-641.371) [-643.387] -- 0:00:35
Average standard deviation of split frequencies: 0.018430
410500 -- (-640.772) [-642.138] (-640.025) (-640.453) * [-640.823] (-643.248) (-640.318) (-640.110) -- 0:00:35
411000 -- [-643.085] (-641.879) (-641.901) (-640.729) * (-640.193) [-641.472] (-640.376) (-643.427) -- 0:00:35
411500 -- (-641.120) (-645.337) [-640.334] (-642.847) * (-641.475) (-639.091) [-641.348] (-643.309) -- 0:00:35
412000 -- (-644.846) (-644.838) [-639.555] (-643.602) * (-642.467) [-641.133] (-642.532) (-643.204) -- 0:00:35
412500 -- (-641.520) [-641.528] (-639.290) (-645.757) * (-640.022) (-642.123) (-640.218) [-641.188] -- 0:00:35
413000 -- (-641.592) (-640.751) (-640.201) [-643.016] * (-640.501) [-640.093] (-640.943) (-639.586) -- 0:00:35
413500 -- (-640.739) (-640.275) [-640.498] (-640.266) * (-640.254) (-643.212) (-644.911) [-641.015] -- 0:00:35
414000 -- (-640.702) (-639.825) (-640.492) [-640.784] * [-642.128] (-644.731) (-643.570) (-641.504) -- 0:00:35
414500 -- [-641.737] (-642.529) (-640.355) (-642.410) * [-639.682] (-639.589) (-645.576) (-641.401) -- 0:00:35
415000 -- [-648.801] (-641.435) (-641.878) (-640.603) * [-640.953] (-644.260) (-640.759) (-644.100) -- 0:00:35
Average standard deviation of split frequencies: 0.017664
415500 -- (-643.518) (-641.102) (-643.183) [-639.970] * (-641.901) [-639.761] (-643.237) (-642.167) -- 0:00:35
416000 -- (-642.749) (-641.952) (-641.183) [-642.834] * (-640.840) (-642.636) [-640.629] (-641.480) -- 0:00:35
416500 -- (-642.366) (-645.852) [-642.107] (-640.462) * (-642.530) [-642.419] (-642.328) (-641.187) -- 0:00:35
417000 -- (-640.010) (-640.434) [-639.810] (-640.893) * (-642.505) [-641.001] (-643.529) (-640.780) -- 0:00:34
417500 -- [-639.630] (-639.591) (-642.431) (-644.009) * (-642.135) (-640.681) [-639.097] (-642.493) -- 0:00:36
418000 -- (-641.384) (-641.396) (-642.506) [-641.458] * (-643.633) (-640.034) (-639.172) [-639.210] -- 0:00:36
418500 -- [-641.170] (-639.992) (-641.622) (-641.830) * (-639.602) (-643.198) (-639.367) [-639.394] -- 0:00:36
419000 -- (-643.492) (-644.760) (-644.555) [-641.134] * (-640.591) (-644.178) (-643.585) [-639.988] -- 0:00:36
419500 -- [-639.797] (-642.638) (-642.019) (-643.526) * [-639.654] (-640.403) (-642.413) (-642.456) -- 0:00:35
420000 -- [-642.762] (-641.024) (-641.234) (-644.205) * (-639.566) [-643.283] (-647.540) (-644.668) -- 0:00:35
Average standard deviation of split frequencies: 0.018523
420500 -- [-641.265] (-641.717) (-640.494) (-644.618) * (-640.810) (-643.463) (-639.059) [-642.955] -- 0:00:35
421000 -- (-641.309) (-640.495) [-640.141] (-639.471) * (-641.450) (-644.776) [-640.364] (-646.817) -- 0:00:35
421500 -- [-640.506] (-645.770) (-640.721) (-640.934) * [-640.152] (-639.747) (-641.002) (-641.960) -- 0:00:35
422000 -- (-641.068) (-640.316) [-640.714] (-639.277) * (-641.562) [-639.395] (-641.194) (-642.106) -- 0:00:35
422500 -- (-641.128) [-640.793] (-640.968) (-639.667) * [-639.186] (-640.077) (-640.316) (-639.819) -- 0:00:35
423000 -- (-647.055) (-645.339) [-640.155] (-647.769) * (-639.273) (-640.356) [-639.265] (-642.062) -- 0:00:35
423500 -- (-642.056) (-641.405) [-644.891] (-641.647) * (-642.284) (-641.237) [-641.187] (-640.879) -- 0:00:35
424000 -- [-639.598] (-642.342) (-640.871) (-639.661) * (-647.925) [-644.350] (-643.665) (-641.334) -- 0:00:35
424500 -- [-639.497] (-640.682) (-639.757) (-641.933) * [-639.637] (-643.274) (-641.487) (-641.564) -- 0:00:35
425000 -- (-645.857) (-641.639) [-639.745] (-641.741) * (-640.110) (-640.795) (-642.984) [-641.854] -- 0:00:35
Average standard deviation of split frequencies: 0.019202
425500 -- (-639.310) (-640.764) (-639.900) [-640.274] * (-640.205) (-642.980) [-641.250] (-641.036) -- 0:00:35
426000 -- (-639.603) (-640.729) [-640.046] (-640.912) * (-642.098) [-640.594] (-643.314) (-642.013) -- 0:00:35
426500 -- (-641.581) (-640.327) [-641.347] (-642.108) * [-640.273] (-639.551) (-642.132) (-648.795) -- 0:00:34
427000 -- [-640.205] (-642.140) (-643.937) (-639.723) * (-641.173) (-640.538) (-638.942) [-646.390] -- 0:00:34
427500 -- (-641.984) (-639.305) (-642.522) [-639.964] * [-641.709] (-643.048) (-644.261) (-644.648) -- 0:00:34
428000 -- [-641.061] (-641.593) (-641.445) (-640.967) * [-642.489] (-644.140) (-641.413) (-641.548) -- 0:00:34
428500 -- (-641.207) [-639.944] (-640.581) (-643.535) * (-643.030) (-641.374) (-640.610) [-640.439] -- 0:00:34
429000 -- (-642.640) (-640.555) (-641.930) [-641.283] * [-642.161] (-639.420) (-645.496) (-640.171) -- 0:00:34
429500 -- (-639.643) (-641.606) [-640.408] (-641.942) * (-643.376) (-641.089) (-641.142) [-640.132] -- 0:00:34
430000 -- (-641.238) [-643.648] (-640.282) (-642.011) * (-641.514) [-640.658] (-642.231) (-643.519) -- 0:00:34
Average standard deviation of split frequencies: 0.018866
430500 -- [-641.455] (-643.069) (-640.438) (-640.169) * (-641.399) (-644.077) [-639.181] (-640.859) -- 0:00:34
431000 -- [-641.010] (-643.969) (-639.856) (-641.626) * [-641.357] (-642.832) (-641.329) (-640.154) -- 0:00:34
431500 -- (-639.760) (-643.377) [-639.650] (-649.071) * [-642.981] (-645.739) (-642.667) (-642.652) -- 0:00:34
432000 -- (-640.553) [-640.988] (-641.060) (-645.184) * [-640.026] (-644.128) (-640.701) (-644.189) -- 0:00:34
432500 -- (-639.780) (-640.006) [-642.994] (-647.868) * (-639.966) (-641.317) [-640.305] (-642.270) -- 0:00:34
433000 -- [-640.934] (-644.905) (-646.198) (-645.964) * (-641.757) (-642.125) [-639.757] (-641.861) -- 0:00:34
433500 -- (-649.211) (-639.905) [-641.106] (-643.868) * (-641.489) (-640.145) [-638.965] (-644.079) -- 0:00:33
434000 -- [-642.942] (-642.351) (-639.394) (-643.470) * [-639.401] (-641.305) (-639.865) (-643.610) -- 0:00:35
434500 -- (-641.963) [-643.817] (-639.295) (-644.656) * (-641.457) [-638.977] (-642.221) (-642.997) -- 0:00:35
435000 -- (-640.035) (-641.503) [-644.203] (-642.894) * (-642.330) (-639.548) (-641.024) [-642.246] -- 0:00:35
Average standard deviation of split frequencies: 0.017999
435500 -- [-640.527] (-641.673) (-640.522) (-647.921) * (-642.235) [-639.576] (-639.397) (-640.263) -- 0:00:34
436000 -- (-640.892) (-641.599) [-641.187] (-643.902) * (-641.537) (-639.851) (-641.365) [-640.894] -- 0:00:34
436500 -- (-641.344) (-639.992) (-639.608) [-641.249] * [-640.295] (-639.831) (-643.595) (-640.403) -- 0:00:34
437000 -- [-639.906] (-644.926) (-639.478) (-641.397) * (-642.033) [-642.768] (-643.702) (-642.014) -- 0:00:34
437500 -- (-641.487) (-640.693) [-639.103] (-643.565) * [-639.283] (-642.640) (-640.540) (-640.375) -- 0:00:34
438000 -- [-642.785] (-641.054) (-640.530) (-640.735) * (-639.048) [-640.491] (-639.687) (-640.704) -- 0:00:34
438500 -- (-643.223) (-640.888) [-640.090] (-639.812) * [-639.143] (-639.650) (-639.662) (-642.670) -- 0:00:34
439000 -- [-641.074] (-639.634) (-640.748) (-642.597) * [-639.214] (-642.477) (-645.944) (-641.885) -- 0:00:34
439500 -- (-639.766) (-639.905) (-639.394) [-640.442] * (-651.299) [-642.781] (-641.944) (-639.501) -- 0:00:34
440000 -- [-639.612] (-640.425) (-639.424) (-643.756) * (-644.015) (-642.639) [-640.403] (-640.664) -- 0:00:34
Average standard deviation of split frequencies: 0.017305
440500 -- (-640.635) (-641.393) [-641.359] (-641.623) * (-642.279) (-642.417) [-641.122] (-640.432) -- 0:00:34
441000 -- (-640.669) [-640.649] (-646.506) (-641.182) * [-641.338] (-643.291) (-641.721) (-640.851) -- 0:00:34
441500 -- (-641.913) [-640.808] (-640.027) (-641.192) * (-641.102) [-640.946] (-640.760) (-640.162) -- 0:00:34
442000 -- [-641.130] (-639.110) (-641.381) (-640.802) * [-641.362] (-639.809) (-646.442) (-651.715) -- 0:00:34
442500 -- (-640.948) (-639.301) [-641.245] (-648.694) * (-642.211) (-646.975) (-645.809) [-643.215] -- 0:00:34
443000 -- [-640.274] (-640.591) (-641.713) (-645.638) * [-640.157] (-644.765) (-645.168) (-638.891) -- 0:00:33
443500 -- (-640.814) (-640.895) [-640.154] (-644.676) * (-642.056) [-640.710] (-645.239) (-641.628) -- 0:00:33
444000 -- (-640.977) (-642.232) [-642.344] (-641.140) * [-641.951] (-639.972) (-640.355) (-639.714) -- 0:00:33
444500 -- (-641.587) (-645.504) (-643.688) [-639.357] * (-638.884) (-640.512) [-640.709] (-642.381) -- 0:00:33
445000 -- (-642.574) (-641.072) [-643.258] (-640.196) * (-640.697) (-641.141) [-642.795] (-642.020) -- 0:00:33
Average standard deviation of split frequencies: 0.017036
445500 -- (-642.590) (-642.151) (-641.238) [-642.555] * (-642.248) (-640.034) [-639.792] (-639.726) -- 0:00:33
446000 -- (-639.870) [-644.597] (-644.597) (-645.476) * [-642.765] (-639.718) (-643.973) (-643.842) -- 0:00:33
446500 -- (-644.324) (-644.886) (-641.611) [-641.300] * [-641.808] (-640.435) (-640.595) (-642.790) -- 0:00:33
447000 -- (-642.560) (-641.668) [-639.694] (-640.730) * [-642.277] (-640.219) (-640.301) (-640.029) -- 0:00:33
447500 -- (-641.215) (-642.428) (-641.489) [-641.073] * [-642.319] (-640.288) (-639.360) (-639.173) -- 0:00:33
448000 -- (-639.053) (-640.916) [-640.868] (-641.713) * (-640.569) (-640.910) (-640.317) [-641.525] -- 0:00:33
448500 -- (-638.980) (-643.152) [-639.953] (-641.426) * (-643.254) (-641.604) [-641.111] (-641.088) -- 0:00:33
449000 -- (-641.991) [-642.563] (-643.597) (-640.956) * (-641.957) (-639.763) (-641.302) [-640.999] -- 0:00:33
449500 -- (-641.166) (-640.960) (-642.852) [-640.139] * (-639.719) (-642.389) (-639.372) [-640.990] -- 0:00:33
450000 -- (-645.056) [-639.393] (-641.651) (-639.632) * [-640.698] (-641.506) (-642.283) (-640.032) -- 0:00:33
Average standard deviation of split frequencies: 0.017167
450500 -- (-641.282) (-640.240) (-642.412) [-643.074] * (-641.870) (-639.543) [-640.189] (-640.523) -- 0:00:34
451000 -- [-641.275] (-639.511) (-643.611) (-640.368) * (-640.779) (-640.727) (-640.531) [-639.778] -- 0:00:34
451500 -- [-641.175] (-642.992) (-641.183) (-640.832) * [-639.318] (-639.926) (-641.529) (-640.280) -- 0:00:34
452000 -- (-641.012) [-641.781] (-644.714) (-640.959) * (-640.392) (-641.776) [-642.153] (-642.153) -- 0:00:33
452500 -- [-641.511] (-640.739) (-640.383) (-640.492) * (-640.461) [-643.264] (-641.972) (-641.766) -- 0:00:33
453000 -- (-641.397) (-642.364) (-640.912) [-643.686] * (-641.351) (-644.448) (-639.393) [-639.996] -- 0:00:33
453500 -- [-640.307] (-641.220) (-642.982) (-641.241) * (-641.540) (-642.104) (-639.714) [-642.595] -- 0:00:33
454000 -- (-641.447) (-644.321) (-641.770) [-639.992] * (-641.702) [-640.639] (-640.209) (-642.684) -- 0:00:33
454500 -- (-641.983) [-644.587] (-639.291) (-641.303) * (-641.564) [-641.320] (-640.757) (-641.169) -- 0:00:33
455000 -- (-641.246) (-644.663) [-645.670] (-648.431) * [-642.481] (-640.997) (-642.343) (-642.659) -- 0:00:33
Average standard deviation of split frequencies: 0.017878
455500 -- [-640.871] (-641.174) (-645.356) (-639.435) * (-643.082) (-641.083) (-645.129) [-642.526] -- 0:00:33
456000 -- (-641.679) (-646.403) (-644.012) [-640.124] * [-641.428] (-640.542) (-645.310) (-641.586) -- 0:00:33
456500 -- (-640.107) [-639.130] (-642.175) (-642.639) * (-639.553) [-640.685] (-642.388) (-642.228) -- 0:00:33
457000 -- (-642.769) (-642.314) (-640.818) [-642.760] * (-640.451) (-643.291) (-639.769) [-639.183] -- 0:00:33
457500 -- (-642.764) (-639.796) (-639.451) [-640.485] * (-643.366) (-642.931) [-640.313] (-640.650) -- 0:00:33
458000 -- (-643.896) [-639.786] (-641.662) (-640.385) * (-641.586) (-642.115) [-643.804] (-639.340) -- 0:00:33
458500 -- [-641.330] (-640.646) (-639.557) (-640.253) * (-640.815) [-641.792] (-644.596) (-641.289) -- 0:00:33
459000 -- (-640.272) [-642.440] (-639.482) (-640.047) * (-641.778) [-640.922] (-644.305) (-643.424) -- 0:00:33
459500 -- (-640.243) (-643.974) [-641.410] (-640.747) * (-639.686) [-639.775] (-644.080) (-640.909) -- 0:00:32
460000 -- (-642.048) (-641.544) [-642.436] (-641.144) * (-644.938) (-642.535) (-642.249) [-640.006] -- 0:00:32
Average standard deviation of split frequencies: 0.017216
460500 -- (-641.820) (-640.750) (-642.674) [-640.576] * (-646.447) [-640.123] (-642.207) (-639.728) -- 0:00:32
461000 -- (-641.799) [-642.560] (-649.320) (-642.732) * (-641.511) [-639.812] (-639.946) (-642.279) -- 0:00:32
461500 -- [-643.109] (-644.465) (-644.478) (-640.960) * (-642.756) [-639.684] (-641.387) (-641.179) -- 0:00:32
462000 -- (-642.784) [-639.660] (-642.673) (-644.656) * (-641.143) [-642.988] (-641.693) (-641.149) -- 0:00:32
462500 -- (-649.080) (-639.818) (-641.859) [-641.519] * (-650.933) (-641.040) [-644.752] (-640.633) -- 0:00:32
463000 -- (-647.784) [-641.348] (-641.302) (-644.864) * (-646.633) (-640.600) (-641.892) [-641.059] -- 0:00:32
463500 -- (-648.228) (-640.990) [-639.765] (-642.155) * (-643.845) (-639.860) (-640.066) [-639.696] -- 0:00:32
464000 -- (-642.917) (-641.380) (-641.682) [-643.260] * (-644.096) [-639.875] (-640.074) (-644.837) -- 0:00:32
464500 -- (-640.830) (-642.261) [-644.573] (-641.730) * (-641.951) (-640.170) (-643.175) [-640.750] -- 0:00:32
465000 -- [-645.916] (-641.498) (-642.661) (-641.175) * (-643.767) (-642.903) (-641.097) [-641.068] -- 0:00:32
Average standard deviation of split frequencies: 0.016305
465500 -- (-645.114) [-640.733] (-641.082) (-641.038) * (-641.169) (-642.761) [-640.881] (-640.804) -- 0:00:32
466000 -- [-639.388] (-640.665) (-642.259) (-639.327) * (-641.064) [-641.823] (-645.178) (-646.374) -- 0:00:32
466500 -- (-643.089) (-638.873) (-642.850) [-643.368] * (-640.960) (-641.711) (-641.544) [-641.955] -- 0:00:32
467000 -- [-640.029] (-639.253) (-641.049) (-638.935) * [-640.342] (-643.314) (-640.275) (-640.716) -- 0:00:31
467500 -- (-639.324) (-639.669) [-643.645] (-640.109) * (-642.099) (-639.745) [-641.914] (-643.761) -- 0:00:33
468000 -- (-642.419) (-640.879) [-640.347] (-641.415) * (-639.193) (-640.192) [-640.421] (-646.926) -- 0:00:32
468500 -- (-645.597) [-640.668] (-642.344) (-640.980) * (-639.950) [-640.606] (-641.911) (-640.489) -- 0:00:32
469000 -- (-640.787) (-641.819) (-645.080) [-641.722] * [-639.551] (-639.914) (-640.319) (-640.791) -- 0:00:32
469500 -- (-639.987) (-645.381) (-641.432) [-639.436] * [-642.881] (-642.938) (-643.615) (-643.839) -- 0:00:32
470000 -- (-640.125) (-640.542) (-642.494) [-639.957] * (-643.502) (-639.578) (-641.450) [-641.615] -- 0:00:32
Average standard deviation of split frequencies: 0.015613
470500 -- (-641.567) [-642.316] (-641.307) (-642.485) * (-640.261) (-641.580) (-640.324) [-642.237] -- 0:00:32
471000 -- [-641.559] (-640.165) (-639.911) (-641.074) * (-641.209) (-641.792) [-639.483] (-643.021) -- 0:00:32
471500 -- [-640.212] (-640.448) (-640.179) (-642.406) * (-644.149) (-639.804) [-640.804] (-643.201) -- 0:00:32
472000 -- (-641.812) [-642.136] (-640.675) (-643.096) * (-643.025) (-641.085) [-640.234] (-652.813) -- 0:00:32
472500 -- [-640.520] (-640.594) (-641.726) (-640.212) * (-644.303) [-642.097] (-642.681) (-643.217) -- 0:00:32
473000 -- (-641.033) (-640.354) (-640.229) [-641.785] * [-641.784] (-642.689) (-644.798) (-643.537) -- 0:00:32
473500 -- (-640.164) (-644.326) [-639.624] (-639.066) * (-643.913) (-642.292) [-640.795] (-639.771) -- 0:00:32
474000 -- (-639.879) (-642.893) [-640.695] (-643.337) * (-642.146) (-643.012) [-639.921] (-639.901) -- 0:00:32
474500 -- [-639.776] (-640.724) (-641.326) (-647.021) * (-639.503) (-641.842) (-640.412) [-641.552] -- 0:00:32
475000 -- (-640.691) (-640.737) [-639.800] (-643.708) * [-638.771] (-644.772) (-641.396) (-640.782) -- 0:00:32
Average standard deviation of split frequencies: 0.015350
475500 -- [-642.516] (-641.669) (-640.494) (-643.176) * [-645.109] (-641.697) (-642.508) (-644.146) -- 0:00:31
476000 -- (-640.031) [-641.853] (-640.004) (-640.908) * (-646.832) [-642.090] (-642.358) (-640.629) -- 0:00:31
476500 -- (-641.653) [-639.923] (-642.426) (-640.326) * (-648.852) (-642.196) [-640.934] (-642.152) -- 0:00:31
477000 -- (-640.216) (-640.549) [-652.011] (-643.425) * (-644.764) (-642.918) [-641.944] (-639.378) -- 0:00:31
477500 -- (-639.635) (-642.597) [-642.063] (-640.481) * [-643.518] (-639.483) (-642.064) (-641.581) -- 0:00:31
478000 -- (-641.829) [-641.919] (-642.139) (-643.243) * [-639.928] (-642.260) (-640.425) (-644.020) -- 0:00:31
478500 -- (-641.994) (-642.485) [-639.817] (-643.796) * [-639.902] (-641.795) (-640.477) (-643.817) -- 0:00:31
479000 -- (-640.339) (-643.795) [-645.801] (-641.728) * (-640.286) [-642.349] (-640.056) (-641.891) -- 0:00:31
479500 -- [-639.428] (-642.506) (-641.563) (-642.331) * [-644.896] (-640.848) (-639.715) (-647.654) -- 0:00:31
480000 -- (-641.641) (-642.354) (-640.365) [-640.047] * [-641.928] (-644.335) (-640.925) (-640.513) -- 0:00:31
Average standard deviation of split frequencies: 0.015310
480500 -- (-639.132) (-641.401) (-639.642) [-639.770] * (-640.461) [-641.806] (-640.768) (-640.513) -- 0:00:31
481000 -- (-639.750) (-640.011) (-641.394) [-643.186] * [-641.626] (-640.703) (-640.629) (-640.181) -- 0:00:31
481500 -- [-639.836] (-639.278) (-641.597) (-641.192) * (-640.173) (-641.730) [-642.769] (-640.433) -- 0:00:31
482000 -- (-642.672) (-639.505) (-640.244) [-640.773] * (-640.422) (-639.302) [-641.715] (-640.396) -- 0:00:31
482500 -- [-639.686] (-640.382) (-644.429) (-639.988) * (-640.941) (-640.838) [-642.004] (-643.302) -- 0:00:31
483000 -- (-639.149) (-639.673) [-641.748] (-642.289) * [-642.952] (-640.160) (-640.140) (-640.060) -- 0:00:31
483500 -- (-642.097) (-640.455) (-640.121) [-640.562] * (-639.341) (-645.784) [-639.405] (-639.885) -- 0:00:30
484000 -- (-646.774) (-644.488) [-639.799] (-639.657) * (-640.907) (-645.529) (-642.622) [-640.110] -- 0:00:31
484500 -- (-642.647) [-642.377] (-646.188) (-643.148) * [-641.186] (-644.959) (-643.055) (-644.393) -- 0:00:31
485000 -- (-639.544) [-639.825] (-639.861) (-641.593) * [-640.732] (-641.821) (-643.536) (-640.081) -- 0:00:31
Average standard deviation of split frequencies: 0.015573
485500 -- (-643.698) (-641.952) [-641.874] (-640.755) * (-641.252) [-640.658] (-642.926) (-644.577) -- 0:00:31
486000 -- [-644.683] (-643.415) (-641.149) (-644.296) * [-640.796] (-640.618) (-639.790) (-642.331) -- 0:00:31
486500 -- [-641.150] (-647.812) (-641.282) (-639.871) * (-642.040) (-643.018) [-639.016] (-640.484) -- 0:00:31
487000 -- (-639.479) (-639.201) [-638.772] (-640.350) * (-640.559) (-643.032) (-643.955) [-640.408] -- 0:00:31
487500 -- (-642.867) (-640.744) [-640.947] (-641.330) * [-640.060] (-642.289) (-641.605) (-642.022) -- 0:00:31
488000 -- (-643.207) (-639.770) (-644.769) [-640.374] * (-640.522) (-642.722) (-641.584) [-643.359] -- 0:00:31
488500 -- (-644.080) [-642.683] (-641.480) (-641.192) * (-641.192) (-641.563) [-642.004] (-640.699) -- 0:00:31
489000 -- (-642.219) (-639.771) (-642.074) [-640.334] * (-641.093) [-640.162] (-644.137) (-640.294) -- 0:00:31
489500 -- (-640.214) [-639.412] (-644.551) (-642.913) * (-642.235) (-640.093) [-642.866] (-640.273) -- 0:00:31
490000 -- (-641.032) (-641.734) [-639.202] (-644.844) * (-640.565) (-640.438) (-641.913) [-642.164] -- 0:00:31
Average standard deviation of split frequencies: 0.016012
490500 -- [-640.493] (-645.130) (-640.102) (-643.899) * (-646.002) [-639.270] (-642.662) (-643.148) -- 0:00:31
491000 -- (-641.437) (-640.487) (-639.327) [-640.940] * (-640.655) (-640.539) [-641.391] (-641.268) -- 0:00:31
491500 -- [-640.421] (-640.620) (-647.445) (-640.615) * (-644.634) (-640.459) (-641.605) [-642.924] -- 0:00:31
492000 -- (-640.924) (-640.024) (-639.502) [-639.923] * (-642.297) [-641.059] (-640.659) (-641.519) -- 0:00:30
492500 -- [-642.331] (-641.034) (-639.875) (-639.018) * (-644.288) [-642.351] (-640.566) (-642.182) -- 0:00:30
493000 -- (-641.884) (-642.881) (-640.736) [-640.888] * (-645.179) (-640.055) (-640.768) [-642.806] -- 0:00:30
493500 -- (-645.162) (-639.827) (-640.393) [-641.435] * [-640.249] (-641.125) (-642.532) (-641.916) -- 0:00:30
494000 -- (-645.923) (-641.096) (-641.247) [-640.482] * [-640.576] (-641.135) (-643.489) (-644.578) -- 0:00:30
494500 -- (-640.064) [-640.535] (-640.088) (-641.673) * (-639.474) (-643.475) [-641.048] (-639.884) -- 0:00:30
495000 -- (-639.365) (-640.860) (-640.242) [-641.153] * [-640.248] (-640.370) (-639.701) (-639.997) -- 0:00:30
Average standard deviation of split frequencies: 0.015787
495500 -- [-640.664] (-643.072) (-639.632) (-647.879) * (-640.216) (-642.532) [-642.134] (-640.019) -- 0:00:30
496000 -- (-641.389) [-639.750] (-640.055) (-639.685) * (-640.280) (-640.022) [-639.490] (-640.261) -- 0:00:30
496500 -- (-639.741) (-644.234) [-640.329] (-639.587) * (-648.641) (-642.923) [-639.575] (-640.211) -- 0:00:30
497000 -- (-643.058) (-641.885) (-645.167) [-639.659] * (-641.223) [-640.739] (-643.621) (-640.159) -- 0:00:30
497500 -- (-643.819) (-640.841) (-643.505) [-640.214] * (-641.737) (-639.637) (-640.415) [-640.438] -- 0:00:30
498000 -- [-638.986] (-640.528) (-641.585) (-640.358) * (-641.319) [-640.062] (-641.589) (-640.670) -- 0:00:30
498500 -- [-640.917] (-640.688) (-641.235) (-640.856) * (-642.349) (-642.773) (-639.543) [-641.350] -- 0:00:30
499000 -- (-640.714) [-640.111] (-640.178) (-639.665) * (-649.014) [-641.826] (-641.077) (-640.761) -- 0:00:30
499500 -- (-641.278) (-639.596) (-642.356) [-639.960] * (-646.164) (-643.760) (-639.073) [-642.306] -- 0:00:30
500000 -- [-639.312] (-639.384) (-639.800) (-647.641) * (-638.741) (-643.816) [-639.384] (-641.445) -- 0:00:30
Average standard deviation of split frequencies: 0.016062
500500 -- (-640.502) (-640.239) [-639.586] (-640.456) * (-639.715) [-645.394] (-640.167) (-645.387) -- 0:00:30
501000 -- (-640.933) [-641.157] (-643.785) (-641.836) * [-639.563] (-639.289) (-644.540) (-650.220) -- 0:00:30
501500 -- [-641.152] (-639.397) (-643.244) (-642.821) * [-643.215] (-641.098) (-643.494) (-640.680) -- 0:00:30
502000 -- (-644.211) (-639.608) [-644.328] (-640.078) * [-645.198] (-641.223) (-642.669) (-641.099) -- 0:00:30
502500 -- [-642.937] (-641.933) (-641.156) (-640.636) * (-639.243) [-641.887] (-644.051) (-639.609) -- 0:00:30
503000 -- (-640.788) (-641.521) [-639.295] (-645.046) * (-641.099) (-642.758) [-645.937] (-641.760) -- 0:00:30
503500 -- [-640.843] (-644.263) (-643.761) (-643.339) * (-640.242) (-640.676) (-646.550) [-642.420] -- 0:00:30
504000 -- (-640.588) [-639.560] (-640.989) (-642.426) * [-639.998] (-641.993) (-639.889) (-641.656) -- 0:00:30
504500 -- (-639.718) [-639.035] (-644.557) (-642.392) * (-646.635) (-643.721) (-642.256) [-640.833] -- 0:00:30
505000 -- [-640.965] (-642.387) (-640.941) (-641.726) * (-641.551) (-641.343) (-641.361) [-643.792] -- 0:00:30
Average standard deviation of split frequencies: 0.014961
505500 -- (-642.086) (-643.810) (-641.039) [-643.102] * (-643.333) (-641.993) (-644.700) [-642.870] -- 0:00:30
506000 -- (-645.817) (-641.741) (-643.013) [-644.147] * (-644.009) (-639.368) [-642.372] (-643.108) -- 0:00:30
506500 -- (-644.305) (-643.219) (-640.011) [-639.939] * (-642.448) [-641.984] (-640.270) (-642.213) -- 0:00:30
507000 -- (-640.991) [-642.649] (-639.654) (-639.498) * [-641.458] (-642.941) (-641.323) (-638.963) -- 0:00:30
507500 -- [-641.202] (-642.292) (-640.110) (-639.637) * (-640.067) [-642.205] (-640.518) (-640.657) -- 0:00:30
508000 -- (-640.092) (-641.064) [-639.183] (-640.450) * (-640.542) (-640.449) (-641.744) [-640.615] -- 0:00:30
508500 -- (-640.571) (-641.941) (-641.200) [-639.637] * (-639.908) (-641.126) (-640.092) [-640.208] -- 0:00:29
509000 -- (-639.475) [-639.817] (-641.697) (-641.650) * (-645.162) [-642.729] (-640.532) (-642.207) -- 0:00:29
509500 -- (-639.684) (-642.164) (-641.484) [-640.763] * [-642.457] (-641.144) (-642.182) (-641.575) -- 0:00:29
510000 -- [-641.037] (-645.150) (-640.441) (-639.644) * [-640.929] (-640.425) (-639.204) (-640.777) -- 0:00:29
Average standard deviation of split frequencies: 0.015204
510500 -- (-640.070) (-642.352) [-640.965] (-641.803) * [-645.430] (-639.912) (-641.569) (-640.862) -- 0:00:29
511000 -- [-640.823] (-647.125) (-640.405) (-639.444) * (-642.205) (-640.677) [-642.232] (-644.843) -- 0:00:29
511500 -- (-639.625) (-640.368) (-641.148) [-647.911] * (-641.398) (-647.017) [-643.364] (-641.595) -- 0:00:29
512000 -- (-639.687) [-645.863] (-640.211) (-642.947) * [-642.633] (-639.870) (-640.200) (-640.671) -- 0:00:29
512500 -- [-639.368] (-642.658) (-640.906) (-640.284) * (-640.216) (-644.525) (-641.595) [-639.682] -- 0:00:29
513000 -- (-640.034) (-642.967) (-642.326) [-639.847] * (-643.737) [-643.048] (-645.626) (-639.679) -- 0:00:29
513500 -- (-640.817) (-640.126) [-642.099] (-639.981) * (-639.043) (-641.281) (-640.789) [-640.140] -- 0:00:29
514000 -- (-639.943) (-639.994) (-641.915) [-643.980] * (-643.705) [-640.659] (-644.128) (-640.563) -- 0:00:29
514500 -- (-640.235) (-641.179) [-640.697] (-640.437) * (-640.723) [-639.999] (-640.843) (-641.578) -- 0:00:29
515000 -- (-639.854) [-641.361] (-640.039) (-643.495) * (-641.578) (-640.596) [-643.656] (-641.107) -- 0:00:29
Average standard deviation of split frequencies: 0.015370
515500 -- (-642.143) (-640.217) [-639.202] (-641.422) * (-642.617) (-640.229) (-640.538) [-645.398] -- 0:00:29
516000 -- (-640.616) (-639.431) [-641.511] (-642.100) * (-645.096) [-639.364] (-640.231) (-645.689) -- 0:00:29
516500 -- (-640.217) [-639.601] (-643.092) (-640.623) * (-644.038) (-640.254) (-641.318) [-645.782] -- 0:00:29
517000 -- [-641.003] (-639.864) (-640.977) (-640.710) * [-642.144] (-640.071) (-643.760) (-642.960) -- 0:00:28
517500 -- (-645.799) [-640.733] (-639.636) (-640.537) * [-641.882] (-640.085) (-641.793) (-642.954) -- 0:00:29
518000 -- (-642.927) (-641.395) (-641.719) [-646.652] * (-641.227) [-643.050] (-643.548) (-643.251) -- 0:00:29
518500 -- [-644.554] (-641.644) (-641.253) (-641.035) * (-642.927) (-642.491) [-643.095] (-641.136) -- 0:00:29
519000 -- (-640.045) [-641.274] (-641.962) (-639.055) * (-641.202) [-639.195] (-643.230) (-640.582) -- 0:00:29
519500 -- (-639.080) [-640.338] (-643.852) (-640.106) * (-644.651) [-643.630] (-642.103) (-640.275) -- 0:00:29
520000 -- [-640.065] (-639.739) (-645.609) (-640.652) * (-643.457) (-640.086) [-639.384] (-639.609) -- 0:00:29
Average standard deviation of split frequencies: 0.014752
520500 -- (-640.379) [-641.353] (-643.298) (-640.178) * (-642.802) (-640.184) [-640.994] (-640.704) -- 0:00:29
521000 -- [-639.804] (-642.006) (-641.620) (-640.915) * (-642.676) (-642.262) [-642.171] (-639.650) -- 0:00:29
521500 -- (-648.156) (-639.590) (-643.154) [-640.705] * (-645.709) (-643.833) (-642.211) [-640.622] -- 0:00:29
522000 -- (-643.800) (-640.995) [-641.610] (-640.850) * (-643.665) [-639.887] (-640.697) (-640.058) -- 0:00:29
522500 -- (-641.190) (-642.606) (-641.360) [-640.138] * (-645.292) [-641.062] (-645.439) (-639.965) -- 0:00:29
523000 -- [-641.172] (-641.603) (-643.194) (-642.118) * (-641.388) (-639.954) [-642.845] (-644.343) -- 0:00:29
523500 -- (-640.031) (-639.896) (-640.790) [-641.716] * (-640.054) (-642.148) [-641.409] (-642.678) -- 0:00:29
524000 -- [-644.303] (-640.206) (-639.731) (-639.797) * (-639.284) [-642.485] (-640.913) (-640.976) -- 0:00:29
524500 -- (-641.283) (-641.451) [-643.913] (-640.460) * (-639.232) [-639.892] (-640.768) (-640.955) -- 0:00:29
525000 -- [-642.194] (-642.542) (-642.211) (-638.972) * (-641.123) (-640.141) (-642.815) [-642.618] -- 0:00:28
Average standard deviation of split frequencies: 0.015130
525500 -- (-642.166) [-641.741] (-639.981) (-641.405) * (-644.856) [-640.571] (-641.955) (-640.269) -- 0:00:28
526000 -- (-640.898) (-641.664) [-639.458] (-641.444) * (-641.735) [-642.681] (-640.189) (-641.761) -- 0:00:28
526500 -- (-645.078) (-642.205) (-639.989) [-641.193] * (-639.956) (-641.315) (-642.014) [-644.896] -- 0:00:28
527000 -- [-641.036] (-639.966) (-639.819) (-643.639) * (-639.994) (-640.910) [-639.988] (-642.176) -- 0:00:28
527500 -- (-640.160) [-643.161] (-639.712) (-642.666) * (-639.318) (-643.925) [-639.628] (-642.393) -- 0:00:28
528000 -- [-641.134] (-640.601) (-642.459) (-641.069) * [-644.898] (-641.793) (-639.653) (-640.748) -- 0:00:28
528500 -- (-643.476) [-640.416] (-641.256) (-640.896) * (-640.916) [-640.636] (-643.640) (-638.793) -- 0:00:28
529000 -- (-643.397) [-639.064] (-640.695) (-640.192) * (-642.403) (-640.687) (-640.536) [-639.373] -- 0:00:28
529500 -- (-640.841) (-638.950) [-640.521] (-644.598) * (-644.755) [-639.884] (-640.835) (-640.277) -- 0:00:28
530000 -- (-641.974) (-645.066) [-641.897] (-642.985) * (-638.991) (-640.546) (-642.130) [-639.074] -- 0:00:28
Average standard deviation of split frequencies: 0.014318
530500 -- (-646.115) (-639.597) (-639.514) [-643.947] * [-640.490] (-642.414) (-644.244) (-639.076) -- 0:00:28
531000 -- [-639.151] (-641.121) (-640.538) (-640.470) * (-643.273) (-639.303) [-639.929] (-639.882) -- 0:00:28
531500 -- [-639.153] (-642.436) (-640.495) (-643.422) * (-647.358) (-641.358) [-642.511] (-641.611) -- 0:00:28
532000 -- [-640.558] (-640.122) (-644.261) (-642.251) * [-643.215] (-639.284) (-643.824) (-640.470) -- 0:00:28
532500 -- [-642.322] (-641.996) (-640.483) (-642.232) * (-643.978) (-641.759) (-642.237) [-641.018] -- 0:00:28
533000 -- (-643.572) (-641.149) [-640.274] (-645.538) * (-640.156) (-641.610) [-640.555] (-640.099) -- 0:00:28
533500 -- (-642.159) (-642.111) [-641.091] (-640.485) * (-640.900) (-639.696) [-642.496] (-642.096) -- 0:00:27
534000 -- (-641.926) (-642.282) [-640.957] (-642.015) * (-640.086) [-639.900] (-642.170) (-641.775) -- 0:00:28
534500 -- (-642.003) [-641.016] (-639.524) (-643.139) * (-639.980) (-640.300) [-639.109] (-643.361) -- 0:00:28
535000 -- (-642.291) (-642.132) (-641.649) [-639.423] * (-642.071) [-642.077] (-640.119) (-640.274) -- 0:00:28
Average standard deviation of split frequencies: 0.014020
535500 -- [-640.242] (-638.830) (-642.042) (-646.905) * (-642.060) [-644.281] (-643.433) (-645.366) -- 0:00:28
536000 -- (-641.040) [-639.455] (-641.536) (-643.104) * (-640.764) (-643.282) (-643.165) [-645.151] -- 0:00:28
536500 -- [-639.750] (-641.265) (-639.840) (-643.448) * [-640.276] (-641.826) (-643.375) (-641.096) -- 0:00:28
537000 -- (-642.771) [-641.005] (-640.073) (-648.145) * (-640.564) (-642.522) [-640.336] (-640.501) -- 0:00:28
537500 -- (-642.096) [-642.755] (-644.573) (-650.002) * (-640.964) (-644.139) (-640.977) [-639.731] -- 0:00:28
538000 -- (-641.813) [-640.960] (-640.466) (-641.443) * [-640.500] (-641.745) (-639.521) (-638.988) -- 0:00:28
538500 -- [-645.177] (-639.851) (-644.399) (-641.215) * (-640.697) [-641.128] (-644.768) (-642.217) -- 0:00:28
539000 -- (-643.893) (-640.512) (-642.071) [-640.612] * (-641.869) (-643.096) [-641.662] (-642.641) -- 0:00:28
539500 -- (-641.472) [-643.990] (-640.788) (-641.034) * (-640.470) (-643.500) (-641.429) [-641.571] -- 0:00:28
540000 -- (-641.097) [-644.046] (-645.798) (-645.877) * (-639.845) (-640.054) [-644.737] (-642.168) -- 0:00:28
Average standard deviation of split frequencies: 0.013437
540500 -- (-647.632) (-642.200) (-644.042) [-639.569] * [-639.891] (-640.111) (-643.706) (-643.366) -- 0:00:28
541000 -- (-641.203) (-644.897) [-639.302] (-639.577) * (-644.186) (-644.969) [-641.517] (-640.824) -- 0:00:27
541500 -- (-641.273) (-644.326) (-640.582) [-640.197] * (-642.222) [-640.463] (-640.374) (-640.567) -- 0:00:27
542000 -- (-643.086) (-640.321) (-639.979) [-639.934] * [-640.785] (-641.373) (-640.583) (-639.850) -- 0:00:27
542500 -- [-643.276] (-640.531) (-639.153) (-643.199) * [-641.292] (-639.965) (-641.326) (-641.666) -- 0:00:27
543000 -- (-643.876) [-644.046] (-640.788) (-639.685) * [-641.096] (-639.309) (-641.286) (-640.803) -- 0:00:27
543500 -- (-645.559) (-643.561) (-639.636) [-639.929] * (-640.137) [-641.240] (-642.226) (-640.051) -- 0:00:27
544000 -- (-642.117) (-643.083) [-639.842] (-644.508) * (-640.606) [-641.761] (-639.478) (-640.038) -- 0:00:27
544500 -- [-642.575] (-638.926) (-640.639) (-648.932) * (-639.550) [-641.051] (-639.322) (-642.506) -- 0:00:27
545000 -- [-639.279] (-640.199) (-642.237) (-640.233) * (-639.731) (-641.920) (-641.536) [-639.938] -- 0:00:27
Average standard deviation of split frequencies: 0.013052
545500 -- (-640.507) [-644.491] (-639.976) (-642.833) * [-640.207] (-647.278) (-640.127) (-643.281) -- 0:00:27
546000 -- (-640.643) [-640.697] (-639.203) (-640.409) * (-639.898) [-639.616] (-639.573) (-642.396) -- 0:00:27
546500 -- (-639.543) [-640.674] (-641.869) (-639.408) * (-642.761) (-643.894) (-639.937) [-639.393] -- 0:00:27
547000 -- [-639.191] (-642.388) (-640.186) (-639.578) * [-639.160] (-642.058) (-643.321) (-639.783) -- 0:00:27
547500 -- [-639.687] (-643.363) (-640.713) (-640.653) * (-642.524) (-639.925) [-642.293] (-642.617) -- 0:00:27
548000 -- (-640.620) [-642.364] (-639.762) (-645.124) * [-641.976] (-643.079) (-641.275) (-640.745) -- 0:00:27
548500 -- (-641.578) (-641.881) (-643.263) [-644.384] * (-641.309) (-641.396) (-640.031) [-639.778] -- 0:00:27
549000 -- (-640.579) [-639.263] (-645.583) (-641.040) * (-645.984) (-640.496) [-642.036] (-639.497) -- 0:00:27
549500 -- [-641.535] (-639.355) (-640.782) (-643.408) * (-643.478) (-644.681) (-641.438) [-640.157] -- 0:00:27
550000 -- (-639.234) (-642.585) (-639.279) [-640.719] * (-640.018) (-642.378) [-639.222] (-638.738) -- 0:00:27
Average standard deviation of split frequencies: 0.013344
550500 -- (-640.022) (-644.176) [-643.546] (-641.440) * (-641.313) (-640.975) [-639.196] (-639.170) -- 0:00:27
551000 -- (-639.034) (-641.981) (-643.341) [-640.324] * (-646.677) (-642.983) (-640.735) [-638.774] -- 0:00:27
551500 -- (-640.488) (-641.225) [-641.590] (-641.500) * [-640.255] (-643.892) (-640.920) (-639.438) -- 0:00:27
552000 -- (-640.054) (-641.013) [-641.476] (-639.989) * (-646.672) (-645.562) [-643.200] (-641.122) -- 0:00:27
552500 -- [-639.540] (-640.847) (-644.399) (-640.100) * (-640.338) (-640.140) [-640.243] (-640.747) -- 0:00:27
553000 -- (-640.465) (-640.812) [-642.834] (-640.548) * (-640.336) (-640.007) (-641.044) [-640.288] -- 0:00:27
553500 -- (-640.763) (-640.341) (-643.783) [-640.126] * (-640.969) (-639.717) (-640.422) [-641.210] -- 0:00:27
554000 -- [-640.222] (-644.389) (-642.680) (-641.953) * (-645.552) (-639.359) [-640.128] (-642.267) -- 0:00:27
554500 -- (-639.029) (-642.703) (-640.995) [-641.302] * (-640.281) (-642.344) [-640.674] (-641.842) -- 0:00:27
555000 -- (-639.504) (-646.357) [-639.226] (-639.671) * (-642.104) (-643.186) [-639.338] (-643.259) -- 0:00:27
Average standard deviation of split frequencies: 0.013366
555500 -- [-641.960] (-647.182) (-639.342) (-640.814) * [-644.592] (-640.105) (-641.499) (-644.160) -- 0:00:27
556000 -- (-641.433) (-642.451) [-640.340] (-639.963) * (-640.760) [-640.458] (-642.769) (-640.461) -- 0:00:27
556500 -- [-642.287] (-649.349) (-643.125) (-639.839) * (-639.464) [-639.641] (-640.242) (-641.957) -- 0:00:27
557000 -- (-641.719) [-640.155] (-646.048) (-639.811) * [-640.295] (-641.851) (-640.892) (-640.174) -- 0:00:27
557500 -- (-640.145) (-639.409) (-641.614) [-644.814] * (-640.618) (-640.285) (-645.213) [-640.271] -- 0:00:26
558000 -- (-641.787) (-640.729) (-640.618) [-640.421] * (-642.077) (-640.692) [-640.164] (-641.799) -- 0:00:26
558500 -- (-640.427) (-643.990) [-640.167] (-642.915) * (-640.669) [-639.537] (-644.585) (-643.082) -- 0:00:26
559000 -- (-639.397) [-641.113] (-638.993) (-639.722) * (-641.803) [-640.671] (-645.117) (-640.934) -- 0:00:26
559500 -- (-640.169) [-640.115] (-642.316) (-645.948) * (-639.749) (-640.504) (-644.639) [-640.185] -- 0:00:26
560000 -- [-640.721] (-640.648) (-641.853) (-642.728) * (-641.264) (-642.203) (-642.325) [-638.895] -- 0:00:26
Average standard deviation of split frequencies: 0.013304
560500 -- (-641.580) [-639.571] (-640.100) (-640.468) * (-641.242) [-641.927] (-639.876) (-641.158) -- 0:00:26
561000 -- (-642.789) (-639.649) (-640.658) [-639.550] * (-640.266) (-642.362) (-646.862) [-640.105] -- 0:00:26
561500 -- (-650.892) (-643.589) [-640.646] (-642.407) * (-640.810) (-641.102) (-642.155) [-640.733] -- 0:00:26
562000 -- (-640.804) (-643.946) [-639.114] (-642.178) * [-642.714] (-643.132) (-639.948) (-640.360) -- 0:00:26
562500 -- (-642.590) [-641.481] (-639.868) (-638.990) * (-639.411) (-642.140) [-643.466] (-641.879) -- 0:00:26
563000 -- [-643.037] (-639.704) (-642.118) (-641.552) * (-647.179) (-645.649) (-640.184) [-641.166] -- 0:00:26
563500 -- (-640.302) (-640.971) (-642.363) [-641.415] * [-639.780] (-642.649) (-643.038) (-640.507) -- 0:00:26
564000 -- [-639.761] (-643.347) (-640.674) (-643.703) * (-640.872) (-644.893) [-641.087] (-638.766) -- 0:00:26
564500 -- (-642.342) [-640.479] (-639.591) (-639.787) * (-641.128) (-645.241) (-640.078) [-639.647] -- 0:00:26
565000 -- (-641.173) (-640.955) [-639.204] (-639.911) * (-646.185) (-642.428) (-645.067) [-640.970] -- 0:00:26
Average standard deviation of split frequencies: 0.013228
565500 -- (-639.697) [-641.263] (-641.229) (-639.902) * (-643.984) (-642.289) [-642.852] (-642.369) -- 0:00:26
566000 -- (-641.088) [-639.450] (-639.933) (-642.241) * (-645.732) [-641.171] (-641.242) (-642.168) -- 0:00:26
566500 -- (-640.617) [-640.384] (-643.140) (-643.017) * (-644.510) (-641.867) (-640.538) [-639.505] -- 0:00:26
567000 -- [-643.267] (-642.492) (-640.668) (-639.099) * (-644.525) (-639.900) [-641.230] (-638.985) -- 0:00:25
567500 -- (-643.539) (-644.722) [-639.910] (-639.821) * (-642.007) (-641.573) [-641.113] (-639.359) -- 0:00:26
568000 -- (-641.332) (-639.644) (-639.878) [-640.031] * (-642.652) (-639.633) [-640.043] (-640.578) -- 0:00:26
568500 -- (-644.404) [-641.220] (-643.495) (-639.146) * (-641.563) (-639.430) [-639.577] (-640.305) -- 0:00:26
569000 -- (-640.244) (-640.368) [-639.217] (-639.722) * [-641.186] (-645.072) (-640.958) (-641.474) -- 0:00:26
569500 -- (-639.731) (-641.025) [-639.771] (-645.878) * [-640.111] (-640.708) (-642.347) (-640.875) -- 0:00:26
570000 -- [-640.495] (-643.938) (-641.881) (-640.970) * (-639.365) (-639.335) [-640.967] (-640.367) -- 0:00:26
Average standard deviation of split frequencies: 0.013460
570500 -- (-640.269) [-640.587] (-641.668) (-640.558) * (-641.507) (-641.757) (-643.837) [-640.226] -- 0:00:26
571000 -- (-643.367) (-640.205) (-639.479) [-639.831] * [-638.904] (-640.071) (-640.282) (-639.033) -- 0:00:26
571500 -- (-643.268) (-638.962) [-640.165] (-639.836) * (-640.729) [-640.375] (-640.240) (-641.517) -- 0:00:26
572000 -- (-641.691) (-639.755) [-638.809] (-640.820) * (-641.869) [-640.842] (-639.321) (-639.939) -- 0:00:26
572500 -- [-641.128] (-642.552) (-641.375) (-641.191) * [-640.479] (-639.706) (-641.537) (-645.232) -- 0:00:26
573000 -- (-639.713) (-641.836) (-643.599) [-642.049] * (-641.904) (-639.205) (-641.694) [-641.667] -- 0:00:26
573500 -- (-640.450) (-641.249) [-639.379] (-639.183) * (-640.415) (-640.488) (-639.154) [-642.175] -- 0:00:26
574000 -- (-640.018) (-641.737) [-639.799] (-640.073) * [-641.637] (-644.614) (-642.612) (-642.647) -- 0:00:25
574500 -- (-640.168) (-640.853) (-642.049) [-639.744] * [-642.105] (-641.885) (-642.813) (-639.976) -- 0:00:25
575000 -- (-646.057) (-639.724) [-643.359] (-639.535) * [-643.717] (-640.881) (-641.318) (-640.648) -- 0:00:25
Average standard deviation of split frequencies: 0.014394
575500 -- [-640.591] (-643.021) (-640.930) (-640.981) * (-640.952) [-642.493] (-642.513) (-641.121) -- 0:00:25
576000 -- [-642.072] (-641.219) (-644.255) (-640.229) * (-640.765) (-644.103) (-641.865) [-639.260] -- 0:00:25
576500 -- (-641.908) [-641.424] (-643.043) (-639.869) * (-640.838) (-641.157) [-640.956] (-639.833) -- 0:00:25
577000 -- (-639.931) (-643.372) (-640.100) [-641.855] * (-642.772) [-644.107] (-640.173) (-643.803) -- 0:00:25
577500 -- (-640.436) (-643.130) (-641.810) [-641.850] * [-644.302] (-644.021) (-640.441) (-640.341) -- 0:00:25
578000 -- (-639.194) (-643.648) (-640.574) [-642.203] * (-639.410) (-645.274) [-643.107] (-639.776) -- 0:00:25
578500 -- (-639.575) [-640.855] (-644.990) (-642.823) * (-642.592) (-645.530) [-640.521] (-640.493) -- 0:00:25
579000 -- (-640.972) (-640.743) [-639.782] (-647.925) * (-643.381) [-640.680] (-643.419) (-641.303) -- 0:00:25
579500 -- [-641.263] (-641.821) (-639.895) (-645.463) * (-642.881) [-639.418] (-640.946) (-642.066) -- 0:00:25
580000 -- (-643.604) (-640.256) (-645.489) [-641.002] * (-640.524) (-640.147) [-643.416] (-643.373) -- 0:00:25
Average standard deviation of split frequencies: 0.014900
580500 -- [-641.688] (-639.821) (-640.283) (-642.387) * (-646.850) (-638.954) (-640.774) [-639.193] -- 0:00:25
581000 -- (-640.204) [-642.117] (-639.211) (-642.233) * [-642.342] (-640.204) (-642.948) (-644.095) -- 0:00:25
581500 -- (-642.591) [-640.945] (-641.143) (-640.756) * (-650.454) (-641.266) (-642.423) [-641.845] -- 0:00:25
582000 -- (-640.325) [-639.380] (-641.527) (-640.282) * (-646.816) [-646.261] (-643.138) (-642.329) -- 0:00:25
582500 -- (-639.201) (-640.401) (-644.669) [-640.158] * (-648.633) (-642.427) (-641.136) [-639.711] -- 0:00:25
583000 -- [-641.046] (-639.455) (-641.726) (-646.291) * (-643.321) (-643.928) [-642.090] (-639.853) -- 0:00:25
583500 -- (-640.983) [-645.143] (-641.029) (-647.317) * (-644.290) (-639.964) (-640.228) [-641.554] -- 0:00:25
584000 -- (-643.129) (-640.835) (-639.867) [-641.904] * (-643.195) (-640.091) (-644.142) [-639.754] -- 0:00:25
584500 -- (-642.239) (-640.151) (-641.499) [-639.671] * (-642.388) (-640.232) [-641.382] (-641.951) -- 0:00:25
585000 -- (-644.355) (-641.024) [-640.671] (-641.495) * [-639.824] (-639.657) (-643.619) (-641.378) -- 0:00:25
Average standard deviation of split frequencies: 0.014257
585500 -- (-639.557) [-639.612] (-640.472) (-640.670) * (-639.030) [-643.740] (-641.468) (-641.141) -- 0:00:25
586000 -- (-640.441) (-640.123) [-639.756] (-639.940) * [-639.090] (-642.314) (-640.109) (-641.915) -- 0:00:25
586500 -- [-639.598] (-643.513) (-640.426) (-639.830) * (-643.047) (-641.567) (-640.288) [-645.666] -- 0:00:25
587000 -- (-639.660) (-641.181) [-640.477] (-639.930) * [-639.610] (-643.909) (-640.285) (-641.029) -- 0:00:25
587500 -- (-640.593) (-643.245) (-643.076) [-639.580] * (-640.428) (-643.257) (-641.481) [-642.065] -- 0:00:25
588000 -- [-642.022] (-641.365) (-642.059) (-641.822) * (-641.437) (-645.542) [-644.300] (-643.521) -- 0:00:25
588500 -- (-640.580) [-639.951] (-642.187) (-640.606) * (-641.154) (-639.876) [-640.772] (-641.333) -- 0:00:25
589000 -- (-640.406) (-640.096) [-641.258] (-639.653) * [-641.604] (-644.544) (-644.092) (-641.748) -- 0:00:25
589500 -- (-639.397) (-639.416) (-640.431) [-640.332] * (-644.945) (-642.057) (-641.039) [-642.135] -- 0:00:25
590000 -- (-643.408) (-640.165) (-643.009) [-641.063] * (-642.472) (-638.902) (-644.656) [-642.009] -- 0:00:25
Average standard deviation of split frequencies: 0.014178
590500 -- (-641.378) (-642.629) (-641.805) [-642.390] * (-641.315) (-641.986) [-644.061] (-643.538) -- 0:00:24
591000 -- [-642.144] (-640.426) (-641.924) (-641.613) * [-639.629] (-639.737) (-644.328) (-642.095) -- 0:00:24
591500 -- (-642.889) (-640.110) [-640.149] (-638.916) * (-643.972) [-639.256] (-644.664) (-640.654) -- 0:00:24
592000 -- (-641.959) (-645.119) [-641.935] (-640.295) * (-639.858) (-639.116) (-639.923) [-639.740] -- 0:00:24
592500 -- (-639.518) (-645.940) (-639.413) [-640.625] * (-641.733) (-639.567) (-640.011) [-639.692] -- 0:00:24
593000 -- (-640.812) [-640.525] (-639.185) (-643.519) * (-641.273) [-640.398] (-641.240) (-642.372) -- 0:00:24
593500 -- [-640.567] (-643.013) (-639.643) (-643.448) * (-640.965) (-642.265) [-640.440] (-639.297) -- 0:00:24
594000 -- (-641.794) [-643.390] (-641.304) (-639.678) * [-641.389] (-639.736) (-640.431) (-639.090) -- 0:00:24
594500 -- (-640.306) [-641.155] (-644.943) (-639.144) * (-643.613) [-640.147] (-639.632) (-642.127) -- 0:00:24
595000 -- (-647.724) (-642.827) (-642.052) [-639.340] * (-641.145) [-640.170] (-641.822) (-647.664) -- 0:00:24
Average standard deviation of split frequencies: 0.013958
595500 -- (-639.860) (-639.496) (-640.853) [-642.833] * (-643.159) (-639.827) (-642.919) [-641.997] -- 0:00:24
596000 -- (-639.080) (-638.968) (-639.754) [-641.841] * (-642.087) [-639.474] (-640.975) (-640.533) -- 0:00:24
596500 -- (-639.608) [-642.703] (-646.151) (-643.371) * (-643.130) (-640.745) [-641.769] (-641.044) -- 0:00:24
597000 -- (-642.319) (-640.683) (-639.945) [-641.414] * (-642.789) [-648.818] (-639.803) (-639.910) -- 0:00:24
597500 -- [-641.840] (-641.178) (-642.569) (-640.177) * (-641.017) (-643.982) [-640.182] (-645.017) -- 0:00:24
598000 -- (-641.603) [-641.941] (-643.265) (-640.685) * (-642.219) (-639.323) (-640.957) [-643.307] -- 0:00:24
598500 -- (-641.982) (-640.716) (-641.125) [-639.096] * (-639.545) (-644.308) [-641.778] (-640.388) -- 0:00:24
599000 -- (-642.078) (-640.829) [-640.443] (-639.211) * [-640.096] (-642.843) (-640.224) (-639.627) -- 0:00:24
599500 -- (-639.577) (-642.124) (-641.836) [-640.738] * (-641.242) (-640.897) [-639.765] (-642.961) -- 0:00:24
600000 -- (-646.098) (-641.637) (-640.933) [-639.378] * (-639.501) [-641.116] (-643.751) (-640.398) -- 0:00:24
Average standard deviation of split frequencies: 0.013619
600500 -- (-638.903) [-640.390] (-643.280) (-641.231) * [-639.382] (-644.188) (-639.591) (-639.602) -- 0:00:24
601000 -- [-639.198] (-641.816) (-640.914) (-641.654) * (-639.658) (-641.701) (-638.894) [-639.028] -- 0:00:24
601500 -- (-640.794) (-644.106) (-640.238) [-639.356] * [-640.676] (-640.380) (-640.523) (-641.078) -- 0:00:24
602000 -- (-642.150) [-642.115] (-639.306) (-639.292) * (-640.262) (-640.155) [-639.002] (-644.453) -- 0:00:24
602500 -- [-642.438] (-640.517) (-642.081) (-642.914) * [-641.751] (-644.676) (-639.236) (-642.181) -- 0:00:24
603000 -- (-642.663) [-639.259] (-644.129) (-640.769) * (-645.944) [-640.138] (-641.156) (-640.081) -- 0:00:24
603500 -- (-641.502) [-639.662] (-642.023) (-641.295) * (-643.720) (-641.767) [-641.247] (-641.983) -- 0:00:24
604000 -- (-641.611) (-643.675) (-643.814) [-642.921] * (-642.578) (-643.558) [-639.339] (-639.253) -- 0:00:24
604500 -- [-641.756] (-641.543) (-640.448) (-639.674) * (-639.720) (-643.106) [-640.335] (-638.827) -- 0:00:24
605000 -- (-641.081) [-640.795] (-643.807) (-640.079) * (-643.232) (-645.759) (-640.837) [-639.475] -- 0:00:24
Average standard deviation of split frequencies: 0.013087
605500 -- (-640.344) (-641.459) (-640.577) [-643.580] * (-641.501) [-641.315] (-641.622) (-638.971) -- 0:00:24
606000 -- (-642.294) [-640.448] (-639.915) (-640.434) * (-639.849) [-642.844] (-639.626) (-640.885) -- 0:00:24
606500 -- (-642.022) (-639.959) [-640.848] (-639.385) * (-641.843) [-639.422] (-639.257) (-639.992) -- 0:00:24
607000 -- (-641.632) [-641.732] (-642.245) (-640.075) * (-642.529) (-639.448) [-639.828] (-640.129) -- 0:00:23
607500 -- (-639.571) (-641.951) (-641.763) [-640.335] * (-646.158) (-643.376) [-640.996] (-639.226) -- 0:00:23
608000 -- (-640.763) (-643.515) [-644.157] (-639.502) * (-639.801) (-650.282) (-640.757) [-645.332] -- 0:00:23
608500 -- (-642.499) (-644.707) (-641.750) [-640.207] * (-639.924) (-640.826) (-639.095) [-639.550] -- 0:00:23
609000 -- (-640.091) (-643.415) (-640.615) [-640.478] * (-639.912) [-639.769] (-639.865) (-640.569) -- 0:00:23
609500 -- (-640.292) [-639.565] (-642.952) (-640.068) * (-642.370) [-640.697] (-641.666) (-640.035) -- 0:00:23
610000 -- (-640.447) [-640.172] (-640.315) (-642.140) * (-640.536) (-642.415) (-644.172) [-639.125] -- 0:00:23
Average standard deviation of split frequencies: 0.013577
610500 -- (-639.633) (-640.772) [-639.319] (-641.136) * (-638.870) (-647.204) [-640.754] (-639.437) -- 0:00:23
611000 -- (-644.289) [-640.585] (-642.179) (-647.316) * (-642.756) (-640.679) [-640.263] (-639.136) -- 0:00:23
611500 -- (-639.956) [-642.003] (-640.144) (-642.956) * [-642.768] (-641.787) (-639.158) (-640.210) -- 0:00:23
612000 -- (-640.523) [-640.163] (-640.131) (-640.366) * [-642.947] (-646.217) (-641.408) (-640.129) -- 0:00:23
612500 -- (-639.402) (-639.425) [-639.986] (-639.602) * [-643.251] (-646.106) (-641.639) (-643.417) -- 0:00:23
613000 -- [-643.301] (-639.469) (-643.223) (-642.698) * (-643.954) (-641.614) (-640.309) [-641.228] -- 0:00:23
613500 -- (-641.984) [-641.055] (-640.878) (-639.915) * (-641.677) (-639.978) [-639.883] (-645.604) -- 0:00:23
614000 -- (-641.730) [-642.583] (-638.795) (-640.080) * (-643.830) (-640.795) (-640.748) [-643.043] -- 0:00:23
614500 -- (-640.062) [-643.073] (-641.653) (-640.002) * (-642.160) [-640.075] (-640.459) (-645.715) -- 0:00:23
615000 -- (-641.493) (-640.232) [-640.080] (-641.305) * (-646.335) [-639.378] (-640.204) (-641.699) -- 0:00:23
Average standard deviation of split frequencies: 0.014225
615500 -- (-640.375) [-640.285] (-641.414) (-647.095) * (-639.723) (-639.083) (-639.221) [-640.206] -- 0:00:23
616000 -- (-644.279) (-641.227) [-641.408] (-640.677) * (-644.343) [-639.930] (-643.178) (-639.600) -- 0:00:23
616500 -- [-640.457] (-642.432) (-639.094) (-642.171) * [-642.312] (-640.865) (-642.126) (-641.775) -- 0:00:23
617000 -- [-643.435] (-643.019) (-641.158) (-646.776) * (-641.553) [-641.668] (-643.397) (-640.440) -- 0:00:23
617500 -- (-642.488) (-645.383) (-643.419) [-644.277] * (-641.954) (-641.735) (-653.616) [-639.950] -- 0:00:23
618000 -- [-641.298] (-640.538) (-641.148) (-642.789) * (-643.532) (-640.703) (-641.353) [-640.469] -- 0:00:23
618500 -- (-642.894) (-639.743) [-641.155] (-642.499) * [-642.572] (-639.915) (-645.480) (-640.124) -- 0:00:23
619000 -- (-642.057) (-641.827) (-643.425) [-639.754] * (-642.028) (-641.477) (-641.692) [-640.682] -- 0:00:23
619500 -- (-643.513) (-643.452) [-641.550] (-640.161) * [-639.728] (-641.191) (-639.255) (-640.444) -- 0:00:23
620000 -- (-639.533) (-644.636) [-640.333] (-640.041) * (-644.129) [-642.278] (-641.318) (-639.880) -- 0:00:23
Average standard deviation of split frequencies: 0.013850
620500 -- [-640.043] (-643.003) (-643.694) (-642.446) * (-640.004) [-641.195] (-639.739) (-640.594) -- 0:00:23
621000 -- [-642.908] (-639.599) (-640.675) (-641.379) * (-644.171) (-639.877) [-641.997] (-641.222) -- 0:00:23
621500 -- (-640.478) (-640.364) (-639.107) [-641.127] * (-643.121) (-639.688) (-640.672) [-644.788] -- 0:00:23
622000 -- (-639.992) (-640.393) (-639.108) [-644.811] * (-648.077) (-639.096) [-640.548] (-640.843) -- 0:00:23
622500 -- [-641.426] (-640.638) (-641.613) (-644.708) * (-641.011) (-639.337) (-640.751) [-640.379] -- 0:00:23
623000 -- (-642.582) (-640.214) [-639.026] (-641.296) * (-644.396) [-641.181] (-646.952) (-641.678) -- 0:00:22
623500 -- (-640.150) (-642.822) [-639.490] (-647.234) * (-642.884) (-641.859) [-641.994] (-641.597) -- 0:00:22
624000 -- (-639.777) [-641.426] (-640.955) (-639.553) * [-641.017] (-640.850) (-647.135) (-640.565) -- 0:00:22
624500 -- (-639.442) (-641.225) (-642.241) [-639.899] * (-641.217) [-640.831] (-644.507) (-642.915) -- 0:00:22
625000 -- (-639.494) (-641.437) [-640.777] (-640.050) * (-645.043) (-643.001) [-642.149] (-641.559) -- 0:00:22
Average standard deviation of split frequencies: 0.014175
625500 -- (-639.110) (-639.456) (-643.938) [-642.023] * [-639.014] (-640.309) (-640.795) (-640.680) -- 0:00:22
626000 -- (-641.059) (-639.089) [-642.226] (-639.840) * (-639.460) (-642.460) [-642.144] (-641.839) -- 0:00:22
626500 -- (-643.479) (-639.753) (-643.309) [-639.994] * (-640.672) (-640.842) [-640.240] (-643.652) -- 0:00:22
627000 -- (-648.319) (-641.079) (-640.536) [-639.514] * [-640.168] (-640.050) (-640.576) (-640.044) -- 0:00:22
627500 -- [-641.741] (-641.360) (-642.390) (-639.815) * (-640.120) (-641.847) [-641.095] (-643.984) -- 0:00:22
628000 -- [-641.952] (-641.002) (-642.168) (-639.783) * (-642.253) [-641.531] (-640.845) (-644.499) -- 0:00:22
628500 -- (-642.011) (-643.232) [-640.233] (-640.372) * [-640.276] (-640.909) (-640.726) (-643.608) -- 0:00:22
629000 -- (-641.546) (-640.471) [-639.446] (-642.218) * (-641.447) [-641.508] (-641.380) (-643.247) -- 0:00:22
629500 -- (-642.472) [-642.917] (-643.126) (-640.419) * (-640.599) (-640.028) (-639.358) [-642.723] -- 0:00:22
630000 -- [-640.748] (-642.483) (-644.756) (-639.312) * (-641.755) (-641.580) [-640.186] (-639.574) -- 0:00:22
Average standard deviation of split frequencies: 0.014290
630500 -- (-642.462) [-639.882] (-640.300) (-641.207) * [-640.382] (-642.067) (-640.352) (-646.287) -- 0:00:22
631000 -- [-640.111] (-640.510) (-641.048) (-641.283) * [-640.514] (-641.634) (-639.443) (-641.447) -- 0:00:22
631500 -- (-639.216) [-640.958] (-642.442) (-640.868) * (-643.070) (-640.199) (-642.472) [-640.774] -- 0:00:22
632000 -- (-642.841) (-643.340) (-642.584) [-641.054] * (-641.890) (-640.014) (-644.008) [-640.774] -- 0:00:22
632500 -- (-641.137) (-647.718) (-645.988) [-640.671] * (-639.281) [-640.435] (-639.568) (-642.025) -- 0:00:22
633000 -- (-646.010) (-644.359) [-640.816] (-641.005) * [-641.035] (-640.455) (-641.104) (-642.240) -- 0:00:22
633500 -- (-641.084) [-639.668] (-641.856) (-643.514) * (-642.210) (-643.217) (-640.388) [-640.286] -- 0:00:22
634000 -- (-641.294) [-639.678] (-643.465) (-642.825) * (-643.206) (-644.040) [-640.290] (-642.018) -- 0:00:22
634500 -- (-641.892) [-639.160] (-641.121) (-645.619) * (-639.354) (-639.973) [-641.507] (-639.451) -- 0:00:22
635000 -- (-640.863) (-640.568) [-639.521] (-640.390) * [-639.383] (-640.653) (-639.764) (-639.946) -- 0:00:22
Average standard deviation of split frequencies: 0.013821
635500 -- (-640.314) [-643.858] (-643.443) (-645.757) * (-640.795) (-644.410) [-638.981] (-642.602) -- 0:00:22
636000 -- (-642.991) (-642.971) [-639.551] (-645.298) * (-643.067) (-644.226) [-640.090] (-643.869) -- 0:00:22
636500 -- [-640.716] (-643.374) (-641.289) (-641.388) * (-640.813) (-638.810) [-640.836] (-641.599) -- 0:00:22
637000 -- (-642.524) (-644.371) [-641.417] (-639.318) * (-641.102) [-642.559] (-640.450) (-640.166) -- 0:00:22
637500 -- (-640.969) (-640.276) [-640.856] (-639.262) * [-640.736] (-640.511) (-639.190) (-644.067) -- 0:00:22
638000 -- [-640.060] (-639.186) (-640.283) (-640.559) * (-640.035) [-639.940] (-639.513) (-641.462) -- 0:00:22
638500 -- [-640.348] (-640.976) (-641.492) (-648.843) * (-641.750) (-641.562) [-640.418] (-645.177) -- 0:00:22
639000 -- (-641.455) [-639.567] (-642.497) (-641.920) * [-644.976] (-642.359) (-641.635) (-642.745) -- 0:00:22
639500 -- (-640.436) [-639.868] (-639.374) (-646.740) * (-646.015) (-642.788) [-643.260] (-640.573) -- 0:00:21
640000 -- (-643.821) [-643.192] (-640.712) (-639.390) * (-640.538) (-641.502) (-640.674) [-639.612] -- 0:00:21
Average standard deviation of split frequencies: 0.013937
640500 -- (-642.187) (-640.338) (-643.425) [-641.366] * [-639.258] (-640.453) (-641.029) (-640.181) -- 0:00:21
641000 -- (-640.397) [-641.022] (-646.284) (-641.359) * (-639.158) (-639.983) [-639.826] (-639.176) -- 0:00:21
641500 -- (-640.479) [-639.139] (-642.187) (-641.987) * (-642.590) [-642.836] (-639.736) (-639.878) -- 0:00:21
642000 -- (-642.210) [-640.222] (-644.422) (-643.201) * [-641.237] (-643.406) (-639.253) (-642.650) -- 0:00:21
642500 -- (-640.932) [-640.123] (-641.227) (-641.187) * [-641.016] (-641.482) (-644.829) (-639.152) -- 0:00:21
643000 -- (-638.884) [-639.950] (-641.735) (-640.494) * (-641.294) [-645.010] (-642.165) (-641.196) -- 0:00:21
643500 -- (-642.805) [-639.313] (-642.845) (-642.073) * (-641.122) [-644.248] (-640.939) (-640.550) -- 0:00:21
644000 -- (-643.013) (-639.498) [-641.403] (-642.380) * (-641.530) (-642.589) (-642.014) [-642.038] -- 0:00:21
644500 -- (-642.071) (-640.998) [-642.009] (-643.818) * (-640.645) [-642.006] (-647.541) (-639.854) -- 0:00:21
645000 -- [-644.771] (-638.985) (-641.518) (-642.078) * (-641.231) (-643.534) [-642.817] (-641.002) -- 0:00:21
Average standard deviation of split frequencies: 0.013951
645500 -- [-644.164] (-640.746) (-642.062) (-639.451) * (-640.408) (-641.681) (-642.790) [-642.230] -- 0:00:21
646000 -- (-643.229) [-641.763] (-642.078) (-645.110) * (-639.237) (-642.255) [-641.879] (-642.711) -- 0:00:21
646500 -- (-642.258) [-639.920] (-641.080) (-641.028) * (-639.407) [-639.559] (-642.285) (-642.629) -- 0:00:21
647000 -- (-640.827) [-639.474] (-640.834) (-640.449) * (-640.088) (-641.278) (-641.617) [-639.253] -- 0:00:21
647500 -- (-641.727) (-642.242) [-640.378] (-642.231) * [-641.065] (-640.844) (-644.272) (-640.881) -- 0:00:21
648000 -- (-642.336) (-642.378) (-640.029) [-642.155] * [-641.426] (-642.599) (-644.648) (-645.505) -- 0:00:21
648500 -- (-639.404) [-641.602] (-644.588) (-640.535) * [-644.114] (-647.292) (-640.441) (-643.538) -- 0:00:21
649000 -- [-642.827] (-639.609) (-644.083) (-643.294) * (-642.032) (-642.834) [-640.933] (-642.912) -- 0:00:21
649500 -- [-639.573] (-639.584) (-642.083) (-644.134) * (-643.110) [-640.397] (-640.076) (-640.101) -- 0:00:21
650000 -- (-646.135) (-640.779) [-640.792] (-642.161) * (-649.175) [-643.210] (-639.631) (-640.934) -- 0:00:21
Average standard deviation of split frequencies: 0.014490
650500 -- (-643.036) (-642.102) [-640.877] (-642.182) * (-647.889) (-642.917) [-643.441] (-640.799) -- 0:00:21
651000 -- [-642.466] (-640.374) (-645.296) (-640.329) * (-642.361) (-640.424) (-641.261) [-639.469] -- 0:00:21
651500 -- (-640.346) [-644.554] (-642.833) (-640.598) * (-643.359) [-638.880] (-645.188) (-639.430) -- 0:00:21
652000 -- [-639.921] (-645.449) (-643.696) (-640.569) * [-643.837] (-639.165) (-642.292) (-639.972) -- 0:00:21
652500 -- (-642.274) (-641.643) (-640.782) [-639.160] * (-644.235) [-639.317] (-643.471) (-646.663) -- 0:00:21
653000 -- [-642.413] (-641.643) (-642.367) (-640.745) * (-642.258) [-639.435] (-643.645) (-647.446) -- 0:00:21
653500 -- (-640.436) (-640.780) (-639.981) [-640.399] * (-642.149) (-641.351) [-641.912] (-645.744) -- 0:00:21
654000 -- (-640.428) [-639.363] (-641.669) (-640.834) * (-639.208) (-642.488) (-643.775) [-641.317] -- 0:00:21
654500 -- (-641.537) [-642.543] (-642.612) (-641.578) * (-639.264) (-643.948) [-643.655] (-640.079) -- 0:00:21
655000 -- (-643.865) (-641.846) (-640.031) [-639.916] * (-639.611) (-647.815) (-640.145) [-640.177] -- 0:00:21
Average standard deviation of split frequencies: 0.014457
655500 -- [-640.595] (-641.618) (-640.072) (-639.848) * (-641.431) [-640.684] (-640.407) (-643.041) -- 0:00:21
656000 -- [-639.289] (-639.850) (-640.237) (-640.741) * (-646.854) (-643.192) [-641.183] (-642.741) -- 0:00:20
656500 -- (-639.580) (-640.775) (-639.961) [-639.814] * [-641.832] (-639.383) (-640.967) (-639.478) -- 0:00:20
657000 -- (-641.587) (-639.554) [-641.967] (-641.672) * [-642.399] (-643.311) (-643.825) (-639.773) -- 0:00:20
657500 -- (-640.493) (-639.636) [-643.545] (-641.252) * (-640.915) (-640.853) [-642.985] (-643.530) -- 0:00:20
658000 -- (-641.151) (-641.038) (-639.320) [-640.619] * (-640.825) (-640.991) (-639.723) [-643.315] -- 0:00:20
658500 -- (-640.731) (-645.329) [-641.591] (-639.749) * [-642.440] (-643.319) (-643.949) (-639.605) -- 0:00:20
659000 -- (-641.399) (-640.931) (-641.447) [-639.288] * (-640.476) (-644.465) (-641.738) [-639.984] -- 0:00:20
659500 -- [-640.696] (-642.221) (-641.423) (-639.852) * (-639.611) (-644.282) [-639.749] (-640.219) -- 0:00:20
660000 -- (-641.330) (-640.128) (-641.451) [-640.468] * (-638.905) (-642.711) (-640.016) [-640.718] -- 0:00:20
Average standard deviation of split frequencies: 0.014103
660500 -- (-640.889) (-640.413) [-643.849] (-642.910) * [-641.515] (-639.518) (-646.230) (-645.286) -- 0:00:20
661000 -- (-640.681) (-640.649) [-645.781] (-639.953) * (-640.028) (-642.789) [-639.769] (-641.999) -- 0:00:20
661500 -- [-641.624] (-640.449) (-641.032) (-642.293) * (-641.015) (-639.243) [-639.824] (-639.668) -- 0:00:20
662000 -- (-640.039) (-641.604) (-639.219) [-641.784] * [-640.267] (-643.671) (-643.540) (-639.956) -- 0:00:20
662500 -- (-640.564) [-642.636] (-641.269) (-639.879) * (-639.719) [-650.291] (-642.239) (-643.210) -- 0:00:20
663000 -- (-640.272) [-642.989] (-642.726) (-640.761) * (-640.877) [-640.997] (-643.611) (-642.030) -- 0:00:20
663500 -- (-639.454) (-640.570) (-643.847) [-640.616] * (-647.640) (-640.263) [-640.757] (-639.328) -- 0:00:20
664000 -- (-643.562) (-644.567) [-641.296] (-644.232) * (-640.771) (-641.015) (-640.028) [-640.492] -- 0:00:20
664500 -- (-643.972) (-641.800) [-642.408] (-643.364) * (-638.857) (-640.361) [-639.487] (-641.414) -- 0:00:20
665000 -- (-642.337) (-643.203) (-643.461) [-639.544] * (-643.387) (-641.745) [-639.071] (-643.270) -- 0:00:20
Average standard deviation of split frequencies: 0.013823
665500 -- (-642.195) (-646.821) [-640.189] (-646.700) * (-640.579) [-643.293] (-638.945) (-640.620) -- 0:00:20
666000 -- [-639.770] (-643.100) (-643.577) (-644.935) * (-643.006) (-646.715) [-644.631] (-641.773) -- 0:00:20
666500 -- (-641.471) [-640.081] (-641.462) (-642.281) * (-645.717) (-643.099) (-640.479) [-643.238] -- 0:00:20
667000 -- (-639.884) (-642.114) [-640.708] (-643.691) * (-646.302) (-644.077) [-640.137] (-641.830) -- 0:00:20
667500 -- [-640.306] (-643.951) (-642.104) (-640.992) * (-640.840) (-642.795) [-641.396] (-644.650) -- 0:00:20
668000 -- (-640.028) (-644.870) (-644.491) [-641.552] * [-639.802] (-643.078) (-645.253) (-640.438) -- 0:00:20
668500 -- [-641.837] (-639.809) (-641.299) (-640.493) * [-639.548] (-644.151) (-644.707) (-640.400) -- 0:00:20
669000 -- (-642.835) [-639.986] (-642.499) (-641.260) * (-641.070) (-641.446) [-639.502] (-642.193) -- 0:00:20
669500 -- (-648.772) (-641.806) (-641.714) [-640.121] * (-640.602) (-639.062) (-639.974) [-646.731] -- 0:00:20
670000 -- (-644.950) (-640.794) [-641.816] (-641.513) * [-639.526] (-639.515) (-640.496) (-641.002) -- 0:00:20
Average standard deviation of split frequencies: 0.013024
670500 -- (-644.259) (-639.270) (-639.909) [-640.473] * (-639.892) [-640.904] (-644.114) (-640.367) -- 0:00:20
671000 -- [-640.325] (-639.220) (-641.039) (-641.376) * (-641.410) (-644.338) [-641.134] (-642.284) -- 0:00:20
671500 -- [-642.123] (-641.553) (-639.385) (-639.437) * (-640.880) [-642.434] (-639.420) (-641.557) -- 0:00:20
672000 -- (-640.047) (-640.249) [-643.922] (-639.439) * (-640.402) (-643.327) (-640.628) [-642.191] -- 0:00:20
672500 -- (-640.712) [-640.480] (-648.616) (-639.523) * [-641.076] (-639.987) (-640.260) (-641.831) -- 0:00:19
673000 -- (-643.290) (-640.430) (-641.620) [-639.116] * (-639.925) (-640.543) (-640.662) [-643.666] -- 0:00:19
673500 -- (-643.230) (-649.627) (-640.586) [-642.086] * (-641.073) (-639.935) [-641.414] (-644.330) -- 0:00:19
674000 -- (-644.881) (-641.176) [-641.800] (-639.943) * (-640.994) (-642.016) [-640.281] (-642.692) -- 0:00:19
674500 -- (-640.792) [-643.686] (-642.144) (-640.706) * [-639.789] (-640.350) (-644.674) (-642.028) -- 0:00:19
675000 -- [-640.163] (-642.016) (-639.061) (-639.816) * [-641.013] (-639.909) (-641.218) (-640.590) -- 0:00:19
Average standard deviation of split frequencies: 0.012429
675500 -- (-640.030) (-642.171) [-641.565] (-645.733) * (-639.716) [-641.062] (-640.029) (-645.725) -- 0:00:19
676000 -- (-641.795) (-642.997) [-639.617] (-642.563) * [-639.406] (-639.522) (-640.390) (-647.189) -- 0:00:19
676500 -- (-642.946) [-640.356] (-639.725) (-639.966) * (-642.485) (-641.341) [-640.519] (-644.450) -- 0:00:19
677000 -- (-641.706) [-640.256] (-640.105) (-643.078) * (-646.767) [-641.402] (-639.985) (-640.957) -- 0:00:19
677500 -- [-639.746] (-640.543) (-641.351) (-639.631) * (-640.839) [-640.419] (-642.111) (-639.451) -- 0:00:19
678000 -- (-641.339) (-644.523) [-641.907] (-641.493) * (-641.078) [-639.538] (-643.864) (-639.451) -- 0:00:19
678500 -- (-643.258) (-643.965) (-640.503) [-641.961] * (-640.614) (-639.260) [-640.932] (-639.824) -- 0:00:19
679000 -- (-640.242) [-640.080] (-642.082) (-640.602) * [-642.052] (-639.260) (-641.839) (-641.584) -- 0:00:19
679500 -- (-641.417) (-643.824) [-643.966] (-644.060) * (-642.009) (-640.635) [-640.279] (-640.755) -- 0:00:19
680000 -- [-644.730] (-640.323) (-639.160) (-643.457) * [-639.895] (-642.369) (-639.524) (-641.395) -- 0:00:19
Average standard deviation of split frequencies: 0.013159
680500 -- (-640.699) (-639.776) (-641.821) [-643.851] * [-639.596] (-642.453) (-640.329) (-641.240) -- 0:00:19
681000 -- (-639.695) (-640.962) (-640.028) [-643.593] * (-640.956) (-642.025) [-641.922] (-641.784) -- 0:00:19
681500 -- (-640.082) [-644.011] (-640.997) (-640.457) * (-641.692) (-640.017) [-642.942] (-639.886) -- 0:00:19
682000 -- [-641.059] (-642.976) (-640.851) (-639.216) * (-643.962) (-640.203) (-641.250) [-640.035] -- 0:00:19
682500 -- (-641.414) (-641.881) [-640.482] (-639.169) * [-639.774] (-642.894) (-640.090) (-640.668) -- 0:00:19
683000 -- (-640.017) (-640.638) (-639.579) [-639.399] * (-639.994) (-639.109) (-642.948) [-639.986] -- 0:00:19
683500 -- (-640.013) (-639.397) [-640.086] (-639.355) * [-641.560] (-641.264) (-640.706) (-640.870) -- 0:00:19
684000 -- (-641.190) (-640.057) [-639.878] (-640.989) * [-644.230] (-642.090) (-643.338) (-642.149) -- 0:00:19
684500 -- (-641.010) (-644.710) (-639.901) [-642.214] * (-640.886) [-640.642] (-641.159) (-642.036) -- 0:00:19
685000 -- (-643.547) (-640.315) (-643.970) [-641.760] * (-644.600) [-642.570] (-641.329) (-640.193) -- 0:00:19
Average standard deviation of split frequencies: 0.012612
685500 -- (-642.115) (-639.731) [-641.385] (-639.353) * (-639.494) (-641.629) [-640.815] (-639.875) -- 0:00:19
686000 -- [-641.610] (-639.473) (-639.864) (-640.444) * [-639.083] (-641.649) (-640.341) (-644.930) -- 0:00:19
686500 -- (-646.997) [-639.650] (-639.159) (-640.907) * [-642.014] (-640.958) (-644.960) (-641.464) -- 0:00:19
687000 -- (-641.525) (-644.715) (-640.047) [-639.798] * (-639.460) [-640.573] (-643.864) (-640.413) -- 0:00:19
687500 -- (-641.044) (-641.271) (-640.932) [-640.214] * (-640.950) (-641.822) (-640.396) [-641.293] -- 0:00:19
688000 -- (-640.094) (-640.210) [-639.744] (-640.144) * [-639.567] (-639.896) (-640.404) (-642.829) -- 0:00:19
688500 -- (-641.801) (-644.413) (-640.951) [-639.931] * (-643.340) (-642.245) (-645.375) [-641.213] -- 0:00:19
689000 -- (-640.204) [-640.281] (-640.699) (-640.342) * [-645.710] (-643.851) (-640.955) (-639.904) -- 0:00:18
689500 -- (-640.896) [-640.689] (-642.338) (-641.906) * (-650.908) (-640.013) [-645.111] (-639.226) -- 0:00:18
690000 -- (-641.402) (-641.062) [-642.626] (-642.237) * [-645.202] (-639.159) (-641.491) (-639.475) -- 0:00:18
Average standard deviation of split frequencies: 0.012808
690500 -- (-641.885) [-639.925] (-639.682) (-641.974) * (-640.399) (-640.250) (-639.327) [-642.040] -- 0:00:18
691000 -- [-641.563] (-639.230) (-640.712) (-642.183) * [-642.461] (-640.556) (-641.295) (-642.277) -- 0:00:18
691500 -- (-640.182) (-639.844) (-640.088) [-639.826] * [-640.722] (-642.247) (-639.863) (-643.874) -- 0:00:18
692000 -- (-640.770) (-640.452) (-642.444) [-640.146] * (-639.384) (-644.147) [-642.808] (-642.330) -- 0:00:18
692500 -- (-639.417) (-646.106) [-639.390] (-639.541) * (-639.109) (-642.287) [-643.314] (-640.197) -- 0:00:18
693000 -- (-643.364) (-644.235) (-639.888) [-642.164] * (-641.430) (-639.723) (-640.543) [-641.376] -- 0:00:18
693500 -- (-642.263) (-642.368) (-640.588) [-640.084] * [-640.470] (-639.643) (-639.286) (-640.267) -- 0:00:18
694000 -- [-644.234] (-639.969) (-641.307) (-640.200) * (-642.618) [-639.062] (-640.731) (-639.518) -- 0:00:18
694500 -- (-640.062) (-641.538) [-640.246] (-639.443) * (-640.290) [-639.386] (-640.315) (-642.251) -- 0:00:18
695000 -- [-640.479] (-641.597) (-642.025) (-640.055) * [-639.543] (-640.577) (-639.253) (-640.217) -- 0:00:18
Average standard deviation of split frequencies: 0.012590
695500 -- [-639.053] (-646.972) (-642.174) (-641.364) * (-641.145) (-640.526) (-641.788) [-639.764] -- 0:00:18
696000 -- (-640.471) [-641.296] (-640.151) (-641.945) * (-641.722) (-642.474) [-639.481] (-645.741) -- 0:00:18
696500 -- (-640.558) (-643.295) [-640.174] (-642.019) * (-639.852) [-641.565] (-640.540) (-640.480) -- 0:00:18
697000 -- [-639.598] (-641.166) (-642.970) (-639.060) * (-643.689) [-642.755] (-642.141) (-638.866) -- 0:00:18
697500 -- (-641.414) (-640.363) (-639.949) [-640.943] * (-640.418) (-640.921) [-640.514] (-641.582) -- 0:00:18
698000 -- (-641.175) (-640.309) (-639.588) [-639.266] * (-640.417) [-644.392] (-643.870) (-642.501) -- 0:00:18
698500 -- (-642.359) (-642.301) (-639.752) [-639.990] * (-640.597) [-641.235] (-641.455) (-641.495) -- 0:00:18
699000 -- (-642.924) (-645.574) (-643.001) [-641.315] * (-640.416) [-641.342] (-640.090) (-640.637) -- 0:00:18
699500 -- (-643.107) (-643.498) (-642.184) [-642.067] * (-642.449) (-645.612) [-640.598] (-640.647) -- 0:00:18
700000 -- (-646.434) (-639.304) (-645.417) [-640.391] * (-647.196) (-644.431) (-645.051) [-640.846] -- 0:00:18
Average standard deviation of split frequencies: 0.012269
700500 -- [-643.207] (-640.132) (-643.664) (-641.157) * (-640.409) (-642.168) (-643.926) [-640.687] -- 0:00:18
701000 -- (-644.504) [-641.143] (-640.907) (-640.035) * (-643.269) [-639.560] (-642.315) (-640.494) -- 0:00:18
701500 -- (-640.200) (-640.503) (-642.520) [-640.903] * [-639.358] (-643.369) (-646.129) (-639.536) -- 0:00:18
702000 -- [-641.385] (-642.796) (-640.235) (-641.473) * [-642.895] (-640.812) (-639.366) (-639.500) -- 0:00:18
702500 -- (-639.253) [-640.768] (-642.007) (-640.661) * (-642.573) (-643.497) (-640.735) [-640.393] -- 0:00:18
703000 -- (-639.553) (-644.887) (-641.331) [-642.965] * (-639.870) (-645.072) (-643.215) [-640.978] -- 0:00:18
703500 -- (-641.208) (-642.469) [-639.977] (-644.248) * (-639.901) [-639.987] (-640.776) (-640.992) -- 0:00:18
704000 -- [-641.471] (-643.943) (-643.649) (-645.377) * [-639.226] (-640.353) (-644.631) (-640.124) -- 0:00:18
704500 -- (-640.019) [-643.695] (-644.096) (-642.912) * (-639.485) (-640.523) [-641.528] (-640.074) -- 0:00:18
705000 -- [-639.222] (-641.197) (-640.293) (-640.481) * (-643.069) (-640.439) (-645.663) [-642.766] -- 0:00:17
Average standard deviation of split frequencies: 0.011833
705500 -- (-640.219) (-639.941) (-641.022) [-639.159] * (-641.895) (-643.118) (-639.627) [-641.300] -- 0:00:17
706000 -- (-644.528) (-641.749) (-641.601) [-639.226] * [-640.055] (-641.409) (-640.978) (-640.167) -- 0:00:17
706500 -- (-640.760) (-643.798) [-640.056] (-640.344) * (-640.465) [-640.879] (-641.576) (-640.019) -- 0:00:17
707000 -- (-642.016) [-642.422] (-642.206) (-640.546) * (-640.422) (-639.799) (-641.046) [-639.027] -- 0:00:17
707500 -- (-642.078) [-639.597] (-640.771) (-639.409) * [-643.360] (-640.303) (-642.475) (-640.678) -- 0:00:17
708000 -- (-642.995) [-639.049] (-643.318) (-639.549) * [-642.983] (-647.358) (-639.488) (-640.331) -- 0:00:17
708500 -- (-642.796) [-641.417] (-641.636) (-642.226) * (-641.460) (-644.993) (-640.362) [-639.727] -- 0:00:17
709000 -- (-643.823) (-643.667) (-639.464) [-640.991] * [-640.927] (-640.393) (-640.608) (-643.501) -- 0:00:17
709500 -- (-644.534) (-639.643) (-645.554) [-639.288] * [-641.480] (-638.918) (-639.133) (-640.645) -- 0:00:17
710000 -- (-640.809) (-640.170) [-642.114] (-639.998) * (-645.138) [-638.990] (-639.558) (-642.714) -- 0:00:17
Average standard deviation of split frequencies: 0.011940
710500 -- (-640.542) (-640.903) (-640.466) [-641.609] * (-643.236) [-640.902] (-646.102) (-643.384) -- 0:00:17
711000 -- (-643.073) (-640.953) (-640.121) [-640.315] * [-641.454] (-640.570) (-644.671) (-639.576) -- 0:00:17
711500 -- (-640.562) [-640.054] (-639.592) (-641.730) * [-639.208] (-643.207) (-640.589) (-640.558) -- 0:00:17
712000 -- (-639.645) (-641.045) (-639.041) [-641.060] * (-639.630) (-642.313) [-641.326] (-641.363) -- 0:00:17
712500 -- (-640.487) (-641.866) (-640.676) [-644.117] * (-640.572) (-642.821) (-642.209) [-639.655] -- 0:00:17
713000 -- [-639.829] (-642.922) (-641.951) (-643.697) * (-641.933) [-642.720] (-639.962) (-644.090) -- 0:00:17
713500 -- (-640.436) (-641.091) [-642.405] (-639.706) * (-641.084) (-642.807) [-641.176] (-640.600) -- 0:00:17
714000 -- (-640.783) (-641.885) (-642.847) [-641.064] * (-646.369) (-647.342) (-641.828) [-640.422] -- 0:00:17
714500 -- (-639.383) [-640.738] (-647.202) (-639.857) * (-640.361) (-642.826) (-642.486) [-639.879] -- 0:00:17
715000 -- [-641.552] (-640.455) (-641.583) (-639.481) * (-639.882) [-641.526] (-646.479) (-640.336) -- 0:00:17
Average standard deviation of split frequencies: 0.011851
715500 -- [-644.708] (-643.084) (-639.856) (-638.875) * (-640.016) (-640.221) (-641.622) [-642.876] -- 0:00:17
716000 -- (-640.718) (-643.806) [-642.128] (-640.866) * [-640.099] (-640.861) (-640.428) (-645.616) -- 0:00:17
716500 -- [-642.156] (-642.494) (-641.070) (-640.043) * (-641.246) (-642.858) (-643.893) [-642.719] -- 0:00:17
717000 -- (-642.415) (-640.954) (-645.148) [-640.776] * (-639.734) (-640.219) (-643.057) [-640.149] -- 0:00:17
717500 -- [-641.369] (-640.139) (-643.857) (-642.001) * (-639.586) (-643.050) [-642.903] (-645.885) -- 0:00:17
718000 -- (-641.091) (-638.745) [-641.617] (-640.788) * (-640.130) [-640.605] (-640.829) (-641.020) -- 0:00:17
718500 -- (-638.957) [-640.294] (-639.437) (-640.668) * (-641.944) (-641.946) [-641.558] (-639.265) -- 0:00:17
719000 -- (-642.857) (-643.523) [-640.780] (-640.515) * (-641.720) (-639.412) [-640.270] (-641.576) -- 0:00:17
719500 -- [-639.649] (-639.454) (-641.571) (-639.547) * (-643.186) [-640.818] (-640.391) (-640.470) -- 0:00:17
720000 -- (-643.327) (-639.483) [-643.681] (-639.495) * (-639.491) [-640.312] (-639.757) (-641.886) -- 0:00:17
Average standard deviation of split frequencies: 0.011582
720500 -- (-641.679) (-641.320) (-643.099) [-639.316] * [-640.398] (-642.260) (-639.802) (-641.400) -- 0:00:17
721000 -- (-643.301) (-640.241) (-642.761) [-640.539] * (-639.913) (-639.884) (-640.676) [-640.666] -- 0:00:17
721500 -- (-643.609) (-640.299) [-639.564] (-640.865) * (-649.225) (-639.872) (-640.968) [-641.056] -- 0:00:16
722000 -- (-644.943) (-641.064) [-640.806] (-640.493) * (-643.356) [-639.741] (-640.205) (-640.400) -- 0:00:16
722500 -- (-639.380) [-642.241] (-640.986) (-641.841) * (-642.386) [-640.360] (-642.451) (-640.014) -- 0:00:16
723000 -- [-639.913] (-642.983) (-642.627) (-643.987) * (-644.738) (-639.571) [-641.745] (-640.664) -- 0:00:16
723500 -- [-642.160] (-642.513) (-642.549) (-642.737) * (-641.666) (-639.775) [-644.547] (-640.673) -- 0:00:16
724000 -- (-639.673) [-641.132] (-644.652) (-649.334) * (-640.242) [-639.951] (-646.858) (-643.125) -- 0:00:16
724500 -- [-641.809] (-641.724) (-643.811) (-642.484) * (-643.415) (-641.049) [-639.727] (-646.228) -- 0:00:16
725000 -- [-639.368] (-641.694) (-645.711) (-643.140) * (-642.533) (-639.740) (-641.658) [-641.057] -- 0:00:16
Average standard deviation of split frequencies: 0.011000
725500 -- (-640.696) (-641.548) (-639.999) [-642.782] * (-647.870) (-644.243) [-641.252] (-639.747) -- 0:00:16
726000 -- (-642.428) (-643.402) (-642.276) [-644.219] * (-644.709) (-654.522) [-640.869] (-641.793) -- 0:00:16
726500 -- (-642.544) (-640.501) [-640.518] (-641.760) * (-645.732) [-641.740] (-639.975) (-640.690) -- 0:00:16
727000 -- (-643.219) (-642.921) (-641.253) [-639.073] * (-640.939) (-641.254) [-641.658] (-639.898) -- 0:00:16
727500 -- (-639.408) (-639.703) (-641.930) [-639.886] * (-641.881) (-642.783) (-639.640) [-643.623] -- 0:00:16
728000 -- (-640.941) (-639.396) (-645.932) [-640.871] * (-641.196) (-639.732) [-639.848] (-639.498) -- 0:00:16
728500 -- (-640.972) (-642.011) (-640.907) [-641.499] * (-648.358) [-640.439] (-641.294) (-644.291) -- 0:00:16
729000 -- (-639.846) (-643.359) [-642.824] (-641.066) * (-641.423) [-639.553] (-639.320) (-643.982) -- 0:00:16
729500 -- (-642.783) (-644.597) [-641.496] (-639.812) * [-640.873] (-641.782) (-641.917) (-639.725) -- 0:00:16
730000 -- (-642.234) [-641.639] (-642.033) (-644.277) * [-641.818] (-640.948) (-643.147) (-640.209) -- 0:00:16
Average standard deviation of split frequencies: 0.010968
730500 -- (-639.610) (-641.844) (-644.751) [-642.817] * (-642.221) (-640.513) (-640.558) [-640.644] -- 0:00:16
731000 -- (-638.775) [-640.305] (-642.330) (-640.377) * [-640.585] (-641.153) (-641.059) (-647.384) -- 0:00:16
731500 -- [-638.760] (-643.492) (-640.539) (-644.883) * [-639.567] (-640.665) (-641.448) (-643.851) -- 0:00:16
732000 -- [-639.548] (-640.267) (-640.227) (-652.743) * (-647.150) (-641.129) [-640.129] (-640.623) -- 0:00:16
732500 -- (-640.082) [-640.477] (-643.541) (-647.048) * [-641.482] (-646.510) (-640.480) (-639.379) -- 0:00:16
733000 -- (-639.548) [-642.054] (-649.496) (-643.245) * (-640.810) (-645.821) (-641.863) [-640.166] -- 0:00:16
733500 -- [-639.632] (-642.325) (-644.408) (-639.122) * (-640.266) (-640.652) (-639.159) [-639.336] -- 0:00:16
734000 -- [-643.730] (-642.618) (-641.604) (-641.625) * [-639.496] (-639.779) (-639.425) (-639.921) -- 0:00:16
734500 -- (-641.940) (-640.147) (-640.673) [-640.281] * (-639.428) [-639.373] (-639.311) (-641.678) -- 0:00:16
735000 -- [-642.620] (-639.875) (-644.390) (-639.450) * [-639.460] (-640.613) (-639.556) (-640.256) -- 0:00:16
Average standard deviation of split frequencies: 0.010662
735500 -- (-643.468) [-641.077] (-644.026) (-643.354) * (-642.914) (-644.579) (-640.956) [-640.965] -- 0:00:16
736000 -- (-639.494) (-639.554) [-640.127] (-641.484) * (-642.211) (-644.769) [-642.490] (-641.618) -- 0:00:16
736500 -- (-641.561) [-642.232] (-640.209) (-642.632) * (-645.151) (-644.008) [-642.822] (-641.556) -- 0:00:16
737000 -- (-639.721) (-643.649) (-640.047) [-641.165] * [-642.458] (-647.670) (-644.754) (-641.202) -- 0:00:16
737500 -- (-640.387) (-640.877) [-639.466] (-640.204) * (-640.945) (-643.767) (-641.253) [-640.903] -- 0:00:16
738000 -- [-640.279] (-644.224) (-640.604) (-643.915) * (-645.309) (-640.290) (-640.535) [-642.453] -- 0:00:15
738500 -- (-643.118) (-640.173) (-642.304) [-644.098] * (-640.475) (-640.389) [-642.330] (-640.119) -- 0:00:15
739000 -- (-639.947) [-639.978] (-641.119) (-640.477) * (-641.246) [-640.587] (-641.803) (-641.903) -- 0:00:15
739500 -- [-640.172] (-641.133) (-643.184) (-639.505) * (-644.478) (-643.750) [-640.129] (-641.216) -- 0:00:15
740000 -- (-640.649) (-641.221) [-642.075] (-640.453) * (-640.885) [-640.752] (-640.667) (-640.323) -- 0:00:15
Average standard deviation of split frequencies: 0.010408
740500 -- (-639.920) [-640.616] (-641.576) (-639.233) * (-640.334) [-641.483] (-640.848) (-643.406) -- 0:00:15
741000 -- [-641.562] (-640.806) (-639.910) (-641.254) * (-642.394) (-639.183) [-640.959] (-641.835) -- 0:00:15
741500 -- (-641.076) (-639.425) (-643.576) [-640.543] * [-643.314] (-639.277) (-645.885) (-643.671) -- 0:00:15
742000 -- (-640.828) (-642.225) (-640.280) [-640.121] * (-640.335) [-639.684] (-642.256) (-639.264) -- 0:00:15
742500 -- (-646.001) (-644.861) (-640.306) [-642.552] * (-639.004) (-640.031) [-641.235] (-640.511) -- 0:00:15
743000 -- (-641.950) [-642.827] (-639.907) (-639.780) * (-640.372) (-640.815) (-639.626) [-645.280] -- 0:00:15
743500 -- (-644.694) (-643.434) [-644.528] (-639.873) * (-646.788) (-639.839) (-640.920) [-642.377] -- 0:00:15
744000 -- [-642.056] (-641.561) (-640.857) (-640.723) * (-641.496) (-645.707) (-639.875) [-642.859] -- 0:00:15
744500 -- (-640.942) (-640.614) (-641.236) [-639.060] * [-643.811] (-642.053) (-643.274) (-641.656) -- 0:00:15
745000 -- (-643.326) (-640.498) [-641.180] (-643.270) * (-642.337) (-643.130) [-642.491] (-642.936) -- 0:00:15
Average standard deviation of split frequencies: 0.010519
745500 -- (-644.883) (-641.164) [-640.800] (-639.092) * (-639.697) [-642.689] (-642.490) (-643.299) -- 0:00:15
746000 -- (-639.040) [-641.765] (-642.052) (-639.731) * (-641.874) [-640.155] (-640.709) (-640.952) -- 0:00:15
746500 -- [-639.402] (-643.500) (-640.644) (-640.286) * (-640.574) (-642.053) (-639.915) [-641.904] -- 0:00:15
747000 -- [-639.538] (-641.296) (-640.523) (-640.488) * [-640.116] (-640.768) (-644.323) (-643.609) -- 0:00:15
747500 -- [-639.733] (-646.568) (-642.645) (-642.199) * (-639.554) (-640.329) [-640.921] (-639.931) -- 0:00:15
748000 -- [-640.514] (-645.896) (-644.177) (-641.857) * (-639.738) (-639.753) (-639.642) [-646.025] -- 0:00:15
748500 -- (-642.751) (-639.906) [-642.183] (-645.222) * (-640.079) [-639.124] (-639.329) (-641.180) -- 0:00:15
749000 -- (-642.222) [-640.383] (-643.584) (-641.291) * (-641.167) [-638.952] (-642.560) (-639.398) -- 0:00:15
749500 -- (-642.130) (-643.023) (-643.791) [-639.937] * (-639.742) (-640.121) [-642.276] (-640.991) -- 0:00:15
750000 -- (-639.966) [-641.877] (-641.693) (-640.143) * [-640.379] (-641.266) (-640.781) (-642.091) -- 0:00:15
Average standard deviation of split frequencies: 0.010528
750500 -- (-645.213) (-640.693) (-639.294) [-641.046] * (-640.415) (-642.822) [-639.738] (-641.950) -- 0:00:15
751000 -- (-644.989) [-642.158] (-642.056) (-642.105) * [-639.146] (-644.037) (-641.307) (-641.444) -- 0:00:15
751500 -- (-643.801) (-641.317) (-640.222) [-640.750] * (-639.525) (-642.602) (-640.791) [-639.515] -- 0:00:15
752000 -- (-645.622) (-643.303) (-640.372) [-641.864] * (-641.649) (-642.397) [-639.426] (-640.447) -- 0:00:15
752500 -- (-639.267) (-641.581) (-641.339) [-644.348] * [-640.636] (-639.866) (-640.712) (-641.751) -- 0:00:15
753000 -- (-639.479) (-640.301) [-647.831] (-641.560) * [-642.224] (-640.132) (-640.454) (-639.875) -- 0:00:15
753500 -- (-639.783) [-640.694] (-641.390) (-643.940) * (-643.882) (-640.990) (-639.583) [-641.448] -- 0:00:15
754000 -- (-641.474) (-641.442) [-641.233] (-640.490) * (-639.992) [-640.663] (-640.343) (-643.473) -- 0:00:15
754500 -- [-643.352] (-639.479) (-640.781) (-640.208) * [-640.728] (-639.838) (-644.357) (-639.391) -- 0:00:14
755000 -- (-639.776) [-639.494] (-642.531) (-640.695) * [-641.436] (-641.603) (-641.188) (-643.107) -- 0:00:14
Average standard deviation of split frequencies: 0.010234
755500 -- (-642.015) (-639.095) [-639.867] (-640.166) * (-644.723) [-640.391] (-643.882) (-640.636) -- 0:00:14
756000 -- (-640.251) [-639.416] (-641.296) (-643.232) * [-639.583] (-639.764) (-642.711) (-642.358) -- 0:00:14
756500 -- (-642.347) (-641.861) (-640.744) [-639.706] * (-640.665) [-640.663] (-647.206) (-642.991) -- 0:00:14
757000 -- (-642.131) (-641.293) [-642.804] (-639.717) * (-639.916) (-639.035) (-643.054) [-640.214] -- 0:00:14
757500 -- (-644.654) (-641.337) (-642.331) [-641.766] * (-640.299) [-640.881] (-644.992) (-642.646) -- 0:00:14
758000 -- (-644.922) [-639.781] (-643.333) (-641.781) * (-639.688) [-641.418] (-641.919) (-642.524) -- 0:00:14
758500 -- [-641.061] (-641.782) (-644.547) (-642.641) * (-640.484) (-641.596) (-641.933) [-641.630] -- 0:00:14
759000 -- (-640.019) (-641.265) [-642.274] (-639.563) * (-640.230) (-643.280) (-641.589) [-640.682] -- 0:00:14
759500 -- (-640.591) (-643.002) (-642.081) [-641.714] * (-639.439) (-643.423) [-641.406] (-640.713) -- 0:00:14
760000 -- (-641.338) (-640.754) (-641.453) [-640.615] * [-642.722] (-644.164) (-640.601) (-639.254) -- 0:00:14
Average standard deviation of split frequencies: 0.010462
760500 -- [-641.126] (-641.412) (-642.972) (-641.355) * (-644.690) [-639.568] (-641.684) (-639.633) -- 0:00:14
761000 -- (-641.096) (-646.241) (-640.517) [-641.574] * (-646.527) (-640.922) [-641.351] (-639.457) -- 0:00:14
761500 -- (-641.686) [-641.774] (-640.522) (-644.584) * (-641.267) [-643.533] (-642.211) (-641.297) -- 0:00:14
762000 -- (-641.745) (-640.334) [-640.539] (-640.290) * [-641.314] (-643.721) (-648.935) (-641.934) -- 0:00:14
762500 -- (-641.746) (-642.168) (-640.516) [-641.740] * (-642.939) [-642.290] (-642.715) (-641.457) -- 0:00:14
763000 -- (-643.497) (-640.769) (-640.623) [-643.512] * [-640.229] (-643.150) (-639.842) (-642.747) -- 0:00:14
763500 -- (-639.852) (-641.473) (-645.001) [-640.228] * [-640.251] (-641.296) (-639.246) (-640.344) -- 0:00:14
764000 -- (-640.340) (-640.512) (-643.295) [-639.138] * (-641.453) (-644.474) [-640.231] (-644.099) -- 0:00:14
764500 -- [-639.706] (-643.010) (-643.049) (-639.956) * (-639.966) [-639.781] (-639.451) (-639.457) -- 0:00:14
765000 -- [-640.670] (-642.585) (-640.682) (-642.725) * (-640.153) (-642.460) [-639.872] (-641.125) -- 0:00:14
Average standard deviation of split frequencies: 0.010353
765500 -- (-641.140) (-641.543) (-644.806) [-639.693] * (-644.689) (-643.372) (-640.630) [-642.323] -- 0:00:14
766000 -- (-641.628) (-640.662) [-642.594] (-642.529) * [-640.584] (-639.703) (-641.426) (-642.380) -- 0:00:14
766500 -- (-639.508) [-640.574] (-641.579) (-641.980) * (-639.057) [-640.168] (-640.942) (-645.385) -- 0:00:14
767000 -- [-638.744] (-642.408) (-642.505) (-642.671) * (-640.284) (-643.275) [-640.618] (-647.470) -- 0:00:14
767500 -- [-638.737] (-640.444) (-641.518) (-643.060) * (-645.878) (-641.244) (-639.693) [-640.825] -- 0:00:14
768000 -- (-638.811) (-644.704) (-640.374) [-640.175] * (-646.841) (-640.648) (-640.441) [-641.306] -- 0:00:14
768500 -- [-644.308] (-648.884) (-640.136) (-643.165) * [-640.025] (-642.556) (-640.979) (-640.304) -- 0:00:14
769000 -- (-639.821) (-644.241) (-651.479) [-643.389] * (-639.635) (-642.606) [-639.655] (-639.648) -- 0:00:14
769500 -- (-644.589) [-639.905] (-642.774) (-639.465) * (-642.179) [-643.414] (-642.579) (-638.793) -- 0:00:14
770000 -- (-642.276) (-642.810) (-640.172) [-641.716] * (-639.775) (-646.828) [-641.019] (-642.936) -- 0:00:14
Average standard deviation of split frequencies: 0.010003
770500 -- (-641.816) (-639.607) [-644.987] (-640.419) * (-640.226) [-643.266] (-640.981) (-642.521) -- 0:00:13
771000 -- (-641.524) [-638.821] (-641.526) (-640.104) * (-639.393) [-641.060] (-648.085) (-642.734) -- 0:00:13
771500 -- (-644.254) [-646.626] (-646.843) (-644.120) * [-640.051] (-640.535) (-642.423) (-640.363) -- 0:00:13
772000 -- (-639.780) [-641.340] (-639.416) (-641.884) * (-639.999) (-641.413) (-646.708) [-639.374] -- 0:00:13
772500 -- (-640.413) [-641.071] (-640.255) (-639.039) * [-641.028] (-642.606) (-640.430) (-638.841) -- 0:00:13
773000 -- (-639.087) (-639.533) [-643.405] (-639.971) * [-640.614] (-640.602) (-641.586) (-643.750) -- 0:00:13
773500 -- (-639.361) [-640.104] (-643.152) (-640.457) * (-642.725) [-639.488] (-643.507) (-641.879) -- 0:00:13
774000 -- [-640.857] (-639.364) (-640.519) (-641.678) * (-640.347) (-639.342) [-642.766] (-641.197) -- 0:00:13
774500 -- (-641.369) (-640.251) [-639.884] (-641.303) * [-644.461] (-640.907) (-641.936) (-640.289) -- 0:00:13
775000 -- [-641.799] (-641.061) (-640.990) (-643.167) * (-640.117) (-639.463) [-640.240] (-640.182) -- 0:00:13
Average standard deviation of split frequencies: 0.009302
775500 -- [-641.589] (-645.613) (-642.827) (-640.201) * (-641.972) (-641.586) [-641.389] (-640.155) -- 0:00:13
776000 -- [-639.785] (-643.422) (-640.363) (-639.875) * (-643.669) [-642.177] (-642.734) (-641.390) -- 0:00:13
776500 -- (-641.664) (-645.987) [-643.211] (-644.022) * [-639.712] (-639.627) (-642.747) (-640.033) -- 0:00:13
777000 -- (-640.549) [-640.820] (-641.075) (-645.692) * (-641.543) [-639.626] (-640.702) (-642.732) -- 0:00:13
777500 -- [-644.009] (-642.670) (-642.174) (-641.142) * [-641.230] (-639.199) (-644.234) (-644.236) -- 0:00:13
778000 -- (-639.434) (-640.587) [-641.909] (-642.599) * (-640.984) (-641.875) [-642.939] (-642.655) -- 0:00:13
778500 -- (-639.901) (-642.813) [-640.861] (-639.493) * [-640.406] (-641.500) (-640.075) (-644.759) -- 0:00:13
779000 -- (-640.143) (-644.077) (-639.747) [-639.370] * (-639.788) [-642.632] (-640.217) (-640.662) -- 0:00:13
779500 -- (-647.920) [-644.029] (-643.447) (-640.499) * (-641.968) (-642.340) [-640.149] (-639.159) -- 0:00:13
780000 -- (-648.296) (-640.366) [-644.952] (-641.448) * (-640.801) [-640.604] (-639.618) (-640.812) -- 0:00:13
Average standard deviation of split frequencies: 0.008856
780500 -- [-640.957] (-641.241) (-640.145) (-641.092) * (-641.133) [-639.597] (-643.243) (-644.651) -- 0:00:13
781000 -- [-640.284] (-641.778) (-639.570) (-639.396) * (-641.264) (-639.823) [-640.609] (-640.447) -- 0:00:13
781500 -- (-641.601) (-639.082) (-640.475) [-639.335] * [-641.194] (-639.213) (-640.690) (-640.062) -- 0:00:13
782000 -- [-641.622] (-645.125) (-639.554) (-644.273) * (-639.614) (-641.280) (-642.067) [-641.740] -- 0:00:13
782500 -- [-642.249] (-640.750) (-641.907) (-642.585) * (-639.704) (-640.555) (-641.627) [-640.515] -- 0:00:13
783000 -- [-640.962] (-641.343) (-639.307) (-640.513) * (-642.750) (-639.948) (-643.914) [-638.866] -- 0:00:13
783500 -- [-640.619] (-641.419) (-643.001) (-647.201) * (-640.615) (-641.760) [-640.143] (-640.392) -- 0:00:13
784000 -- (-639.882) [-641.125] (-640.690) (-642.956) * (-639.833) (-639.850) (-642.561) [-643.353] -- 0:00:13
784500 -- (-639.848) (-642.871) [-640.019] (-640.824) * [-640.412] (-644.180) (-645.239) (-640.002) -- 0:00:13
785000 -- (-640.909) (-639.716) [-645.357] (-644.123) * (-640.774) [-644.645] (-642.139) (-642.065) -- 0:00:13
Average standard deviation of split frequencies: 0.009702
785500 -- (-639.421) [-640.218] (-642.249) (-641.021) * (-643.049) (-642.320) (-639.925) [-640.090] -- 0:00:13
786000 -- [-639.747] (-642.091) (-641.607) (-643.444) * (-642.065) (-639.327) [-641.716] (-640.297) -- 0:00:13
786500 -- [-640.135] (-641.727) (-640.786) (-640.498) * (-642.170) (-640.748) [-642.078] (-647.051) -- 0:00:13
787000 -- [-641.190] (-640.573) (-641.143) (-646.264) * (-642.040) [-640.526] (-640.959) (-643.775) -- 0:00:12
787500 -- (-642.402) (-641.536) [-641.726] (-644.510) * [-639.401] (-642.547) (-642.976) (-643.306) -- 0:00:12
788000 -- (-642.518) (-641.278) [-639.999] (-643.317) * (-643.639) (-639.934) [-643.115] (-642.657) -- 0:00:12
788500 -- (-640.631) [-640.039] (-640.481) (-641.220) * [-640.166] (-642.578) (-641.505) (-641.186) -- 0:00:12
789000 -- (-643.829) [-640.760] (-641.240) (-647.580) * [-640.484] (-642.837) (-639.570) (-641.320) -- 0:00:12
789500 -- [-639.309] (-641.350) (-642.473) (-642.388) * (-639.524) [-639.888] (-641.381) (-643.695) -- 0:00:12
790000 -- (-639.235) (-640.669) [-641.873] (-641.529) * (-641.425) [-640.675] (-640.753) (-642.776) -- 0:00:12
Average standard deviation of split frequencies: 0.009614
790500 -- [-641.321] (-639.854) (-642.173) (-643.389) * (-639.936) (-641.162) (-640.349) [-641.611] -- 0:00:12
791000 -- [-639.622] (-639.975) (-640.321) (-639.499) * (-642.423) (-642.458) (-639.885) [-639.261] -- 0:00:12
791500 -- (-639.642) (-642.972) (-639.798) [-642.320] * (-643.090) (-640.335) [-641.302] (-639.353) -- 0:00:12
792000 -- (-640.742) [-641.997] (-640.505) (-640.425) * (-645.970) (-640.187) [-640.606] (-640.727) -- 0:00:12
792500 -- (-640.389) (-639.547) [-640.887] (-641.901) * (-641.511) (-639.699) [-640.219] (-640.525) -- 0:00:12
793000 -- (-640.349) (-642.538) (-643.889) [-640.417] * [-641.155] (-643.527) (-642.370) (-643.087) -- 0:00:12
793500 -- (-643.565) (-643.977) [-640.714] (-641.122) * (-639.587) [-643.457] (-641.507) (-645.820) -- 0:00:12
794000 -- (-643.346) [-640.930] (-644.913) (-638.984) * (-640.014) (-641.412) [-644.544] (-640.861) -- 0:00:12
794500 -- [-640.376] (-639.025) (-643.957) (-640.334) * (-639.633) (-642.146) [-639.873] (-643.287) -- 0:00:12
795000 -- (-639.371) (-645.308) (-643.749) [-640.032] * (-640.838) (-640.174) (-642.811) [-642.580] -- 0:00:12
Average standard deviation of split frequencies: 0.009994
795500 -- [-641.403] (-640.428) (-641.709) (-640.980) * (-640.921) [-643.188] (-644.922) (-640.580) -- 0:00:12
796000 -- [-641.469] (-643.255) (-642.759) (-644.394) * (-640.759) (-639.463) [-642.281] (-641.377) -- 0:00:12
796500 -- (-641.464) [-641.109] (-644.935) (-643.464) * [-640.836] (-639.346) (-640.365) (-641.037) -- 0:00:12
797000 -- (-638.878) [-640.035] (-640.027) (-643.234) * (-638.931) (-640.415) [-640.397] (-639.705) -- 0:00:12
797500 -- [-639.681] (-640.868) (-640.186) (-642.296) * [-639.196] (-643.877) (-642.296) (-641.249) -- 0:00:12
798000 -- (-641.016) [-642.951] (-639.439) (-640.415) * (-642.357) (-640.153) [-641.952] (-640.920) -- 0:00:12
798500 -- [-641.876] (-647.184) (-639.429) (-640.416) * (-639.004) (-639.710) [-643.448] (-639.697) -- 0:00:12
799000 -- (-640.309) [-640.075] (-639.117) (-640.101) * (-641.595) (-639.602) (-642.160) [-640.242] -- 0:00:12
799500 -- (-640.598) (-639.262) (-642.749) [-641.494] * [-644.798] (-639.859) (-643.018) (-643.426) -- 0:00:12
800000 -- (-641.815) [-639.814] (-641.368) (-640.500) * (-639.362) [-640.351] (-639.540) (-644.525) -- 0:00:12
Average standard deviation of split frequencies: 0.009695
800500 -- (-642.640) [-641.601] (-639.271) (-643.871) * (-640.253) [-639.941] (-640.198) (-640.028) -- 0:00:12
801000 -- (-639.448) (-640.600) [-640.020] (-643.488) * [-641.976] (-643.846) (-640.118) (-639.632) -- 0:00:12
801500 -- [-643.634] (-639.865) (-639.799) (-645.751) * (-644.853) (-642.834) (-640.293) [-639.524] -- 0:00:12
802000 -- (-639.099) [-641.202] (-639.911) (-653.198) * (-641.712) [-641.623] (-641.081) (-640.861) -- 0:00:12
802500 -- (-641.947) [-641.428] (-639.319) (-640.894) * (-642.069) (-640.098) (-640.580) [-641.377] -- 0:00:12
803000 -- (-644.103) [-640.633] (-638.888) (-639.576) * (-640.033) (-642.325) [-641.176] (-640.527) -- 0:00:12
803500 -- [-639.451] (-639.793) (-642.778) (-640.276) * [-642.026] (-638.966) (-640.537) (-639.696) -- 0:00:11
804000 -- [-640.464] (-640.947) (-639.198) (-643.235) * (-639.310) [-640.768] (-639.711) (-643.968) -- 0:00:11
804500 -- (-641.035) (-640.611) [-639.117] (-643.430) * [-642.889] (-640.301) (-640.734) (-642.147) -- 0:00:11
805000 -- (-642.109) (-650.137) (-643.079) [-642.360] * [-640.639] (-640.440) (-640.644) (-642.603) -- 0:00:11
Average standard deviation of split frequencies: 0.009436
805500 -- (-642.625) [-644.039] (-642.693) (-639.197) * [-640.023] (-641.984) (-640.564) (-646.358) -- 0:00:11
806000 -- [-640.048] (-646.733) (-642.463) (-639.210) * [-639.486] (-642.604) (-643.372) (-640.347) -- 0:00:11
806500 -- (-642.546) [-642.300] (-642.204) (-644.779) * (-641.341) (-642.837) (-643.368) [-641.984] -- 0:00:11
807000 -- (-644.646) (-639.847) (-643.271) [-641.166] * (-640.192) (-643.736) (-641.451) [-641.500] -- 0:00:11
807500 -- (-642.525) [-639.651] (-644.007) (-642.463) * [-638.907] (-639.130) (-639.421) (-639.574) -- 0:00:11
808000 -- (-639.940) (-639.031) (-642.874) [-640.024] * (-641.076) (-640.393) (-642.851) [-639.789] -- 0:00:11
808500 -- (-639.423) (-640.186) [-640.692] (-645.856) * (-642.436) (-640.634) (-641.389) [-643.178] -- 0:00:11
809000 -- (-640.258) (-638.904) [-641.344] (-645.475) * (-641.573) (-640.356) [-641.587] (-640.247) -- 0:00:11
809500 -- (-644.137) (-639.015) (-641.516) [-645.622] * (-641.363) (-639.338) [-641.719] (-642.189) -- 0:00:11
810000 -- (-641.564) (-639.847) [-641.402] (-643.560) * [-640.196] (-643.028) (-644.094) (-640.910) -- 0:00:11
Average standard deviation of split frequencies: 0.009265
810500 -- (-643.680) (-644.243) (-639.768) [-644.178] * (-641.534) (-646.121) (-642.644) [-640.034] -- 0:00:11
811000 -- [-639.719] (-641.935) (-641.573) (-644.505) * (-640.166) (-647.073) [-641.615] (-639.392) -- 0:00:11
811500 -- [-640.809] (-643.293) (-641.127) (-641.973) * (-642.046) (-641.007) (-641.935) [-642.077] -- 0:00:11
812000 -- [-639.902] (-642.776) (-641.179) (-641.164) * (-642.063) [-639.636] (-640.868) (-641.607) -- 0:00:11
812500 -- [-640.872] (-639.688) (-644.841) (-642.383) * (-640.069) (-640.135) [-639.943] (-640.372) -- 0:00:11
813000 -- (-641.231) [-640.731] (-642.625) (-645.703) * [-640.093] (-639.147) (-644.490) (-641.316) -- 0:00:11
813500 -- (-640.648) (-638.999) [-645.959] (-642.125) * (-640.000) (-640.991) [-640.532] (-643.514) -- 0:00:11
814000 -- (-639.387) (-642.212) (-648.819) [-641.174] * (-640.034) (-643.418) [-641.156] (-641.633) -- 0:00:11
814500 -- (-644.554) (-642.243) (-645.726) [-640.142] * (-640.306) (-647.331) [-642.521] (-641.303) -- 0:00:11
815000 -- (-641.428) [-639.766] (-640.995) (-643.869) * (-640.443) (-641.902) (-641.678) [-641.756] -- 0:00:11
Average standard deviation of split frequencies: 0.008897
815500 -- [-645.247] (-640.417) (-643.843) (-641.773) * (-640.344) (-641.431) (-641.815) [-640.144] -- 0:00:11
816000 -- [-642.656] (-639.070) (-648.687) (-643.912) * (-639.501) (-641.270) (-645.913) [-640.435] -- 0:00:11
816500 -- (-641.666) [-639.548] (-644.849) (-645.429) * (-641.235) [-641.270] (-645.849) (-640.958) -- 0:00:11
817000 -- (-641.603) [-639.448] (-640.780) (-642.304) * (-640.668) (-642.213) (-647.576) [-640.410] -- 0:00:11
817500 -- [-641.098] (-640.257) (-639.695) (-643.810) * (-640.113) [-642.529] (-645.440) (-641.388) -- 0:00:11
818000 -- (-643.980) (-642.834) [-640.687] (-641.765) * [-641.697] (-641.719) (-642.540) (-644.474) -- 0:00:11
818500 -- (-644.555) [-639.923] (-643.437) (-642.975) * (-640.879) (-638.997) (-641.549) [-639.633] -- 0:00:11
819000 -- (-641.435) [-640.085] (-644.987) (-641.344) * [-640.298] (-638.988) (-645.392) (-640.540) -- 0:00:11
819500 -- (-643.612) [-643.246] (-640.760) (-640.513) * (-644.731) [-640.038] (-643.694) (-641.886) -- 0:00:11
820000 -- (-640.368) [-642.060] (-640.861) (-642.496) * (-640.159) (-642.905) [-640.263] (-639.155) -- 0:00:10
Average standard deviation of split frequencies: 0.008884
820500 -- [-640.598] (-641.522) (-639.201) (-641.649) * (-640.284) (-640.893) [-644.391] (-643.218) -- 0:00:10
821000 -- (-640.645) (-643.650) (-643.437) [-643.474] * [-641.506] (-642.763) (-639.270) (-643.702) -- 0:00:10
821500 -- (-641.549) (-642.333) (-642.428) [-643.689] * (-640.676) (-639.569) [-639.336] (-647.459) -- 0:00:10
822000 -- (-639.699) (-642.603) (-641.219) [-643.539] * (-643.333) (-644.351) [-640.793] (-645.577) -- 0:00:10
822500 -- (-641.934) (-642.325) (-640.532) [-639.851] * (-643.352) (-640.940) (-641.023) [-641.246] -- 0:00:10
823000 -- (-643.186) (-640.789) [-640.800] (-639.840) * [-641.871] (-641.899) (-641.193) (-641.360) -- 0:00:10
823500 -- (-643.712) [-642.374] (-641.864) (-642.701) * (-640.500) (-640.564) (-641.651) [-641.290] -- 0:00:10
824000 -- (-642.424) (-643.920) [-639.827] (-645.974) * (-644.642) [-644.006] (-647.389) (-640.682) -- 0:00:10
824500 -- (-647.284) (-645.933) [-642.283] (-640.917) * (-641.113) (-643.277) (-641.934) [-641.014] -- 0:00:10
825000 -- [-640.452] (-641.048) (-640.741) (-639.937) * [-641.924] (-642.908) (-641.086) (-640.930) -- 0:00:10
Average standard deviation of split frequencies: 0.008637
825500 -- [-640.451] (-644.404) (-640.700) (-640.342) * [-641.298] (-639.777) (-641.358) (-643.959) -- 0:00:10
826000 -- (-640.873) [-640.349] (-639.219) (-639.188) * (-640.764) [-640.735] (-640.320) (-641.160) -- 0:00:10
826500 -- [-642.552] (-640.903) (-639.491) (-640.411) * (-641.402) [-640.729] (-643.632) (-641.227) -- 0:00:10
827000 -- [-642.284] (-642.203) (-639.683) (-639.662) * [-640.299] (-644.029) (-641.018) (-641.662) -- 0:00:10
827500 -- [-640.666] (-644.607) (-640.680) (-639.286) * [-641.396] (-640.914) (-642.721) (-639.870) -- 0:00:10
828000 -- [-640.629] (-640.850) (-639.402) (-641.225) * (-641.472) (-639.378) (-642.118) [-640.843] -- 0:00:10
828500 -- (-641.438) (-639.690) (-641.140) [-639.034] * (-641.486) [-639.792] (-647.880) (-640.346) -- 0:00:10
829000 -- (-642.992) (-641.449) (-640.607) [-641.044] * (-641.184) (-639.792) (-646.083) [-642.569] -- 0:00:10
829500 -- [-639.608] (-642.057) (-643.412) (-640.750) * [-639.877] (-641.593) (-641.730) (-642.474) -- 0:00:10
830000 -- (-640.227) (-641.395) (-641.702) [-640.478] * [-642.201] (-646.314) (-642.196) (-642.688) -- 0:00:10
Average standard deviation of split frequencies: 0.008437
830500 -- (-640.496) (-639.995) (-643.393) [-643.023] * (-641.405) [-646.446] (-640.852) (-643.221) -- 0:00:10
831000 -- (-640.959) [-642.512] (-641.083) (-643.228) * (-640.167) [-645.941] (-641.315) (-644.513) -- 0:00:10
831500 -- (-639.019) (-643.339) (-642.873) [-639.060] * (-640.759) (-641.260) (-640.043) [-641.038] -- 0:00:10
832000 -- [-643.348] (-642.700) (-642.093) (-640.384) * (-639.475) (-642.247) [-641.721] (-642.922) -- 0:00:10
832500 -- (-642.872) (-642.851) (-643.037) [-647.059] * (-639.363) [-639.041] (-648.712) (-649.947) -- 0:00:10
833000 -- (-640.195) [-643.233] (-643.213) (-641.532) * (-639.835) (-639.923) [-640.671] (-639.602) -- 0:00:10
833500 -- (-639.131) (-642.149) (-643.072) [-638.839] * (-639.412) [-642.106] (-640.685) (-640.711) -- 0:00:10
834000 -- (-639.465) [-643.598] (-640.172) (-643.354) * [-639.815] (-646.608) (-641.843) (-642.234) -- 0:00:10
834500 -- [-639.752] (-643.943) (-643.860) (-642.465) * [-643.109] (-641.032) (-641.914) (-640.508) -- 0:00:10
835000 -- (-639.103) (-640.410) (-641.762) [-642.210] * (-641.457) [-641.282] (-641.601) (-640.691) -- 0:00:10
Average standard deviation of split frequencies: 0.008345
835500 -- (-638.762) [-642.989] (-640.887) (-643.039) * (-641.198) (-641.087) [-642.023] (-643.043) -- 0:00:10
836000 -- (-639.588) (-643.590) (-640.914) [-639.631] * (-640.785) (-641.506) [-639.798] (-640.218) -- 0:00:10
836500 -- (-638.847) [-643.712] (-642.876) (-639.941) * [-640.462] (-641.666) (-639.191) (-640.788) -- 0:00:09
837000 -- [-640.650] (-641.333) (-641.345) (-640.164) * (-641.469) [-640.597] (-643.880) (-641.943) -- 0:00:09
837500 -- (-642.082) [-640.886] (-640.542) (-640.309) * [-639.106] (-640.960) (-641.850) (-640.515) -- 0:00:09
838000 -- (-642.472) [-641.784] (-641.870) (-643.408) * (-640.282) (-640.563) (-643.239) [-641.181] -- 0:00:09
838500 -- (-639.895) (-641.276) [-640.187] (-643.437) * [-639.958] (-643.727) (-640.472) (-641.153) -- 0:00:09
839000 -- (-640.605) (-642.488) (-641.649) [-640.977] * (-640.942) (-642.485) (-641.753) [-643.144] -- 0:00:09
839500 -- (-641.847) [-640.143] (-646.569) (-639.976) * (-640.206) (-639.843) [-641.965] (-642.608) -- 0:00:09
840000 -- (-639.905) (-640.224) [-642.523] (-639.550) * (-641.626) (-639.236) (-642.094) [-641.683] -- 0:00:09
Average standard deviation of split frequencies: 0.008785
840500 -- (-640.218) (-643.337) (-642.890) [-639.084] * (-644.671) [-640.364] (-644.880) (-641.152) -- 0:00:09
841000 -- (-640.259) (-640.980) [-641.172] (-642.742) * (-640.488) (-641.976) [-639.685] (-639.362) -- 0:00:09
841500 -- (-643.154) [-639.737] (-640.487) (-641.699) * (-639.210) (-643.270) (-639.554) [-643.377] -- 0:00:09
842000 -- [-642.423] (-641.595) (-640.487) (-639.963) * [-640.547] (-641.144) (-642.658) (-642.996) -- 0:00:09
842500 -- (-640.836) (-640.366) (-642.575) [-640.887] * (-641.627) [-640.520] (-641.343) (-640.971) -- 0:00:09
843000 -- (-643.502) (-640.122) [-641.562] (-639.981) * (-640.760) (-640.940) [-640.130] (-644.051) -- 0:00:09
843500 -- [-642.531] (-640.115) (-645.997) (-641.718) * (-641.384) (-642.602) [-642.168] (-641.291) -- 0:00:09
844000 -- (-642.474) [-640.230] (-641.576) (-641.634) * (-641.012) (-640.088) [-640.336] (-640.402) -- 0:00:09
844500 -- [-640.714] (-641.257) (-641.356) (-643.124) * (-641.182) [-640.896] (-642.706) (-641.270) -- 0:00:09
845000 -- (-645.187) [-640.826] (-641.859) (-640.309) * (-640.520) (-640.360) (-647.100) [-640.901] -- 0:00:09
Average standard deviation of split frequencies: 0.008841
845500 -- (-646.946) [-641.869] (-641.437) (-640.750) * (-641.342) [-641.039] (-644.153) (-642.400) -- 0:00:09
846000 -- (-643.113) (-641.072) (-640.781) [-639.529] * [-640.490] (-640.524) (-641.629) (-643.751) -- 0:00:09
846500 -- (-641.926) (-642.237) [-640.155] (-639.730) * (-640.292) [-639.897] (-641.286) (-639.732) -- 0:00:09
847000 -- (-641.487) [-642.191] (-641.808) (-640.555) * (-641.433) (-639.030) (-644.612) [-640.096] -- 0:00:09
847500 -- [-642.628] (-641.201) (-640.672) (-640.278) * (-645.877) (-638.888) (-640.177) [-639.683] -- 0:00:09
848000 -- (-642.400) (-643.263) [-641.439] (-640.531) * (-643.759) (-640.923) [-639.426] (-641.939) -- 0:00:09
848500 -- [-641.801] (-640.586) (-644.293) (-641.621) * [-641.352] (-639.984) (-639.497) (-646.359) -- 0:00:09
849000 -- (-642.284) (-641.990) (-644.340) [-639.846] * (-640.146) (-639.939) (-639.774) [-640.807] -- 0:00:09
849500 -- [-640.865] (-639.347) (-640.732) (-639.076) * (-644.705) (-640.828) [-641.168] (-642.288) -- 0:00:09
850000 -- (-640.308) (-641.131) (-640.873) [-639.705] * [-640.414] (-643.569) (-639.910) (-641.275) -- 0:00:09
Average standard deviation of split frequencies: 0.008571
850500 -- [-639.468] (-640.985) (-641.272) (-639.869) * (-640.230) (-640.980) [-639.847] (-643.127) -- 0:00:09
851000 -- (-641.072) (-642.233) [-640.503] (-640.911) * (-642.675) (-640.736) (-646.073) [-641.355] -- 0:00:09
851500 -- (-639.592) (-646.775) [-640.527] (-639.743) * (-641.270) [-641.512] (-641.276) (-641.008) -- 0:00:09
852000 -- (-639.931) (-645.415) (-640.290) [-641.399] * (-639.560) (-640.179) (-641.748) [-640.182] -- 0:00:09
852500 -- (-642.199) (-643.517) [-644.639] (-642.349) * (-638.900) [-640.774] (-646.580) (-642.875) -- 0:00:08
853000 -- (-641.082) [-639.760] (-642.653) (-640.693) * (-642.512) (-639.720) (-642.491) [-640.564] -- 0:00:08
853500 -- (-639.444) (-644.251) (-639.720) [-642.543] * (-639.849) (-641.296) [-642.651] (-640.050) -- 0:00:08
854000 -- (-641.163) (-649.790) (-645.104) [-640.756] * (-640.264) (-642.221) (-642.999) [-640.397] -- 0:00:08
854500 -- (-644.758) (-640.617) [-639.562] (-639.557) * (-646.619) (-643.387) [-641.567] (-640.490) -- 0:00:08
855000 -- [-640.833] (-642.982) (-640.210) (-640.372) * (-639.315) [-644.409] (-642.217) (-645.268) -- 0:00:08
Average standard deviation of split frequencies: 0.008518
855500 -- (-642.233) [-639.588] (-642.828) (-642.889) * (-640.560) (-643.141) [-642.228] (-643.026) -- 0:00:08
856000 -- (-639.647) (-641.741) (-641.120) [-639.641] * (-640.717) [-640.792] (-642.069) (-639.080) -- 0:00:08
856500 -- (-639.508) [-642.398] (-643.144) (-641.325) * [-641.138] (-643.845) (-640.167) (-640.671) -- 0:00:08
857000 -- (-638.932) (-642.741) (-641.055) [-643.363] * (-641.000) (-641.345) (-640.652) [-639.740] -- 0:00:08
857500 -- (-642.751) [-643.254] (-639.897) (-641.557) * (-640.774) (-641.503) (-642.175) [-640.858] -- 0:00:08
858000 -- (-640.148) (-641.721) (-639.828) [-644.416] * (-639.687) [-641.163] (-639.863) (-642.050) -- 0:00:08
858500 -- (-643.356) (-647.304) [-641.955] (-639.902) * (-640.770) (-643.210) (-641.626) [-641.241] -- 0:00:08
859000 -- (-640.666) (-641.541) (-643.225) [-641.101] * (-640.737) [-640.043] (-641.208) (-642.407) -- 0:00:08
859500 -- (-638.853) (-640.393) (-640.194) [-642.877] * [-642.209] (-639.525) (-641.967) (-642.619) -- 0:00:08
860000 -- (-641.979) [-643.642] (-641.170) (-644.734) * (-639.949) [-639.364] (-640.796) (-641.495) -- 0:00:08
Average standard deviation of split frequencies: 0.008690
860500 -- (-643.613) (-648.100) (-640.488) [-644.321] * (-640.685) [-639.564] (-643.017) (-639.325) -- 0:00:08
861000 -- (-640.647) (-643.235) (-643.177) [-643.266] * (-640.984) (-640.902) [-646.044] (-640.852) -- 0:00:08
861500 -- [-643.208] (-641.816) (-638.795) (-640.526) * [-639.886] (-641.523) (-645.594) (-645.622) -- 0:00:08
862000 -- (-640.713) [-640.910] (-639.637) (-641.448) * [-641.137] (-645.212) (-642.014) (-645.462) -- 0:00:08
862500 -- (-641.404) (-641.231) [-639.219] (-638.951) * (-647.675) (-639.269) (-644.476) [-640.788] -- 0:00:08
863000 -- [-639.679] (-644.063) (-640.609) (-638.973) * (-641.867) (-645.000) [-640.019] (-641.317) -- 0:00:08
863500 -- (-642.382) (-643.750) (-642.401) [-639.670] * (-639.489) (-645.609) (-642.003) [-640.276] -- 0:00:08
864000 -- (-643.406) [-643.135] (-640.768) (-641.232) * [-640.035] (-645.880) (-641.839) (-644.530) -- 0:00:08
864500 -- (-643.985) (-642.046) (-641.543) [-639.732] * (-640.518) [-639.307] (-644.642) (-643.149) -- 0:00:08
865000 -- (-642.004) (-642.315) [-642.188] (-641.618) * [-640.511] (-641.725) (-643.115) (-644.294) -- 0:00:08
Average standard deviation of split frequencies: 0.008419
865500 -- [-641.089] (-646.440) (-645.974) (-642.712) * (-640.790) [-641.698] (-640.967) (-640.086) -- 0:00:08
866000 -- [-639.147] (-644.115) (-644.572) (-641.281) * (-641.941) (-640.154) [-640.473] (-645.231) -- 0:00:08
866500 -- [-639.241] (-641.260) (-639.770) (-645.840) * (-639.651) [-641.090] (-640.285) (-642.152) -- 0:00:08
867000 -- (-643.159) [-642.476] (-639.683) (-639.462) * (-642.228) (-640.166) [-640.405] (-641.220) -- 0:00:08
867500 -- (-642.497) (-645.894) (-641.329) [-641.628] * (-643.382) [-641.733] (-642.076) (-638.895) -- 0:00:08
868000 -- [-641.255] (-642.492) (-641.027) (-640.812) * (-641.880) [-642.541] (-641.022) (-641.441) -- 0:00:08
868500 -- (-641.088) (-643.592) [-639.496] (-639.700) * (-642.523) (-639.650) (-641.440) [-645.241] -- 0:00:08
869000 -- (-643.205) [-642.575] (-641.138) (-641.004) * (-640.395) (-640.664) (-641.193) [-644.044] -- 0:00:07
869500 -- (-642.893) (-639.478) [-643.599] (-641.041) * [-639.797] (-643.556) (-639.637) (-640.656) -- 0:00:07
870000 -- [-641.111] (-644.076) (-643.266) (-639.741) * (-639.679) (-641.969) [-640.137] (-643.036) -- 0:00:07
Average standard deviation of split frequencies: 0.008735
870500 -- (-643.563) (-643.218) [-640.037] (-639.623) * [-643.200] (-640.877) (-642.526) (-642.055) -- 0:00:07
871000 -- (-640.973) [-640.928] (-641.811) (-643.067) * (-643.019) (-642.124) (-645.267) [-641.840] -- 0:00:07
871500 -- (-646.225) (-642.665) [-641.215] (-641.992) * (-640.350) (-640.397) (-640.768) [-641.828] -- 0:00:07
872000 -- (-640.840) [-641.245] (-646.405) (-640.907) * (-640.841) [-640.000] (-647.809) (-640.843) -- 0:00:07
872500 -- (-640.600) (-645.288) [-640.556] (-640.728) * (-644.034) [-639.776] (-641.162) (-640.657) -- 0:00:07
873000 -- (-642.429) [-640.357] (-641.590) (-640.265) * [-640.277] (-639.526) (-640.859) (-641.367) -- 0:00:07
873500 -- (-640.595) [-640.898] (-640.345) (-641.232) * (-644.836) [-639.040] (-642.809) (-639.883) -- 0:00:07
874000 -- (-642.243) (-640.058) [-640.728] (-641.646) * (-639.580) (-641.650) [-642.217] (-640.375) -- 0:00:07
874500 -- (-640.355) (-641.113) (-640.025) [-640.210] * (-640.898) [-640.558] (-641.597) (-639.690) -- 0:00:07
875000 -- (-640.199) (-642.244) [-642.761] (-642.547) * (-639.034) (-641.892) [-641.333] (-648.733) -- 0:00:07
Average standard deviation of split frequencies: 0.008790
875500 -- (-640.971) [-640.869] (-640.199) (-640.550) * (-639.049) (-641.329) (-640.075) [-641.855] -- 0:00:07
876000 -- (-645.326) (-640.216) [-641.379] (-641.952) * (-639.536) [-640.702] (-641.727) (-639.408) -- 0:00:07
876500 -- [-645.682] (-640.556) (-640.503) (-640.148) * (-640.178) (-642.191) (-640.644) [-641.270] -- 0:00:07
877000 -- (-640.117) [-639.603] (-639.438) (-641.923) * [-639.757] (-641.217) (-639.410) (-642.515) -- 0:00:07
877500 -- (-640.187) (-641.391) (-639.853) [-640.752] * (-641.075) [-642.294] (-640.055) (-642.101) -- 0:00:07
878000 -- (-640.949) [-640.208] (-641.803) (-642.164) * (-641.116) (-643.823) (-640.327) [-642.151] -- 0:00:07
878500 -- (-641.117) (-639.273) [-640.753] (-642.507) * (-643.434) (-642.747) (-639.895) [-640.438] -- 0:00:07
879000 -- (-639.820) (-641.992) [-643.161] (-640.191) * (-642.227) (-642.460) [-639.983] (-639.457) -- 0:00:07
879500 -- (-641.082) (-640.148) [-640.712] (-640.694) * (-640.440) [-640.522] (-641.929) (-639.633) -- 0:00:07
880000 -- (-641.727) (-644.206) [-640.744] (-642.526) * (-643.066) (-642.872) [-640.686] (-641.557) -- 0:00:07
Average standard deviation of split frequencies: 0.008743
880500 -- [-642.073] (-642.436) (-642.024) (-641.782) * (-644.858) [-641.412] (-640.939) (-641.080) -- 0:00:07
881000 -- (-640.927) (-641.637) [-641.696] (-639.355) * (-642.423) [-640.330] (-641.972) (-641.752) -- 0:00:07
881500 -- (-645.818) (-641.292) (-640.292) [-643.726] * [-642.895] (-647.462) (-645.145) (-641.828) -- 0:00:07
882000 -- (-643.179) [-640.905] (-641.632) (-640.597) * [-640.388] (-639.628) (-644.605) (-648.074) -- 0:00:07
882500 -- [-642.305] (-645.048) (-642.127) (-641.561) * (-642.991) [-640.443] (-649.408) (-644.528) -- 0:00:07
883000 -- (-642.021) [-641.685] (-641.654) (-644.776) * [-641.415] (-639.793) (-641.774) (-645.156) -- 0:00:07
883500 -- (-643.071) (-640.943) [-639.994] (-639.703) * [-642.033] (-640.535) (-641.226) (-643.684) -- 0:00:07
884000 -- [-639.413] (-639.768) (-641.010) (-639.088) * (-643.175) (-640.961) (-641.070) [-639.122] -- 0:00:07
884500 -- (-642.467) (-640.917) [-640.733] (-642.009) * (-641.532) (-642.752) [-640.014] (-639.595) -- 0:00:07
885000 -- [-642.658] (-643.747) (-641.341) (-639.116) * (-639.524) (-640.189) [-641.291] (-639.654) -- 0:00:07
Average standard deviation of split frequencies: 0.009080
885500 -- (-642.196) (-642.158) [-640.096] (-640.587) * (-642.041) (-639.509) [-639.517] (-640.309) -- 0:00:06
886000 -- (-642.136) (-643.085) (-643.692) [-640.770] * (-640.237) (-639.607) (-640.114) [-640.144] -- 0:00:06
886500 -- [-640.358] (-644.629) (-640.603) (-642.435) * (-640.639) (-641.263) [-640.718] (-640.644) -- 0:00:06
887000 -- (-638.838) (-643.614) [-639.426] (-641.962) * (-640.344) [-641.529] (-640.489) (-640.397) -- 0:00:06
887500 -- (-639.846) (-643.556) [-641.408] (-640.385) * [-641.229] (-644.133) (-641.841) (-640.732) -- 0:00:06
888000 -- (-640.817) (-644.331) (-642.135) [-640.161] * (-640.989) [-640.370] (-640.530) (-640.777) -- 0:00:06
888500 -- (-641.810) [-641.005] (-640.776) (-639.050) * (-640.167) (-641.352) (-643.099) [-641.032] -- 0:00:06
889000 -- (-640.641) (-643.090) (-640.706) [-640.642] * (-644.711) (-638.911) (-638.985) [-640.712] -- 0:00:06
889500 -- (-644.310) (-642.471) [-639.392] (-644.759) * (-642.123) (-641.073) [-640.024] (-640.781) -- 0:00:06
890000 -- (-640.253) (-643.428) [-639.531] (-642.905) * (-641.400) (-641.722) (-640.739) [-639.150] -- 0:00:06
Average standard deviation of split frequencies: 0.008892
890500 -- [-641.027] (-644.499) (-639.749) (-641.767) * (-643.687) (-641.767) (-639.467) [-639.605] -- 0:00:06
891000 -- (-641.687) (-644.227) [-638.796] (-641.075) * (-643.030) [-640.536] (-640.309) (-643.332) -- 0:00:06
891500 -- [-642.454] (-641.388) (-640.388) (-641.452) * [-639.042] (-643.197) (-641.455) (-640.171) -- 0:00:06
892000 -- [-642.625] (-640.278) (-642.886) (-641.833) * (-639.656) (-639.144) [-641.135] (-650.933) -- 0:00:06
892500 -- (-641.209) (-640.377) (-641.587) [-639.331] * [-640.834] (-640.654) (-640.858) (-645.471) -- 0:00:06
893000 -- (-641.264) (-642.016) (-641.772) [-638.956] * [-639.412] (-644.025) (-640.824) (-641.381) -- 0:00:06
893500 -- (-642.189) (-640.867) [-640.781] (-639.012) * (-640.252) [-640.485] (-641.481) (-639.647) -- 0:00:06
894000 -- (-641.773) (-641.401) [-641.990] (-643.633) * (-641.220) (-643.485) [-639.933] (-640.725) -- 0:00:06
894500 -- (-639.977) [-640.040] (-644.835) (-645.572) * (-642.980) [-640.757] (-643.873) (-640.507) -- 0:00:06
895000 -- (-640.088) [-639.242] (-645.336) (-643.111) * [-642.803] (-639.477) (-639.489) (-640.063) -- 0:00:06
Average standard deviation of split frequencies: 0.008839
895500 -- (-639.579) [-640.114] (-641.940) (-641.922) * (-640.833) (-640.729) [-640.575] (-643.592) -- 0:00:06
896000 -- (-640.177) (-644.075) [-640.038] (-645.446) * (-642.221) (-641.356) (-639.113) [-641.032] -- 0:00:06
896500 -- (-640.968) [-640.467] (-640.941) (-642.714) * [-642.343] (-644.085) (-641.076) (-639.021) -- 0:00:06
897000 -- [-640.913] (-641.467) (-643.303) (-639.577) * (-641.723) [-641.635] (-639.992) (-642.979) -- 0:00:06
897500 -- (-641.642) [-643.790] (-643.202) (-639.586) * [-639.366] (-642.096) (-642.508) (-639.771) -- 0:00:06
898000 -- (-641.347) (-639.563) [-639.154] (-640.548) * [-640.563] (-640.425) (-643.259) (-644.541) -- 0:00:06
898500 -- (-639.289) [-643.176] (-640.459) (-640.546) * [-640.101] (-641.808) (-641.388) (-642.581) -- 0:00:06
899000 -- (-642.255) (-642.303) [-639.941] (-640.099) * (-644.685) [-641.494] (-640.513) (-642.970) -- 0:00:06
899500 -- [-639.960] (-642.216) (-643.440) (-641.664) * (-638.741) [-640.508] (-643.614) (-640.537) -- 0:00:06
900000 -- (-639.261) (-643.551) [-640.860] (-641.925) * (-639.193) [-640.566] (-642.093) (-640.326) -- 0:00:06
Average standard deviation of split frequencies: 0.009107
900500 -- (-642.570) (-639.787) [-639.822] (-642.349) * (-639.302) [-640.022] (-643.001) (-642.976) -- 0:00:06
901000 -- (-641.041) (-639.180) [-639.816] (-640.307) * [-642.368] (-640.367) (-643.566) (-643.994) -- 0:00:06
901500 -- (-642.110) [-640.209] (-641.628) (-639.861) * [-642.073] (-639.309) (-643.440) (-640.993) -- 0:00:06
902000 -- (-644.526) (-641.700) [-640.541] (-639.590) * (-645.312) (-640.053) (-641.673) [-641.003] -- 0:00:05
902500 -- (-643.243) (-643.240) (-639.261) [-638.867] * [-639.936] (-639.409) (-642.616) (-641.682) -- 0:00:05
903000 -- (-640.451) (-641.074) (-642.549) [-639.411] * [-639.898] (-643.187) (-642.580) (-641.308) -- 0:00:05
903500 -- (-639.448) [-643.498] (-641.455) (-641.650) * (-643.781) (-642.148) (-639.561) [-639.481] -- 0:00:05
904000 -- (-640.065) (-644.759) [-641.139] (-641.463) * [-641.563] (-642.473) (-643.843) (-641.523) -- 0:00:05
904500 -- (-640.219) (-646.405) [-639.811] (-642.762) * (-642.432) (-640.925) (-642.716) [-642.364] -- 0:00:05
905000 -- (-640.573) [-640.986] (-639.950) (-639.716) * [-641.374] (-640.925) (-639.774) (-644.103) -- 0:00:05
Average standard deviation of split frequencies: 0.009088
905500 -- (-639.633) (-640.418) [-642.502] (-640.030) * (-641.881) (-640.058) [-640.820] (-640.626) -- 0:00:05
906000 -- (-642.044) (-640.417) (-645.961) [-639.951] * [-639.839] (-641.203) (-641.668) (-641.195) -- 0:00:05
906500 -- (-643.397) (-640.035) (-642.735) [-639.379] * (-639.135) (-639.994) (-645.202) [-640.170] -- 0:00:05
907000 -- [-648.981] (-642.814) (-642.276) (-640.783) * (-639.557) (-639.886) [-642.006] (-643.067) -- 0:00:05
907500 -- (-639.741) [-638.913] (-642.209) (-639.587) * (-642.929) [-640.772] (-640.668) (-643.916) -- 0:00:05
908000 -- (-640.291) (-639.228) [-639.757] (-643.545) * (-640.631) (-642.928) (-639.944) [-644.413] -- 0:00:05
908500 -- (-640.918) (-642.343) [-640.069] (-642.763) * (-643.099) (-640.362) [-640.293] (-643.266) -- 0:00:05
909000 -- (-641.759) (-643.901) [-640.791] (-640.911) * (-644.761) [-639.396] (-643.182) (-642.771) -- 0:00:05
909500 -- (-639.314) (-645.995) (-644.232) [-639.790] * (-642.421) [-639.743] (-644.278) (-642.685) -- 0:00:05
910000 -- (-639.120) [-644.112] (-642.712) (-640.433) * (-640.301) [-642.011] (-641.710) (-641.411) -- 0:00:05
Average standard deviation of split frequencies: 0.009387
910500 -- [-639.965] (-641.874) (-642.176) (-641.414) * (-641.657) (-639.682) (-641.946) [-641.175] -- 0:00:05
911000 -- (-640.123) (-639.247) (-643.791) [-640.790] * (-644.985) [-642.403] (-641.845) (-644.988) -- 0:00:05
911500 -- (-640.776) (-647.514) (-644.057) [-640.711] * (-640.849) (-641.269) (-648.002) [-639.760] -- 0:00:05
912000 -- (-640.642) [-640.380] (-644.262) (-642.190) * [-642.242] (-646.622) (-639.800) (-639.634) -- 0:00:05
912500 -- (-642.633) (-639.390) [-641.792] (-645.659) * (-640.484) (-641.923) (-639.076) [-641.246] -- 0:00:05
913000 -- (-641.177) (-639.609) [-640.151] (-644.406) * [-642.565] (-641.189) (-640.332) (-643.584) -- 0:00:05
913500 -- (-639.451) [-641.377] (-645.943) (-640.337) * (-640.988) (-643.417) (-641.748) [-639.823] -- 0:00:05
914000 -- [-644.935] (-640.607) (-646.840) (-639.616) * (-639.861) [-640.411] (-642.127) (-643.205) -- 0:00:05
914500 -- [-643.724] (-645.985) (-646.295) (-641.014) * [-641.200] (-640.519) (-641.614) (-642.714) -- 0:00:05
915000 -- (-644.596) (-643.970) (-641.270) [-641.131] * (-640.925) (-640.034) (-644.290) [-639.107] -- 0:00:05
Average standard deviation of split frequencies: 0.009709
915500 -- (-642.161) (-639.720) [-640.030] (-641.787) * (-642.531) (-640.801) (-642.655) [-640.881] -- 0:00:05
916000 -- [-642.062] (-641.694) (-639.752) (-639.586) * (-639.361) (-642.602) (-643.768) [-639.268] -- 0:00:05
916500 -- (-644.424) (-642.245) (-639.166) [-645.122] * (-639.205) (-644.448) [-641.602] (-640.691) -- 0:00:05
917000 -- (-640.425) (-641.122) [-638.986] (-640.181) * (-639.114) (-640.556) [-643.328] (-639.939) -- 0:00:05
917500 -- [-640.065] (-642.555) (-643.157) (-642.653) * (-643.710) (-640.528) (-646.107) [-640.448] -- 0:00:05
918000 -- (-640.285) [-640.320] (-641.698) (-641.104) * (-641.567) [-640.685] (-642.628) (-642.123) -- 0:00:05
918500 -- [-639.894] (-640.411) (-639.281) (-643.533) * [-640.929] (-643.782) (-642.825) (-644.516) -- 0:00:04
919000 -- (-640.547) [-640.440] (-640.230) (-642.236) * [-642.734] (-639.157) (-639.237) (-641.406) -- 0:00:04
919500 -- (-640.533) (-642.614) [-639.528] (-639.239) * [-641.847] (-639.454) (-639.256) (-640.566) -- 0:00:04
920000 -- [-639.839] (-644.870) (-641.544) (-642.134) * (-642.721) [-640.831] (-639.802) (-640.249) -- 0:00:04
Average standard deviation of split frequencies: 0.009592
920500 -- (-641.692) (-639.333) [-642.169] (-642.920) * (-640.734) [-639.666] (-639.684) (-642.605) -- 0:00:04
921000 -- (-641.923) (-641.539) (-642.237) [-643.035] * (-641.191) (-640.799) [-641.744] (-640.168) -- 0:00:04
921500 -- [-640.544] (-640.963) (-639.428) (-641.634) * [-640.817] (-640.657) (-639.391) (-644.542) -- 0:00:04
922000 -- (-640.797) (-643.753) [-641.116] (-639.653) * (-645.092) [-645.469] (-645.274) (-643.726) -- 0:00:04
922500 -- [-639.368] (-640.334) (-646.118) (-639.624) * (-639.376) (-641.301) [-639.984] (-640.919) -- 0:00:04
923000 -- [-641.418] (-639.041) (-641.094) (-640.632) * [-639.348] (-643.360) (-642.688) (-641.374) -- 0:00:04
923500 -- [-646.151] (-639.941) (-640.398) (-639.361) * (-638.878) (-641.467) (-640.435) [-639.234] -- 0:00:04
924000 -- (-643.872) (-643.133) (-640.411) [-640.358] * (-641.595) (-640.547) [-639.414] (-644.511) -- 0:00:04
924500 -- (-642.683) (-650.245) [-640.537] (-639.963) * (-641.634) [-642.047] (-640.610) (-643.838) -- 0:00:04
925000 -- [-639.886] (-642.034) (-640.240) (-640.188) * (-640.365) (-645.968) (-640.652) [-643.257] -- 0:00:04
Average standard deviation of split frequencies: 0.009571
925500 -- (-640.823) (-641.523) [-641.046] (-642.378) * (-640.283) (-644.721) (-640.398) [-644.943] -- 0:00:04
926000 -- [-640.527] (-642.302) (-642.315) (-642.006) * (-640.100) (-640.612) [-639.188] (-642.412) -- 0:00:04
926500 -- (-643.599) (-643.085) [-639.511] (-643.478) * (-639.379) (-640.598) (-640.007) [-639.637] -- 0:00:04
927000 -- (-647.921) [-640.592] (-640.507) (-642.238) * (-640.840) (-639.656) (-641.180) [-641.419] -- 0:00:04
927500 -- (-641.549) (-638.804) (-639.558) [-641.256] * (-647.428) (-641.592) [-640.381] (-639.590) -- 0:00:04
928000 -- [-642.008] (-640.274) (-640.965) (-639.617) * [-641.807] (-641.347) (-641.686) (-641.576) -- 0:00:04
928500 -- [-641.989] (-640.315) (-642.116) (-639.995) * [-641.079] (-642.444) (-641.107) (-640.108) -- 0:00:04
929000 -- (-642.781) (-639.116) (-645.015) [-639.744] * (-641.995) (-640.998) (-642.200) [-641.359] -- 0:00:04
929500 -- [-639.743] (-639.321) (-642.112) (-640.940) * (-640.100) (-639.368) (-641.442) [-641.270] -- 0:00:04
930000 -- (-644.845) [-639.561] (-641.698) (-642.484) * (-640.322) (-643.692) (-643.591) [-640.958] -- 0:00:04
Average standard deviation of split frequencies: 0.009455
930500 -- (-640.953) (-642.858) (-639.524) [-640.592] * (-642.932) [-640.512] (-642.247) (-640.480) -- 0:00:04
931000 -- (-639.795) [-645.007] (-641.593) (-639.911) * (-643.497) (-639.494) (-640.823) [-640.907] -- 0:00:04
931500 -- (-641.638) [-641.714] (-644.511) (-641.941) * (-643.902) (-639.559) [-640.710] (-639.082) -- 0:00:04
932000 -- [-644.426] (-639.579) (-643.373) (-642.029) * (-643.057) (-640.286) [-639.619] (-639.399) -- 0:00:04
932500 -- (-639.979) (-644.409) [-644.360] (-641.838) * (-642.060) (-643.283) [-640.204] (-645.193) -- 0:00:04
933000 -- (-639.923) (-639.746) [-640.338] (-640.555) * [-642.975] (-640.916) (-639.250) (-640.486) -- 0:00:04
933500 -- (-639.477) (-642.350) (-644.494) [-640.269] * (-639.260) (-640.178) [-643.202] (-638.950) -- 0:00:04
934000 -- (-639.757) (-645.492) [-642.380] (-642.222) * [-640.088] (-646.636) (-639.476) (-640.474) -- 0:00:04
934500 -- [-640.209] (-641.620) (-641.733) (-639.827) * (-642.663) [-640.286] (-641.183) (-642.066) -- 0:00:03
935000 -- (-639.663) [-639.733] (-642.986) (-641.425) * (-639.841) [-640.727] (-640.034) (-639.402) -- 0:00:03
Average standard deviation of split frequencies: 0.009166
935500 -- (-643.445) (-639.396) [-640.583] (-642.262) * (-639.136) [-641.073] (-640.520) (-645.817) -- 0:00:03
936000 -- (-639.655) (-642.592) (-640.006) [-642.001] * [-640.437] (-639.521) (-641.898) (-640.327) -- 0:00:03
936500 -- [-642.237] (-640.729) (-641.802) (-639.462) * (-639.312) [-639.821] (-641.845) (-643.760) -- 0:00:03
937000 -- (-640.092) [-640.001] (-640.761) (-641.046) * [-642.125] (-639.299) (-644.114) (-642.192) -- 0:00:03
937500 -- (-644.909) (-639.171) (-639.901) [-641.431] * (-643.778) (-638.982) [-642.266] (-644.122) -- 0:00:03
938000 -- (-642.399) (-640.683) (-645.140) [-641.460] * [-642.950] (-639.297) (-641.838) (-642.691) -- 0:00:03
938500 -- (-643.694) (-640.643) (-641.726) [-639.056] * (-641.037) (-642.167) [-642.567] (-641.308) -- 0:00:03
939000 -- [-640.928] (-640.442) (-642.515) (-641.887) * [-642.448] (-642.936) (-640.090) (-639.384) -- 0:00:03
939500 -- [-645.420] (-640.920) (-642.903) (-641.568) * (-639.563) (-640.037) (-639.602) [-639.357] -- 0:00:03
940000 -- (-644.407) (-639.948) [-640.714] (-641.597) * (-642.486) (-639.775) [-640.439] (-641.085) -- 0:00:03
Average standard deviation of split frequencies: 0.009355
940500 -- (-645.468) (-639.943) [-639.864] (-643.932) * (-646.310) (-639.351) (-642.083) [-639.869] -- 0:00:03
941000 -- [-642.131] (-641.216) (-642.689) (-640.604) * (-646.102) [-640.355] (-639.063) (-641.850) -- 0:00:03
941500 -- (-641.152) [-640.332] (-642.530) (-641.277) * (-640.178) [-641.937] (-638.964) (-642.647) -- 0:00:03
942000 -- (-640.853) (-640.140) (-642.523) [-642.235] * (-640.502) (-648.687) (-640.539) [-640.803] -- 0:00:03
942500 -- (-640.079) [-641.869] (-640.515) (-641.103) * [-640.300] (-645.217) (-643.005) (-641.165) -- 0:00:03
943000 -- (-640.917) [-641.611] (-640.347) (-640.054) * (-641.068) (-639.898) [-639.748] (-639.725) -- 0:00:03
943500 -- [-642.391] (-643.070) (-640.361) (-640.531) * (-643.936) (-640.600) [-639.686] (-642.460) -- 0:00:03
944000 -- (-638.875) (-645.503) (-639.782) [-639.008] * (-642.383) (-641.895) (-645.154) [-640.513] -- 0:00:03
944500 -- (-639.934) (-638.799) [-640.000] (-642.761) * (-644.081) (-640.090) (-643.638) [-640.640] -- 0:00:03
945000 -- (-639.879) (-639.831) (-639.240) [-641.057] * (-641.999) (-640.282) (-641.834) [-639.160] -- 0:00:03
Average standard deviation of split frequencies: 0.009667
945500 -- (-639.091) [-640.484] (-643.338) (-641.749) * (-639.785) [-641.921] (-642.107) (-642.108) -- 0:00:03
946000 -- (-646.593) (-644.121) (-643.838) [-640.898] * (-639.427) [-642.644] (-640.630) (-639.773) -- 0:00:03
946500 -- (-642.079) (-640.465) (-645.702) [-642.406] * [-639.306] (-640.207) (-641.403) (-639.770) -- 0:00:03
947000 -- (-641.603) [-645.406] (-642.222) (-640.332) * [-640.745] (-640.191) (-643.387) (-641.676) -- 0:00:03
947500 -- [-642.146] (-643.855) (-641.046) (-641.579) * (-642.216) (-639.656) (-643.220) [-641.813] -- 0:00:03
948000 -- (-641.710) (-642.727) (-639.907) [-641.433] * (-641.245) (-640.958) (-640.143) [-640.729] -- 0:00:03
948500 -- (-640.866) (-644.298) [-641.593] (-646.372) * (-641.474) [-639.825] (-639.615) (-639.410) -- 0:00:03
949000 -- (-644.392) (-642.680) [-639.691] (-640.365) * (-639.799) (-641.674) [-641.170] (-638.924) -- 0:00:03
949500 -- (-640.310) (-640.522) (-640.026) [-641.014] * (-645.181) (-643.862) [-640.082] (-641.998) -- 0:00:03
950000 -- [-640.255] (-641.220) (-640.849) (-640.628) * (-640.369) [-643.929] (-641.975) (-640.886) -- 0:00:03
Average standard deviation of split frequencies: 0.009719
950500 -- [-643.365] (-642.637) (-642.444) (-643.073) * (-640.192) (-641.310) [-640.618] (-641.746) -- 0:00:03
951000 -- (-642.572) (-642.862) [-640.462] (-642.555) * (-640.157) (-641.621) (-640.161) [-644.124] -- 0:00:02
951500 -- (-642.404) [-641.186] (-640.723) (-641.730) * (-640.022) (-640.373) [-640.785] (-640.686) -- 0:00:02
952000 -- [-641.746] (-644.973) (-643.343) (-643.026) * (-640.621) (-643.224) [-640.966] (-640.960) -- 0:00:02
952500 -- (-639.924) (-639.945) (-641.640) [-643.841] * (-640.114) [-641.934] (-639.279) (-642.726) -- 0:00:02
953000 -- (-641.115) (-641.505) (-642.436) [-643.074] * (-641.030) (-642.295) (-639.755) [-643.128] -- 0:00:02
953500 -- (-641.311) (-640.440) (-641.607) [-639.664] * (-643.470) (-647.132) (-641.985) [-642.699] -- 0:00:02
954000 -- (-642.011) (-640.953) (-640.701) [-639.427] * (-644.241) (-641.093) (-639.215) [-641.847] -- 0:00:02
954500 -- (-641.564) (-641.648) (-641.749) [-640.124] * (-645.033) [-638.896] (-639.644) (-643.831) -- 0:00:02
955000 -- [-641.620] (-644.393) (-641.485) (-642.704) * (-641.359) [-639.497] (-640.757) (-642.953) -- 0:00:02
Average standard deviation of split frequencies: 0.009698
955500 -- (-640.607) (-642.014) [-641.593] (-643.739) * (-639.231) [-639.649] (-642.251) (-641.030) -- 0:00:02
956000 -- (-641.980) (-641.100) (-645.464) [-642.111] * (-639.807) [-641.164] (-640.189) (-642.583) -- 0:00:02
956500 -- (-642.811) (-640.446) (-639.339) [-641.655] * [-639.917] (-641.186) (-639.765) (-640.378) -- 0:00:02
957000 -- (-641.008) [-640.168] (-639.768) (-642.518) * (-641.227) [-640.265] (-639.963) (-639.838) -- 0:00:02
957500 -- (-640.963) [-643.245] (-638.927) (-643.174) * [-639.908] (-645.964) (-641.983) (-640.095) -- 0:00:02
958000 -- [-643.661] (-642.914) (-641.563) (-642.665) * (-642.618) (-640.331) (-639.824) [-645.908] -- 0:00:02
958500 -- (-642.206) (-643.283) [-642.279] (-640.597) * (-641.957) (-642.031) (-643.561) [-641.530] -- 0:00:02
959000 -- (-643.016) (-640.132) [-640.474] (-645.714) * (-640.320) (-641.527) [-639.774] (-641.520) -- 0:00:02
959500 -- [-639.341] (-640.241) (-642.567) (-640.802) * (-643.394) (-640.069) [-640.073] (-641.331) -- 0:00:02
960000 -- (-644.729) (-639.844) (-641.779) [-639.976] * (-642.620) (-641.598) (-641.288) [-641.052] -- 0:00:02
Average standard deviation of split frequencies: 0.009716
960500 -- (-643.591) (-641.047) [-640.950] (-642.630) * (-644.254) (-641.988) (-641.985) [-641.281] -- 0:00:02
961000 -- (-639.462) [-641.384] (-644.614) (-643.410) * (-644.063) [-642.636] (-640.847) (-640.854) -- 0:00:02
961500 -- [-641.738] (-639.239) (-639.728) (-642.314) * [-642.104] (-639.628) (-641.541) (-642.953) -- 0:00:02
962000 -- (-639.045) (-639.734) [-644.678] (-642.146) * (-639.169) [-639.633] (-645.779) (-640.178) -- 0:00:02
962500 -- [-639.503] (-640.221) (-642.650) (-640.337) * (-639.474) [-639.576] (-641.212) (-639.947) -- 0:00:02
963000 -- [-641.498] (-639.135) (-643.240) (-639.995) * (-639.522) (-640.933) [-639.555] (-639.180) -- 0:00:02
963500 -- (-642.415) (-645.706) [-639.839] (-640.549) * (-640.735) (-640.617) [-639.422] (-640.297) -- 0:00:02
964000 -- (-641.731) [-640.429] (-641.022) (-640.804) * (-640.932) (-641.439) [-639.516] (-642.251) -- 0:00:02
964500 -- (-640.092) [-640.586] (-642.476) (-640.658) * (-641.093) (-642.764) [-639.116] (-646.390) -- 0:00:02
965000 -- [-641.507] (-640.505) (-643.518) (-643.702) * (-640.530) (-643.149) (-638.877) [-640.017] -- 0:00:02
Average standard deviation of split frequencies: 0.009662
965500 -- (-640.420) (-641.438) [-642.066] (-644.989) * (-640.737) (-643.889) [-643.209] (-640.070) -- 0:00:02
966000 -- (-641.699) (-641.060) [-641.938] (-639.389) * (-641.150) (-643.000) (-640.437) [-641.234] -- 0:00:02
966500 -- (-641.474) (-643.819) (-641.490) [-640.203] * (-645.905) (-641.010) [-640.240] (-644.177) -- 0:00:02
967000 -- (-641.938) [-643.233] (-641.426) (-640.071) * (-648.329) (-641.022) [-640.417] (-640.471) -- 0:00:02
967500 -- [-639.752] (-639.959) (-641.324) (-639.673) * [-639.689] (-641.382) (-640.598) (-638.990) -- 0:00:01
968000 -- (-639.711) [-642.436] (-641.149) (-644.158) * (-640.746) (-641.191) [-640.144] (-642.369) -- 0:00:01
968500 -- (-642.003) (-640.325) (-639.814) [-640.235] * (-640.607) (-640.496) (-639.482) [-639.501] -- 0:00:01
969000 -- [-639.317] (-640.897) (-639.956) (-639.274) * (-641.322) (-641.773) [-639.795] (-639.839) -- 0:00:01
969500 -- (-641.533) (-645.812) (-643.533) [-639.859] * (-641.374) (-641.442) [-639.540] (-640.521) -- 0:00:01
970000 -- [-642.240] (-640.171) (-640.910) (-639.959) * (-642.183) [-641.587] (-641.122) (-641.669) -- 0:00:01
Average standard deviation of split frequencies: 0.009583
970500 -- (-640.012) (-640.724) (-639.823) [-639.832] * (-640.407) (-640.109) [-643.511] (-643.570) -- 0:00:01
971000 -- (-645.661) [-640.620] (-639.786) (-646.061) * (-641.256) [-644.368] (-641.251) (-644.137) -- 0:00:01
971500 -- (-639.995) (-640.189) (-641.985) [-643.213] * [-646.920] (-643.890) (-642.622) (-640.160) -- 0:00:01
972000 -- (-644.049) [-639.136] (-643.834) (-641.139) * [-639.207] (-640.745) (-639.464) (-641.561) -- 0:00:01
972500 -- (-639.632) (-645.538) (-642.460) [-641.018] * (-639.169) [-639.704] (-639.818) (-641.099) -- 0:00:01
973000 -- (-642.906) [-639.430] (-639.837) (-642.167) * [-640.078] (-639.723) (-640.456) (-642.543) -- 0:00:01
973500 -- (-640.834) (-640.281) (-642.131) [-643.484] * (-640.109) (-644.004) [-640.148] (-643.271) -- 0:00:01
974000 -- [-640.700] (-639.790) (-641.721) (-640.898) * [-640.306] (-648.062) (-641.188) (-644.390) -- 0:00:01
974500 -- (-640.177) [-644.043] (-645.694) (-640.791) * [-639.544] (-641.349) (-640.913) (-647.073) -- 0:00:01
975000 -- (-641.777) (-640.376) [-641.514] (-639.406) * (-639.540) (-646.192) (-641.000) [-639.910] -- 0:00:01
Average standard deviation of split frequencies: 0.009789
975500 -- (-639.886) [-641.287] (-641.448) (-639.929) * [-639.574] (-641.284) (-640.995) (-639.424) -- 0:00:01
976000 -- (-640.891) (-643.303) (-643.054) [-643.174] * [-639.534] (-640.370) (-641.861) (-644.196) -- 0:00:01
976500 -- (-642.718) (-644.118) [-641.880] (-645.517) * [-639.875] (-641.440) (-642.155) (-642.936) -- 0:00:01
977000 -- (-640.525) (-641.201) [-641.384] (-642.954) * (-639.874) [-640.215] (-640.193) (-642.702) -- 0:00:01
977500 -- (-640.938) (-643.334) (-640.125) [-640.683] * [-639.403] (-641.515) (-640.219) (-643.328) -- 0:00:01
978000 -- (-644.763) (-642.096) (-641.355) [-639.031] * [-641.052] (-640.727) (-639.935) (-643.507) -- 0:00:01
978500 -- [-640.755] (-643.781) (-642.256) (-646.063) * (-640.736) (-642.180) (-639.299) [-640.962] -- 0:00:01
979000 -- (-641.400) [-639.807] (-642.382) (-641.180) * (-639.729) [-643.040] (-640.863) (-640.421) -- 0:00:01
979500 -- (-640.768) [-642.526] (-643.653) (-640.060) * (-640.557) [-639.702] (-642.634) (-648.371) -- 0:00:01
980000 -- (-642.612) [-641.208] (-643.136) (-639.446) * (-641.075) [-639.503] (-640.888) (-641.681) -- 0:00:01
Average standard deviation of split frequencies: 0.009678
980500 -- (-641.952) (-641.574) (-641.645) [-645.927] * (-640.577) (-640.879) [-639.194] (-641.288) -- 0:00:01
981000 -- (-643.025) (-647.679) [-640.577] (-642.937) * (-642.475) (-639.023) (-640.192) [-643.019] -- 0:00:01
981500 -- (-640.077) (-645.330) [-641.829] (-642.717) * [-641.081] (-640.503) (-642.692) (-641.465) -- 0:00:01
982000 -- (-640.803) (-639.715) [-641.231] (-640.905) * (-639.380) (-648.246) (-643.450) [-639.727] -- 0:00:01
982500 -- (-640.258) (-639.034) (-641.588) [-639.772] * [-639.721] (-640.248) (-640.856) (-640.707) -- 0:00:01
983000 -- (-644.304) (-639.843) (-644.211) [-641.656] * [-641.852] (-643.117) (-641.154) (-641.642) -- 0:00:01
983500 -- (-640.745) [-642.333] (-639.891) (-643.131) * (-640.098) (-643.152) (-642.355) [-641.050] -- 0:00:01
984000 -- (-642.014) [-642.012] (-639.514) (-640.517) * (-641.333) [-643.494] (-639.382) (-641.398) -- 0:00:00
984500 -- [-640.646] (-642.039) (-646.483) (-640.046) * (-641.984) [-644.978] (-639.557) (-645.157) -- 0:00:00
985000 -- (-641.970) (-641.237) [-641.755] (-640.553) * (-640.544) (-650.587) (-639.321) [-641.062] -- 0:00:00
Average standard deviation of split frequencies: 0.009339
985500 -- (-640.583) (-640.764) (-643.488) [-643.729] * (-639.973) [-645.271] (-639.409) (-641.246) -- 0:00:00
986000 -- (-641.921) (-640.255) (-644.359) [-641.048] * (-638.999) (-643.088) [-640.745] (-640.671) -- 0:00:00
986500 -- (-641.678) [-640.225] (-641.568) (-643.245) * (-640.589) [-640.677] (-641.782) (-640.642) -- 0:00:00
987000 -- (-640.033) [-640.809] (-640.597) (-642.359) * (-638.978) (-640.455) (-642.387) [-640.290] -- 0:00:00
987500 -- [-642.709] (-641.429) (-640.490) (-640.766) * (-639.569) (-643.802) (-643.403) [-640.684] -- 0:00:00
988000 -- (-640.298) (-640.947) (-640.692) [-643.652] * (-640.214) (-643.626) (-639.798) [-640.508] -- 0:00:00
988500 -- (-643.901) (-642.292) [-640.189] (-641.767) * [-640.130] (-641.780) (-639.207) (-641.081) -- 0:00:00
989000 -- (-645.291) (-645.832) (-640.915) [-641.054] * (-643.854) (-641.755) [-642.967] (-640.050) -- 0:00:00
989500 -- (-644.547) (-644.588) (-642.010) [-639.984] * (-641.369) (-641.051) (-640.267) [-641.330] -- 0:00:00
990000 -- (-642.716) (-641.847) [-640.163] (-642.418) * [-641.358] (-641.673) (-641.324) (-642.613) -- 0:00:00
Average standard deviation of split frequencies: 0.009168
990500 -- (-643.203) (-641.479) (-642.077) [-639.878] * (-641.862) [-641.249] (-641.380) (-645.151) -- 0:00:00
991000 -- (-643.977) [-644.129] (-642.264) (-639.775) * (-640.837) (-639.842) [-640.676] (-640.741) -- 0:00:00
991500 -- [-640.618] (-641.510) (-642.344) (-642.422) * (-642.517) (-641.071) (-641.283) [-644.201] -- 0:00:00
992000 -- (-639.254) (-642.292) (-641.098) [-638.969] * (-641.802) (-641.871) [-639.949] (-643.359) -- 0:00:00
992500 -- (-640.607) (-645.308) (-641.121) [-639.613] * (-641.110) (-639.434) (-643.165) [-641.703] -- 0:00:00
993000 -- (-644.816) (-643.621) [-639.790] (-644.234) * (-641.154) [-639.147] (-640.932) (-639.715) -- 0:00:00
993500 -- [-640.326] (-640.013) (-640.965) (-643.100) * (-644.952) [-639.306] (-639.364) (-640.358) -- 0:00:00
994000 -- (-639.978) (-641.015) [-639.879] (-644.537) * [-640.037] (-639.568) (-639.478) (-639.312) -- 0:00:00
994500 -- (-640.371) (-640.813) [-639.873] (-642.566) * [-640.633] (-639.239) (-639.125) (-641.729) -- 0:00:00
995000 -- (-643.213) (-645.614) (-639.553) [-641.934] * (-640.440) [-640.633] (-647.250) (-643.700) -- 0:00:00
Average standard deviation of split frequencies: 0.008866
995500 -- (-641.870) [-646.036] (-642.763) (-644.255) * (-643.882) (-640.273) [-639.473] (-641.184) -- 0:00:00
996000 -- (-642.512) (-645.980) (-640.498) [-641.592] * (-644.340) [-642.836] (-639.139) (-640.178) -- 0:00:00
996500 -- (-641.342) (-641.957) [-640.490] (-640.329) * (-640.754) (-646.635) [-639.442] (-641.884) -- 0:00:00
997000 -- (-640.991) [-641.774] (-639.852) (-639.572) * (-639.311) (-641.170) [-640.014] (-641.372) -- 0:00:00
997500 -- [-643.781] (-642.825) (-640.390) (-639.678) * (-640.578) (-639.282) (-642.373) [-645.255] -- 0:00:00
998000 -- (-639.288) (-641.938) [-640.843] (-639.883) * [-639.167] (-640.564) (-640.946) (-641.801) -- 0:00:00
998500 -- (-642.568) (-640.978) [-639.612] (-643.961) * [-642.783] (-640.622) (-641.838) (-645.045) -- 0:00:00
999000 -- [-642.167] (-643.039) (-640.194) (-642.039) * [-641.809] (-639.699) (-644.483) (-643.422) -- 0:00:00
999500 -- (-639.778) (-641.404) (-641.670) [-641.213] * (-643.453) [-640.189] (-640.654) (-641.766) -- 0:00:00
1000000 -- (-643.977) (-640.739) (-640.272) [-642.441] * (-643.784) (-642.375) [-641.612] (-642.259) -- 0:00:00
Average standard deviation of split frequencies: 0.009108
Analysis completed in 1 mins 1 seconds
Analysis used 59.50 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -638.68
Likelihood of best state for "cold" chain of run 2 was -638.68
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
32.5 % ( 33 %) Dirichlet(Pi{all})
33.7 % ( 32 %) Slider(Pi{all})
79.0 % ( 53 %) Multiplier(Alpha{1,2})
78.1 % ( 47 %) Multiplier(Alpha{3})
24.2 % ( 15 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.4 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
32.8 % ( 31 %) Dirichlet(Pi{all})
33.3 % ( 21 %) Slider(Pi{all})
78.9 % ( 55 %) Multiplier(Alpha{1,2})
77.9 % ( 51 %) Multiplier(Alpha{3})
24.0 % ( 23 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.4 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166126 0.82 0.67
3 | 166558 167261 0.83
4 | 166814 166964 166277
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166426 0.82 0.67
3 | 166699 166557 0.84
4 | 167151 166300 166867
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -640.48
| 1 21 * |
| 2 2 1 2 |
| 1 1 1 * 2 2 2 1 2 |
| 2 12 2 212 2 1 2 12 12 |
| * 1 2 212 1 2 1 22 1 2 22 122|
| 12 2 11 12 2 2 11 2 1 1 12 2 * |
|2 * 1 1 1 2 1|
| 1 2 121 11 12 112 2 1 1 12 2 1 1 1 |
| 2 2 2 1 1 1 2 1 11 1 |
|1 1 2 2 2 2 |
| 2 1 |
| |
| |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -642.36
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -640.42 -645.06
2 -640.40 -643.82
--------------------------------------
TOTAL -640.41 -644.62
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892415 0.091032 0.355124 1.477746 0.861720 1140.46 1316.30 1.000
r(A<->C){all} 0.165753 0.019930 0.000154 0.449120 0.127323 347.16 384.26 1.001
r(A<->G){all} 0.160250 0.019428 0.000035 0.452399 0.120356 215.27 244.68 1.002
r(A<->T){all} 0.176643 0.020718 0.000036 0.473890 0.142107 205.06 252.35 1.000
r(C<->G){all} 0.173149 0.020364 0.000114 0.457222 0.134270 256.74 314.55 1.000
r(C<->T){all} 0.165687 0.018281 0.000010 0.441788 0.132975 185.51 245.73 1.000
r(G<->T){all} 0.158518 0.020145 0.000030 0.450931 0.116352 229.45 230.14 1.007
pi(A){all} 0.205053 0.000336 0.171125 0.242320 0.204567 1367.99 1395.65 1.000
pi(C){all} 0.292264 0.000426 0.253733 0.334766 0.292107 1183.34 1282.18 1.000
pi(G){all} 0.309859 0.000467 0.266952 0.350134 0.309226 1360.72 1373.28 1.001
pi(T){all} 0.192825 0.000321 0.158556 0.228166 0.192522 1384.07 1438.30 1.000
alpha{1,2} 0.419939 0.241225 0.000303 1.414715 0.240487 1256.84 1325.64 1.000
alpha{3} 0.456309 0.244672 0.000374 1.470843 0.288106 1239.72 1324.69 1.000
pinvar{all} 0.996629 0.000016 0.989258 0.999997 0.997933 1224.09 1362.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- ..*.*.
9 -- .*.*..
10 -- .*..*.
11 -- .***.*
12 -- ...**.
13 -- .**...
14 -- .**.**
15 -- ....**
16 -- ..*..*
17 -- .*.***
18 -- ...*.*
19 -- ..**..
20 -- ..****
21 -- .*...*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.012248 0.145237 0.162558 2
8 453 0.150899 0.011777 0.142572 0.159227 2
9 450 0.149900 0.008480 0.143904 0.155896 2
10 438 0.145903 0.013191 0.136576 0.155230 2
11 438 0.145903 0.003769 0.143238 0.148568 2
12 436 0.145237 0.007537 0.139907 0.150566 2
13 434 0.144570 0.002827 0.142572 0.146569 2
14 433 0.144237 0.012719 0.135243 0.153231 2
15 423 0.140906 0.002355 0.139241 0.142572 2
16 419 0.139574 0.009893 0.132578 0.146569 2
17 417 0.138907 0.013662 0.129247 0.148568 2
18 417 0.138907 0.009893 0.131912 0.145903 2
19 416 0.138574 0.000942 0.137908 0.139241 2
20 413 0.137575 0.016488 0.125916 0.149234 2
21 401 0.133578 0.010835 0.125916 0.141239 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096956 0.009369 0.000011 0.291101 0.068564 1.000 2
length{all}[2] 0.099418 0.009699 0.000018 0.293394 0.069128 1.000 2
length{all}[3] 0.098254 0.009336 0.000002 0.293002 0.069577 1.000 2
length{all}[4] 0.098383 0.009475 0.000028 0.296407 0.067812 1.000 2
length{all}[5] 0.101922 0.009954 0.000061 0.294815 0.072228 1.000 2
length{all}[6] 0.098877 0.009547 0.000059 0.301128 0.066555 1.000 2
length{all}[7] 0.100585 0.011018 0.000238 0.308144 0.068350 1.000 2
length{all}[8] 0.090277 0.007587 0.000027 0.269856 0.062472 1.000 2
length{all}[9] 0.104499 0.010982 0.000078 0.318016 0.069691 0.998 2
length{all}[10] 0.108767 0.012289 0.000171 0.319225 0.071402 0.999 2
length{all}[11] 0.098306 0.011633 0.000111 0.319751 0.064324 1.003 2
length{all}[12] 0.092532 0.007856 0.000243 0.276463 0.069309 1.000 2
length{all}[13] 0.101778 0.010977 0.000159 0.281235 0.071728 1.001 2
length{all}[14] 0.098972 0.009833 0.000031 0.289769 0.069991 0.999 2
length{all}[15] 0.096350 0.008189 0.000480 0.267520 0.070201 0.999 2
length{all}[16] 0.100373 0.009967 0.000603 0.299534 0.066746 0.998 2
length{all}[17] 0.099466 0.011432 0.000007 0.291335 0.066831 0.998 2
length{all}[18] 0.095703 0.012252 0.000451 0.328692 0.059951 0.998 2
length{all}[19] 0.106505 0.011135 0.000018 0.309379 0.073122 1.002 2
length{all}[20] 0.094344 0.008332 0.000326 0.271326 0.065304 0.999 2
length{all}[21] 0.093960 0.009041 0.000121 0.289061 0.066686 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009108
Maximum standard deviation of split frequencies = 0.016488
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 468
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 156 / 156 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 156 / 156 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.084295 0.074018 0.094589 0.058701 0.034358 0.015052 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -671.908943
Iterating by ming2
Initial: fx= 671.908943
x= 0.08429 0.07402 0.09459 0.05870 0.03436 0.01505 0.30000 1.30000
1 h-m-p 0.0000 0.0001 371.6763 ++ 658.296183 m 0.0001 13 | 1/8
2 h-m-p 0.0005 0.0044 73.4650 ++ 654.157439 m 0.0044 24 | 2/8
3 h-m-p 0.0000 0.0001 248.1032 ++ 653.098959 m 0.0001 35 | 3/8
4 h-m-p 0.0001 0.0008 411.4727 ++ 638.613422 m 0.0008 46 | 4/8
5 h-m-p 0.0019 0.0096 13.9742 ------------.. | 4/8
6 h-m-p 0.0000 0.0002 262.3823 +++ 625.674574 m 0.0002 79 | 5/8
7 h-m-p 0.0160 8.0000 13.0123 -------------.. | 5/8
8 h-m-p 0.0000 0.0001 215.0778 ++ 619.845847 m 0.0001 112 | 6/8
9 h-m-p 0.0160 8.0000 8.7089 -------------.. | 6/8
10 h-m-p 0.0000 0.0001 152.3848 ++ 616.913511 m 0.0001 145 | 7/8
11 h-m-p 1.6000 8.0000 0.0000 Y 616.913511 0 2.6500 156 | 7/8
12 h-m-p 0.0160 8.0000 0.0000 ------------N 616.913511 0 0.0000 180
Out..
lnL = -616.913511
181 lfun, 181 eigenQcodon, 1086 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044268 0.051872 0.096765 0.015501 0.032231 0.082383 0.000100 0.660230 0.256529
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.385997
np = 9
lnL0 = -664.349074
Iterating by ming2
Initial: fx= 664.349074
x= 0.04427 0.05187 0.09677 0.01550 0.03223 0.08238 0.00011 0.66023 0.25653
1 h-m-p 0.0000 0.0000 345.1601 ++ 663.925193 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0004 217.0471 +++ 650.574141 m 0.0004 27 | 2/9
3 h-m-p 0.0001 0.0003 130.9603 ++ 640.687668 m 0.0003 39 | 3/9
4 h-m-p 0.0002 0.0009 102.5460 ++ 633.190123 m 0.0009 51 | 4/9
5 h-m-p 0.0000 0.0000 1634.5211 ++ 629.982092 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 33402.6116 ++ 623.062888 m 0.0000 75 | 6/9
7 h-m-p 0.0003 0.0014 28.0675 ++ 622.344043 m 0.0014 87 | 7/9
8 h-m-p 0.0072 0.0394 3.8186 -------------.. | 7/9
9 h-m-p 0.0000 0.0002 147.4556 +++ 616.913579 m 0.0002 123 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 616.913579 m 8.0000 135 | 7/9
11 h-m-p 0.0160 8.0000 0.0005 +++++ 616.913578 m 8.0000 151 | 7/9
12 h-m-p 0.0223 5.4105 0.1843 ++++ 616.913514 m 5.4105 167 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 N 616.913514 0 1.6000 181 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 Y 616.913514 0 0.0160 194
Out..
lnL = -616.913514
195 lfun, 585 eigenQcodon, 2340 P(t)
Time used: 0:00
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065401 0.074302 0.102772 0.012357 0.026079 0.042692 0.000100 0.898309 0.162293 0.487508 1.339503
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.336676
np = 11
lnL0 = -665.157193
Iterating by ming2
Initial: fx= 665.157193
x= 0.06540 0.07430 0.10277 0.01236 0.02608 0.04269 0.00011 0.89831 0.16229 0.48751 1.33950
1 h-m-p 0.0000 0.0000 356.7030 ++ 664.563733 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 164.5660 +++ 653.731345 m 0.0005 31 | 2/11
3 h-m-p 0.0001 0.0003 95.5367 ++ 644.959820 m 0.0003 45 | 3/11
4 h-m-p 0.0007 0.0062 42.6162 ++ 627.240567 m 0.0062 59 | 4/11
5 h-m-p 0.0000 0.0000 136015.1411 ++ 619.518304 m 0.0000 73 | 5/11
6 h-m-p 0.0001 0.0003 187.2378 ++ 618.684744 m 0.0003 87 | 6/11
7 h-m-p 0.0001 0.0006 9.2318 ----------.. | 6/11
8 h-m-p 0.0000 0.0000 215.5290 ++ 618.344704 m 0.0000 123 | 7/11
9 h-m-p 0.0160 8.0000 1.3678 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 152.4174 ++ 616.913533 m 0.0001 162 | 8/11
11 h-m-p 0.0422 8.0000 0.0000 ++++ 616.913533 m 8.0000 178 | 8/11
12 h-m-p 0.0160 8.0000 0.0062 ------Y 616.913533 0 0.0000 201 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 616.913533 m 8.0000 221 | 8/11
14 h-m-p 0.0010 0.5020 1.2977 +++++ 616.913528 m 0.5020 241 | 8/11
15 h-m-p -0.0000 -0.0000 0.7277
h-m-p: -0.00000000e+00 -0.00000000e+00 7.27663827e-01 616.913528
.. | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 616.913528 m 8.0000 272 | 8/11
17 h-m-p 0.0160 8.0000 1.2391 ++++Y 616.913505 0 4.0960 293 | 8/11
18 h-m-p 1.6000 8.0000 0.0867 +Y 616.913505 0 7.0126 308 | 8/11
19 h-m-p 1.6000 8.0000 0.0027 +C 616.913505 0 6.7130 326 | 8/11
20 h-m-p 1.6000 8.0000 0.0005 ++ 616.913505 m 8.0000 343 | 8/11
21 h-m-p 0.0160 8.0000 0.4235 +++++ 616.913504 m 8.0000 363 | 8/11
22 h-m-p 1.6000 8.0000 0.1341 ++ 616.913500 m 8.0000 380 | 8/11
23 h-m-p 0.0722 6.8796 14.8526 ++Y 616.913491 0 1.1553 399 | 8/11
24 h-m-p 1.6000 8.0000 1.6085 ++ 616.913488 m 8.0000 413 | 8/11
25 h-m-p 1.6000 8.0000 3.5582 ++ 616.913487 m 8.0000 427 | 8/11
26 h-m-p 1.6000 8.0000 6.1703 ----------------.. | 8/11
27 h-m-p 0.0160 8.0000 0.0000 ---Y 616.913487 0 0.0001 472 | 8/11
28 h-m-p 0.0160 8.0000 0.0000 ------N 616.913487 0 0.0000 495
Out..
lnL = -616.913487
496 lfun, 1984 eigenQcodon, 8928 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -616.910081 S = -616.909865 -0.000082
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:03
did 20 / 47 patterns 0:03
did 30 / 47 patterns 0:03
did 40 / 47 patterns 0:03
did 47 / 47 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032808 0.031068 0.035003 0.072017 0.063780 0.012755 0.000100 1.130907 1.784021
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.204895
np = 9
lnL0 = -654.048022
Iterating by ming2
Initial: fx= 654.048022
x= 0.03281 0.03107 0.03500 0.07202 0.06378 0.01276 0.00011 1.13091 1.78402
1 h-m-p 0.0000 0.0000 358.8282 ++ 653.383704 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0601 18.7982 ----------.. | 1/9
3 h-m-p 0.0000 0.0001 359.1627 ++ 642.844048 m 0.0001 46 | 2/9
4 h-m-p 0.0017 0.0730 15.5150 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 332.1992 ++ 629.117734 m 0.0001 80 | 3/9
6 h-m-p 0.0044 0.1403 8.3235 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 302.7560 ++ 628.059271 m 0.0000 114 | 4/9
8 h-m-p 0.0007 0.3139 4.2990 -----------.. | 4/9
9 h-m-p 0.0000 0.0000 262.1583 ++ 627.058470 m 0.0000 147 | 5/9
10 h-m-p 0.0008 0.3733 3.7316 -----------.. | 5/9
11 h-m-p 0.0000 0.0002 213.7248 +++ 618.205204 m 0.0002 181 | 6/9
12 h-m-p 0.0139 1.4965 2.0854 -------------.. | 6/9
13 h-m-p 0.0000 0.0001 153.6434 ++ 616.913541 m 0.0001 216 | 7/9
14 h-m-p 0.3278 8.0000 0.0000 +++ 616.913541 m 8.0000 229 | 7/9
15 h-m-p 0.1833 8.0000 0.0000 ----Y 616.913541 0 0.0001 247
Out..
lnL = -616.913541
248 lfun, 2728 eigenQcodon, 14880 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067431 0.025312 0.098755 0.043611 0.071115 0.032450 0.000100 0.900000 1.100751 1.942631 1.129843
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.919769
np = 11
lnL0 = -666.586085
Iterating by ming2
Initial: fx= 666.586085
x= 0.06743 0.02531 0.09876 0.04361 0.07111 0.03245 0.00011 0.90000 1.10075 1.94263 1.12984
1 h-m-p 0.0000 0.0000 343.5474 ++ 666.213959 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0022 108.7358 ++++ 643.757775 m 0.0022 32 | 2/11
3 h-m-p 0.0000 0.0001 477.8455 ++ 638.482944 m 0.0001 46 | 3/11
4 h-m-p 0.0007 0.0036 54.6884 ++ 633.768959 m 0.0036 60 | 4/11
5 h-m-p 0.0001 0.0004 356.2821 ++ 623.860474 m 0.0004 74 | 5/11
6 h-m-p 0.0002 0.0011 148.0871 ++ 622.244515 m 0.0011 88 | 6/11
7 h-m-p 0.0000 0.0001 9540.8585 ++ 616.913511 m 0.0001 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 616.913511 m 8.0000 116 | 7/11
9 h-m-p 0.0036 1.8211 0.4540 ++++
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
+ 616.913501 m 1.8211 137
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33411) = 1.108952e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33386) = 1.109100e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
| 7/11
10 h-m-p 0.0000 0.0000 0.9817
h-m-p: 1.74166159e-18 8.70830797e-18 9.81699817e-01 616.913501
..
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33411) = 1.108952e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33386) = 1.109100e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
| 7/11
11 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
+ 616.913501 m 8.0000 173
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33411) = 1.108952e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33386) = 1.109100e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109026e-160 2000 rounds
| 7/11
12 h-m-p 0.0008 0.3995 0.5500
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109571e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.111207e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.33399) = 1.118563e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.33399) = 1.145235e-160 2000 rounds
+++ 616.913498 m 0.3995 194 | 8/11
13 h-m-p 0.2649 8.0000 0.2315 +++ 616.913493 m 8.0000 213 | 8/11
14 h-m-p 1.5993 8.0000 1.1581 ++ 616.913489 m 8.0000 230 | 8/11
15 h-m-p 1.6000 8.0000 0.4613 ++ 616.913488 m 8.0000 244 | 8/11
16 h-m-p 0.2957 1.4786 10.0559 ---------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0000 C 616.913488 0 0.0051 288
Out..
lnL = -616.913488
289 lfun, 3468 eigenQcodon, 19074 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -616.910554 S = -616.909900 -0.000286
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:12
did 20 / 47 patterns 0:12
did 30 / 47 patterns 0:12
did 40 / 47 patterns 0:12
did 47 / 47 patterns 0:12
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=156
NC_011896_1_WP_010908590_1_2004_MLBR_RS09505 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
NC_002677_1_NP_302269_1_1141_rpsG MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
**************************************************
NC_011896_1_WP_010908590_1_2004_MLBR_RS09505 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
NC_002677_1_NP_302269_1_1141_rpsG RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590 RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
**************************************************
NC_011896_1_WP_010908590_1_2004_MLBR_RS09505 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
NC_002677_1_NP_302269_1_1141_rpsG LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590 LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
**************************************************
NC_011896_1_WP_010908590_1_2004_MLBR_RS09505 FAHYRW
NC_002677_1_NP_302269_1_1141_rpsG FAHYRW
NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505 FAHYRW
NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125 FAHYRW
NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315 FAHYRW
NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590 FAHYRW
******
>NC_011896_1_WP_010908590_1_2004_MLBR_RS09505 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG TTTGCGCACTATCGTTGG >NC_002677_1_NP_302269_1_1141_rpsG ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG TTTGCGCACTATCGTTGG >NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG TTTGCGCACTATCGTTGG >NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG TTTGCGCACTATCGTTGG >NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG TTTGCGCACTATCGTTGG >NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590 ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG TTTGCGCACTATCGTTGG
>NC_011896_1_WP_010908590_1_2004_MLBR_RS09505 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA FAHYRW >NC_002677_1_NP_302269_1_1141_rpsG MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA FAHYRW >NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA FAHYRW >NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA FAHYRW >NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA FAHYRW >NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590 MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA FAHYRW
#NEXUS
[ID: 0066157553]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908590_1_2004_MLBR_RS09505
NC_002677_1_NP_302269_1_1141_rpsG
NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505
NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125
NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315
NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908590_1_2004_MLBR_RS09505,
2 NC_002677_1_NP_302269_1_1141_rpsG,
3 NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505,
4 NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125,
5 NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315,
6 NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06856403,2:0.06912808,3:0.0695773,4:0.06781172,5:0.07222751,6:0.06655471);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06856403,2:0.06912808,3:0.0695773,4:0.06781172,5:0.07222751,6:0.06655471);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -640.42 -645.06
2 -640.40 -643.82
--------------------------------------
TOTAL -640.41 -644.62
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892415 0.091032 0.355124 1.477746 0.861720 1140.46 1316.30 1.000
r(A<->C){all} 0.165753 0.019930 0.000154 0.449120 0.127323 347.16 384.26 1.001
r(A<->G){all} 0.160250 0.019428 0.000035 0.452399 0.120356 215.27 244.68 1.002
r(A<->T){all} 0.176643 0.020718 0.000036 0.473890 0.142107 205.06 252.35 1.000
r(C<->G){all} 0.173149 0.020364 0.000114 0.457222 0.134270 256.74 314.55 1.000
r(C<->T){all} 0.165687 0.018281 0.000010 0.441788 0.132975 185.51 245.73 1.000
r(G<->T){all} 0.158518 0.020145 0.000030 0.450931 0.116352 229.45 230.14 1.007
pi(A){all} 0.205053 0.000336 0.171125 0.242320 0.204567 1367.99 1395.65 1.000
pi(C){all} 0.292264 0.000426 0.253733 0.334766 0.292107 1183.34 1282.18 1.000
pi(G){all} 0.309859 0.000467 0.266952 0.350134 0.309226 1360.72 1373.28 1.001
pi(T){all} 0.192825 0.000321 0.158556 0.228166 0.192522 1384.07 1438.30 1.000
alpha{1,2} 0.419939 0.241225 0.000303 1.414715 0.240487 1256.84 1325.64 1.000
alpha{3} 0.456309 0.244672 0.000374 1.470843 0.288106 1239.72 1324.69 1.000
pinvar{all} 0.996629 0.000016 0.989258 0.999997 0.997933 1224.09 1362.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpsG/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 156
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 7 7 7 7 7 7
CTC 6 6 6 6 6 6 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 6 6 6 6 6 6
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 6 6 6 6 6 6 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 6 6 6 6 6 6 | AAC 5 5 5 5 5 5 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 9 9 9 9 9 9 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 3 3 3 3 3 3 | Asp GAT 2 2 2 2 2 2 | Gly GGT 3 3 3 3 3 3
GTC 6 6 6 6 6 6 | GCC 4 4 4 4 4 4 | GAC 5 5 5 5 5 5 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 2 2 2 2 2 2 | GGA 1 1 1 1 1 1
GTG 4 4 4 4 4 4 | GCG 5 5 5 5 5 5 | GAG 7 7 7 7 7 7 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908590_1_2004_MLBR_RS09505
position 1: T:0.10897 C:0.30128 A:0.23718 G:0.35256
position 2: T:0.25641 C:0.24359 A:0.28846 G:0.21154
position 3: T:0.21154 C:0.33333 A:0.08974 G:0.36538
Average T:0.19231 C:0.29274 A:0.20513 G:0.30983
#2: NC_002677_1_NP_302269_1_1141_rpsG
position 1: T:0.10897 C:0.30128 A:0.23718 G:0.35256
position 2: T:0.25641 C:0.24359 A:0.28846 G:0.21154
position 3: T:0.21154 C:0.33333 A:0.08974 G:0.36538
Average T:0.19231 C:0.29274 A:0.20513 G:0.30983
#3: NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505
position 1: T:0.10897 C:0.30128 A:0.23718 G:0.35256
position 2: T:0.25641 C:0.24359 A:0.28846 G:0.21154
position 3: T:0.21154 C:0.33333 A:0.08974 G:0.36538
Average T:0.19231 C:0.29274 A:0.20513 G:0.30983
#4: NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125
position 1: T:0.10897 C:0.30128 A:0.23718 G:0.35256
position 2: T:0.25641 C:0.24359 A:0.28846 G:0.21154
position 3: T:0.21154 C:0.33333 A:0.08974 G:0.36538
Average T:0.19231 C:0.29274 A:0.20513 G:0.30983
#5: NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315
position 1: T:0.10897 C:0.30128 A:0.23718 G:0.35256
position 2: T:0.25641 C:0.24359 A:0.28846 G:0.21154
position 3: T:0.21154 C:0.33333 A:0.08974 G:0.36538
Average T:0.19231 C:0.29274 A:0.20513 G:0.30983
#6: NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590
position 1: T:0.10897 C:0.30128 A:0.23718 G:0.35256
position 2: T:0.25641 C:0.24359 A:0.28846 G:0.21154
position 3: T:0.21154 C:0.33333 A:0.08974 G:0.36538
Average T:0.19231 C:0.29274 A:0.20513 G:0.30983
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 24 | Cys C TGT 0
TTC 6 | TCC 6 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 24 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 42
CTC 36 | CCC 18 | CAC 12 | CGC 36
CTA 0 | CCA 12 | Gln Q CAA 12 | CGA 6
CTG 36 | CCG 12 | CAG 12 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 0
ATC 12 | ACC 36 | AAC 30 | AGC 12
ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 18 | ACG 6 | AAG 54 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 18 | Asp D GAT 12 | Gly G GGT 18
GTC 36 | GCC 24 | GAC 30 | GGC 18
GTA 0 | GCA 18 | Glu E GAA 12 | GGA 6
GTG 24 | GCG 30 | GAG 42 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10897 C:0.30128 A:0.23718 G:0.35256
position 2: T:0.25641 C:0.24359 A:0.28846 G:0.21154
position 3: T:0.21154 C:0.33333 A:0.08974 G:0.36538
Average T:0.19231 C:0.29274 A:0.20513 G:0.30983
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -616.913511 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.129843
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908590_1_2004_MLBR_RS09505: 0.000004, NC_002677_1_NP_302269_1_1141_rpsG: 0.000004, NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505: 0.000004, NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125: 0.000004, NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315: 0.000004, NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.12984
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 378.2 89.8 1.1298 0.0000 0.0000 0.0 0.0
7..2 0.000 378.2 89.8 1.1298 0.0000 0.0000 0.0 0.0
7..3 0.000 378.2 89.8 1.1298 0.0000 0.0000 0.0 0.0
7..4 0.000 378.2 89.8 1.1298 0.0000 0.0000 0.0 0.0
7..5 0.000 378.2 89.8 1.1298 0.0000 0.0000 0.0 0.0
7..6 0.000 378.2 89.8 1.1298 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -616.913514 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.822118 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908590_1_2004_MLBR_RS09505: 0.000004, NC_002677_1_NP_302269_1_1141_rpsG: 0.000004, NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505: 0.000004, NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125: 0.000004, NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315: 0.000004, NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.82212 0.17788
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 378.2 89.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 378.2 89.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 378.2 89.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 378.2 89.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 378.2 89.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 378.2 89.8 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:00
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -616.913487 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000002 0.000001 41.212040
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908590_1_2004_MLBR_RS09505: 0.000004, NC_002677_1_NP_302269_1_1141_rpsG: 0.000004, NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505: 0.000004, NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125: 0.000004, NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315: 0.000004, NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 41.21204
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 378.2 89.8 41.2119 0.0000 0.0000 0.0 0.0
7..2 0.000 378.2 89.8 41.2119 0.0000 0.0000 0.0 0.0
7..3 0.000 378.2 89.8 41.2119 0.0000 0.0000 0.0 0.0
7..4 0.000 378.2 89.8 41.2119 0.0000 0.0000 0.0 0.0
7..5 0.000 378.2 89.8 41.2119 0.0000 0.0000 0.0 0.0
7..6 0.000 378.2 89.8 41.2119 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908590_1_2004_MLBR_RS09505)
Pr(w>1) post mean +- SE for w
1 M 1.000** 41.212
2 P 1.000** 41.212
3 R 1.000** 41.212
4 K 1.000** 41.212
5 G 1.000** 41.212
6 P 1.000** 41.212
7 A 1.000** 41.212
8 P 1.000** 41.212
9 K 1.000** 41.212
10 R 1.000** 41.212
11 P 1.000** 41.212
12 L 1.000** 41.212
13 V 1.000** 41.212
14 N 1.000** 41.212
15 D 1.000** 41.212
16 P 1.000** 41.212
17 V 1.000** 41.212
18 Y 1.000** 41.212
19 G 1.000** 41.212
20 S 1.000** 41.212
21 Q 1.000** 41.212
22 L 1.000** 41.212
23 V 1.000** 41.212
24 T 1.000** 41.212
25 Q 1.000** 41.212
26 L 1.000** 41.212
27 V 1.000** 41.212
28 N 1.000** 41.212
29 K 1.000** 41.212
30 I 1.000** 41.212
31 L 1.000** 41.212
32 L 1.000** 41.212
33 K 1.000** 41.212
34 G 1.000** 41.212
35 K 1.000** 41.212
36 K 1.000** 41.212
37 S 1.000** 41.212
38 L 1.000** 41.212
39 A 1.000** 41.212
40 E 1.000** 41.212
41 R 1.000** 41.212
42 I 1.000** 41.212
43 V 1.000** 41.212
44 Y 1.000** 41.212
45 G 1.000** 41.212
46 A 1.000** 41.212
47 L 1.000** 41.212
48 E 1.000** 41.212
49 H 1.000** 41.212
50 A 1.000** 41.212
51 R 1.000** 41.212
52 D 1.000** 41.212
53 K 1.000** 41.212
54 T 1.000** 41.212
55 G 1.000** 41.212
56 T 1.000** 41.212
57 D 1.000** 41.212
58 P 1.000** 41.212
59 V 1.000** 41.212
60 I 1.000** 41.212
61 T 1.000** 41.212
62 L 1.000** 41.212
63 K 1.000** 41.212
64 R 1.000** 41.212
65 A 1.000** 41.212
66 L 1.000** 41.212
67 D 1.000** 41.212
68 N 1.000** 41.212
69 V 1.000** 41.212
70 K 1.000** 41.212
71 P 1.000** 41.212
72 A 1.000** 41.212
73 L 1.000** 41.212
74 E 1.000** 41.212
75 V 1.000** 41.212
76 R 1.000** 41.212
77 S 1.000** 41.212
78 R 1.000** 41.212
79 R 1.000** 41.212
80 V 1.000** 41.212
81 G 1.000** 41.212
82 G 1.000** 41.212
83 A 1.000** 41.212
84 T 1.000** 41.212
85 Y 1.000** 41.212
86 Q 1.000** 41.212
87 V 1.000** 41.212
88 P 1.000** 41.212
89 V 1.000** 41.212
90 E 1.000** 41.212
91 V 1.000** 41.212
92 R 1.000** 41.212
93 P 1.000** 41.212
94 D 1.000** 41.212
95 R 1.000** 41.212
96 S 1.000** 41.212
97 T 1.000** 41.212
98 T 1.000** 41.212
99 L 1.000** 41.212
100 A 1.000** 41.212
101 L 1.000** 41.212
102 R 1.000** 41.212
103 W 1.000** 41.212
104 L 1.000** 41.212
105 V 1.000** 41.212
106 G 1.000** 41.212
107 F 1.000** 41.212
108 S 1.000** 41.212
109 R 1.000** 41.212
110 Q 1.000** 41.212
111 R 1.000** 41.212
112 R 1.000** 41.212
113 E 1.000** 41.212
114 K 1.000** 41.212
115 T 1.000** 41.212
116 M 1.000** 41.212
117 I 1.000** 41.212
118 E 1.000** 41.212
119 R 1.000** 41.212
120 L 1.000** 41.212
121 A 1.000** 41.212
122 N 1.000** 41.212
123 E 1.000** 41.212
124 I 1.000** 41.212
125 L 1.000** 41.212
126 D 1.000** 41.212
127 A 1.000** 41.212
128 S 1.000** 41.212
129 N 1.000** 41.212
130 G 1.000** 41.212
131 L 1.000** 41.212
132 G 1.000** 41.212
133 A 1.000** 41.212
134 S 1.000** 41.212
135 V 1.000** 41.212
136 K 1.000** 41.212
137 R 1.000** 41.212
138 R 1.000** 41.212
139 E 1.000** 41.212
140 D 1.000** 41.212
141 T 1.000** 41.212
142 H 1.000** 41.212
143 K 1.000** 41.212
144 M 1.000** 41.212
145 A 1.000** 41.212
146 E 1.000** 41.212
147 A 1.000** 41.212
148 N 1.000** 41.212
149 R 1.000** 41.212
150 A 1.000** 41.212
151 F 1.000** 41.212
152 A 1.000** 41.212
153 H 1.000** 41.212
154 Y 1.000** 41.212
155 R 1.000** 41.212
156 W 1.000** 41.212
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908590_1_2004_MLBR_RS09505)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -616.913541 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.130856 1.784009
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908590_1_2004_MLBR_RS09505: 0.000004, NC_002677_1_NP_302269_1_1141_rpsG: 0.000004, NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505: 0.000004, NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125: 0.000004, NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315: 0.000004, NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 1.13086 q = 1.78401
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.04110 0.11157 0.18017 0.24979 0.32201 0.39838 0.48094 0.57304 0.68160 0.82945
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 378.2 89.8 0.3868 0.0000 0.0000 0.0 0.0
7..2 0.000 378.2 89.8 0.3868 0.0000 0.0000 0.0 0.0
7..3 0.000 378.2 89.8 0.3868 0.0000 0.0000 0.0 0.0
7..4 0.000 378.2 89.8 0.3868 0.0000 0.0000 0.0 0.0
7..5 0.000 378.2 89.8 0.3868 0.0000 0.0000 0.0 0.0
7..6 0.000 378.2 89.8 0.3868 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -616.913488 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005800 2.333986 17.594278
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908590_1_2004_MLBR_RS09505: 0.000004, NC_002677_1_NP_302269_1_1141_rpsG: 0.000004, NZ_LVXE01000034_1_WP_010908590_1_1531_A3216_RS09505: 0.000004, NZ_LYPH01000037_1_WP_010908590_1_1487_A8144_RS07125: 0.000004, NZ_CP029543_1_WP_010908590_1_2027_DIJ64_RS10315: 0.000004, NZ_AP014567_1_WP_010908590_1_2082_JK2ML_RS10590: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00580 q = 2.33399
(p1 = 0.99999) w = 17.59428
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004 17.59428
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 378.2 89.8 17.5941 0.0000 0.0000 0.0 0.0
7..2 0.000 378.2 89.8 17.5941 0.0000 0.0000 0.0 0.0
7..3 0.000 378.2 89.8 17.5941 0.0000 0.0000 0.0 0.0
7..4 0.000 378.2 89.8 17.5941 0.0000 0.0000 0.0 0.0
7..5 0.000 378.2 89.8 17.5941 0.0000 0.0000 0.0 0.0
7..6 0.000 378.2 89.8 17.5941 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908590_1_2004_MLBR_RS09505)
Pr(w>1) post mean +- SE for w
1 M 1.000** 17.594
2 P 1.000** 17.594
3 R 1.000** 17.594
4 K 1.000** 17.594
5 G 1.000** 17.594
6 P 1.000** 17.594
7 A 1.000** 17.594
8 P 1.000** 17.594
9 K 1.000** 17.594
10 R 1.000** 17.594
11 P 1.000** 17.594
12 L 1.000** 17.594
13 V 1.000** 17.594
14 N 1.000** 17.594
15 D 1.000** 17.594
16 P 1.000** 17.594
17 V 1.000** 17.594
18 Y 1.000** 17.594
19 G 1.000** 17.594
20 S 1.000** 17.594
21 Q 1.000** 17.594
22 L 1.000** 17.594
23 V 1.000** 17.594
24 T 1.000** 17.594
25 Q 1.000** 17.594
26 L 1.000** 17.594
27 V 1.000** 17.594
28 N 1.000** 17.594
29 K 1.000** 17.594
30 I 1.000** 17.594
31 L 1.000** 17.594
32 L 1.000** 17.594
33 K 1.000** 17.594
34 G 1.000** 17.594
35 K 1.000** 17.594
36 K 1.000** 17.594
37 S 1.000** 17.594
38 L 1.000** 17.594
39 A 1.000** 17.594
40 E 1.000** 17.594
41 R 1.000** 17.594
42 I 1.000** 17.594
43 V 1.000** 17.594
44 Y 1.000** 17.594
45 G 1.000** 17.594
46 A 1.000** 17.594
47 L 1.000** 17.594
48 E 1.000** 17.594
49 H 1.000** 17.594
50 A 1.000** 17.594
51 R 1.000** 17.594
52 D 1.000** 17.594
53 K 1.000** 17.594
54 T 1.000** 17.594
55 G 1.000** 17.594
56 T 1.000** 17.594
57 D 1.000** 17.594
58 P 1.000** 17.594
59 V 1.000** 17.594
60 I 1.000** 17.594
61 T 1.000** 17.594
62 L 1.000** 17.594
63 K 1.000** 17.594
64 R 1.000** 17.594
65 A 1.000** 17.594
66 L 1.000** 17.594
67 D 1.000** 17.594
68 N 1.000** 17.594
69 V 1.000** 17.594
70 K 1.000** 17.594
71 P 1.000** 17.594
72 A 1.000** 17.594
73 L 1.000** 17.594
74 E 1.000** 17.594
75 V 1.000** 17.594
76 R 1.000** 17.594
77 S 1.000** 17.594
78 R 1.000** 17.594
79 R 1.000** 17.594
80 V 1.000** 17.594
81 G 1.000** 17.594
82 G 1.000** 17.594
83 A 1.000** 17.594
84 T 1.000** 17.594
85 Y 1.000** 17.594
86 Q 1.000** 17.594
87 V 1.000** 17.594
88 P 1.000** 17.594
89 V 1.000** 17.594
90 E 1.000** 17.594
91 V 1.000** 17.594
92 R 1.000** 17.594
93 P 1.000** 17.594
94 D 1.000** 17.594
95 R 1.000** 17.594
96 S 1.000** 17.594
97 T 1.000** 17.594
98 T 1.000** 17.594
99 L 1.000** 17.594
100 A 1.000** 17.594
101 L 1.000** 17.594
102 R 1.000** 17.594
103 W 1.000** 17.594
104 L 1.000** 17.594
105 V 1.000** 17.594
106 G 1.000** 17.594
107 F 1.000** 17.594
108 S 1.000** 17.594
109 R 1.000** 17.594
110 Q 1.000** 17.594
111 R 1.000** 17.594
112 R 1.000** 17.594
113 E 1.000** 17.594
114 K 1.000** 17.594
115 T 1.000** 17.594
116 M 1.000** 17.594
117 I 1.000** 17.594
118 E 1.000** 17.594
119 R 1.000** 17.594
120 L 1.000** 17.594
121 A 1.000** 17.594
122 N 1.000** 17.594
123 E 1.000** 17.594
124 I 1.000** 17.594
125 L 1.000** 17.594
126 D 1.000** 17.594
127 A 1.000** 17.594
128 S 1.000** 17.594
129 N 1.000** 17.594
130 G 1.000** 17.594
131 L 1.000** 17.594
132 G 1.000** 17.594
133 A 1.000** 17.594
134 S 1.000** 17.594
135 V 1.000** 17.594
136 K 1.000** 17.594
137 R 1.000** 17.594
138 R 1.000** 17.594
139 E 1.000** 17.594
140 D 1.000** 17.594
141 T 1.000** 17.594
142 H 1.000** 17.594
143 K 1.000** 17.594
144 M 1.000** 17.594
145 A 1.000** 17.594
146 E 1.000** 17.594
147 A 1.000** 17.594
148 N 1.000** 17.594
149 R 1.000** 17.594
150 A 1.000** 17.594
151 F 1.000** 17.594
152 A 1.000** 17.594
153 H 1.000** 17.594
154 Y 1.000** 17.594
155 R 1.000** 17.594
156 W 1.000** 17.594
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908590_1_2004_MLBR_RS09505)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:12
Model 1: NearlyNeutral -616.913514 Model 2: PositiveSelection -616.913487 Model 0: one-ratio -616.913511 Model 7: beta -616.913541 Model 8: beta&w>1 -616.913488 Model 0 vs 1 5.999999984851456E-6 Model 2 vs 1 5.3999999863663106E-5 Model 8 vs 7 1.059999999597494E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
