--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:17:41 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsG/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -640.42          -645.06
2       -640.40          -643.82
--------------------------------------
TOTAL     -640.41          -644.62
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.892415    0.091032    0.355124    1.477746    0.861720   1140.46   1316.30    1.000
r(A<->C){all}   0.165753    0.019930    0.000154    0.449120    0.127323    347.16    384.26    1.001
r(A<->G){all}   0.160250    0.019428    0.000035    0.452399    0.120356    215.27    244.68    1.002
r(A<->T){all}   0.176643    0.020718    0.000036    0.473890    0.142107    205.06    252.35    1.000
r(C<->G){all}   0.173149    0.020364    0.000114    0.457222    0.134270    256.74    314.55    1.000
r(C<->T){all}   0.165687    0.018281    0.000010    0.441788    0.132975    185.51    245.73    1.000
r(G<->T){all}   0.158518    0.020145    0.000030    0.450931    0.116352    229.45    230.14    1.007
pi(A){all}      0.205053    0.000336    0.171125    0.242320    0.204567   1367.99   1395.65    1.000
pi(C){all}      0.292264    0.000426    0.253733    0.334766    0.292107   1183.34   1282.18    1.000
pi(G){all}      0.309859    0.000467    0.266952    0.350134    0.309226   1360.72   1373.28    1.001
pi(T){all}      0.192825    0.000321    0.158556    0.228166    0.192522   1384.07   1438.30    1.000
alpha{1,2}      0.419939    0.241225    0.000303    1.414715    0.240487   1256.84   1325.64    1.000
alpha{3}        0.456309    0.244672    0.000374    1.470843    0.288106   1239.72   1324.69    1.000
pinvar{all}     0.996629    0.000016    0.989258    0.999997    0.997933   1224.09   1362.54    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-616.913514
Model 2: PositiveSelection	-616.913487
Model 0: one-ratio	-616.913511
Model 7: beta	-616.913541
Model 8: beta&w>1	-616.913488


Model 0 vs 1	5.999999984851456E-6

Model 2 vs 1	5.3999999863663106E-5

Model 8 vs 7	1.059999999597494E-4
>C1
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C2
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C3
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C4
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C5
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C6
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=156 

C1              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C2              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C3              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C4              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C5              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C6              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
                **************************************************

C1              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C2              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C3              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C4              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C5              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C6              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
                **************************************************

C1              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C2              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C3              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C4              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C5              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C6              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
                **************************************************

C1              FAHYRW
C2              FAHYRW
C3              FAHYRW
C4              FAHYRW
C5              FAHYRW
C6              FAHYRW
                ******




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  156 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  156 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4680]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4680]--->[4680]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.469 Mb, Max= 30.691 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C2              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C3              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C4              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C5              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
C6              MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
                **************************************************

C1              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C2              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C3              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C4              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C5              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
C6              RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
                **************************************************

C1              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C2              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C3              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C4              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C5              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
C6              LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
                **************************************************

C1              FAHYRW
C2              FAHYRW
C3              FAHYRW
C4              FAHYRW
C5              FAHYRW
C6              FAHYRW
                ******




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
C2              ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
C3              ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
C4              ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
C5              ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
C6              ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
                **************************************************

C1              CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
C2              CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
C3              CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
C4              CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
C5              CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
C6              CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
                **************************************************

C1              GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
C2              GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
C3              GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
C4              GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
C5              GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
C6              GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
                **************************************************

C1              CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
C2              CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
C3              CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
C4              CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
C5              CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
C6              CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
                **************************************************

C1              CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
C2              CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
C3              CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
C4              CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
C5              CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
C6              CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
                **************************************************

C1              CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
C2              CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
C3              CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
C4              CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
C5              CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
C6              CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
                **************************************************

C1              TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
C2              TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
C3              TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
C4              TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
C5              TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
C6              TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
                **************************************************

C1              TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
C2              TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
C3              TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
C4              TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
C5              TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
C6              TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
                **************************************************

C1              CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
C2              CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
C3              CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
C4              CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
C5              CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
C6              CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
                **************************************************

C1              TTTGCGCACTATCGTTGG
C2              TTTGCGCACTATCGTTGG
C3              TTTGCGCACTATCGTTGG
C4              TTTGCGCACTATCGTTGG
C5              TTTGCGCACTATCGTTGG
C6              TTTGCGCACTATCGTTGG
                ******************



>C1
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C2
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C3
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C4
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C5
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C6
ATGCCACGCAAGGGGCCCGCACCCAAGCGTCCGTTGGTCAACGACCCTGT
CTATGGGTCGCAGTTGGTCACCCAGCTGGTGAACAAAATTCTGCTGAAAG
GGAAGAAATCGCTGGCCGAACGCATTGTTTATGGTGCGCTCGAGCACGCC
CGCGACAAGACCGGCACCGATCCCGTCATCACTCTCAAGCGTGCTCTCGA
CAACGTTAAGCCGGCCCTCGAGGTGCGTAGCCGTCGCGTTGGCGGTGCGA
CTTATCAAGTGCCTGTCGAGGTTCGGCCAGACCGATCGACCACGCTGGCG
TTGCGCTGGCTCGTCGGCTTCTCGCGGCAACGTCGGGAGAAGACCATGAT
TGAGCGTTTGGCAAACGAGATCCTGGATGCTAGCAATGGTCTCGGAGCCT
CCGTGAAGCGGCGCGAAGACACCCATAAGATGGCTGAGGCAAACCGGGCG
TTTGCGCACTATCGTTGG
>C1
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C2
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C3
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C4
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C5
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
>C6
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 468 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579792583
      Setting output file names to "/data/11res/rpsG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 694780100
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0066157553
      Seed = 35893060
      Swapseed = 1579792583
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1047.406377 -- -24.965149
         Chain 2 -- -1047.406437 -- -24.965149
         Chain 3 -- -1047.406377 -- -24.965149
         Chain 4 -- -1047.406377 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1047.406277 -- -24.965149
         Chain 2 -- -1047.406437 -- -24.965149
         Chain 3 -- -1047.406437 -- -24.965149
         Chain 4 -- -1047.406277 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1047.406] (-1047.406) (-1047.406) (-1047.406) * [-1047.406] (-1047.406) (-1047.406) (-1047.406) 
        500 -- (-659.090) (-648.883) [-651.077] (-652.657) * (-660.143) [-648.164] (-657.648) (-656.237) -- 0:00:00
       1000 -- (-650.719) (-648.489) (-648.884) [-648.318] * (-653.326) [-646.209] (-646.230) (-647.356) -- 0:00:00
       1500 -- (-648.113) [-647.686] (-663.039) (-645.623) * (-660.566) [-651.523] (-651.769) (-655.117) -- 0:00:00
       2000 -- [-649.078] (-644.168) (-650.894) (-657.672) * (-653.143) [-648.227] (-652.452) (-648.617) -- 0:00:00
       2500 -- (-649.946) [-646.689] (-655.223) (-655.093) * (-656.912) (-649.700) [-645.699] (-647.902) -- 0:00:00
       3000 -- (-645.742) [-646.561] (-660.662) (-644.071) * [-648.851] (-644.589) (-651.694) (-646.431) -- 0:00:00
       3500 -- (-653.663) (-649.319) (-659.639) [-644.971] * (-651.207) [-647.115] (-654.623) (-650.714) -- 0:00:00
       4000 -- (-649.519) (-656.847) [-647.528] (-655.970) * (-660.913) [-647.025] (-651.224) (-657.491) -- 0:00:00
       4500 -- (-650.560) (-648.397) [-645.255] (-652.320) * (-646.495) [-649.258] (-652.973) (-650.565) -- 0:00:00
       5000 -- (-662.307) [-652.167] (-646.978) (-647.240) * [-653.548] (-650.951) (-644.354) (-654.891) -- 0:00:00

      Average standard deviation of split frequencies: 0.119722

       5500 -- (-653.517) (-656.076) [-654.220] (-657.273) * [-644.645] (-649.269) (-650.839) (-645.150) -- 0:00:00
       6000 -- [-645.052] (-649.986) (-652.647) (-656.567) * [-648.946] (-653.969) (-653.176) (-651.014) -- 0:00:00
       6500 -- (-652.550) (-650.667) (-656.754) [-648.544] * [-645.503] (-655.765) (-657.349) (-651.588) -- 0:00:00
       7000 -- (-651.517) [-648.837] (-653.805) (-651.028) * (-654.443) (-650.566) (-650.614) [-651.542] -- 0:00:00
       7500 -- (-654.664) (-651.389) [-650.234] (-652.921) * (-652.713) (-652.016) (-649.297) [-650.400] -- 0:00:00
       8000 -- (-649.825) (-651.816) [-647.692] (-654.472) * (-652.084) (-650.605) (-651.130) [-654.697] -- 0:00:00
       8500 -- (-652.076) (-652.571) (-648.864) [-653.705] * (-651.017) (-648.335) [-655.878] (-646.858) -- 0:00:00
       9000 -- (-649.795) [-644.922] (-646.507) (-656.572) * (-648.955) (-654.183) (-650.668) [-646.208] -- 0:01:50
       9500 -- (-647.205) (-649.262) (-651.918) [-649.680] * (-654.664) [-648.593] (-645.973) (-655.397) -- 0:01:44
      10000 -- (-649.994) [-647.264] (-645.672) (-651.679) * (-656.006) (-646.891) [-653.663] (-651.948) -- 0:01:39

      Average standard deviation of split frequencies: 0.076112

      10500 -- (-650.386) (-646.562) [-650.928] (-651.263) * (-667.674) [-667.494] (-650.813) (-653.433) -- 0:01:34
      11000 -- (-657.069) (-650.276) [-649.534] (-651.773) * (-643.831) (-652.554) (-650.459) [-648.766] -- 0:01:29
      11500 -- (-654.352) (-654.687) [-645.383] (-650.161) * (-642.182) (-653.988) (-647.142) [-646.304] -- 0:01:25
      12000 -- (-645.900) (-643.096) (-651.769) [-645.912] * (-639.869) (-648.917) [-652.748] (-647.345) -- 0:01:22
      12500 -- (-649.028) (-652.041) (-654.214) [-647.620] * (-643.067) [-648.516] (-652.883) (-660.909) -- 0:01:19
      13000 -- (-657.574) (-653.046) (-654.312) [-646.614] * (-640.498) (-654.180) [-647.508] (-655.361) -- 0:01:15
      13500 -- (-654.952) (-653.621) [-648.470] (-643.800) * (-640.251) (-652.315) [-649.627] (-654.614) -- 0:01:13
      14000 -- [-646.024] (-643.933) (-659.192) (-645.221) * (-640.884) [-643.371] (-650.249) (-650.512) -- 0:01:10
      14500 -- (-652.702) (-650.680) (-644.348) [-653.345] * (-643.108) (-651.543) [-646.587] (-656.425) -- 0:01:07
      15000 -- (-649.434) (-649.238) (-649.013) [-649.478] * (-642.607) [-652.915] (-649.575) (-653.779) -- 0:01:05

      Average standard deviation of split frequencies: 0.053314

      15500 -- [-647.161] (-652.398) (-655.223) (-649.193) * (-641.594) [-653.970] (-648.134) (-648.066) -- 0:01:03
      16000 -- [-644.413] (-646.875) (-646.589) (-645.479) * (-640.437) [-646.821] (-652.636) (-648.670) -- 0:01:01
      16500 -- (-648.768) [-652.826] (-659.968) (-646.566) * [-640.749] (-645.417) (-648.627) (-659.604) -- 0:00:59
      17000 -- [-647.003] (-648.525) (-653.586) (-648.693) * (-644.271) [-651.219] (-654.514) (-654.412) -- 0:00:57
      17500 -- [-646.416] (-643.696) (-659.887) (-645.755) * [-642.294] (-649.153) (-652.413) (-645.053) -- 0:00:56
      18000 -- (-662.433) (-648.695) [-649.679] (-657.785) * (-641.136) (-654.954) (-653.467) [-642.516] -- 0:00:54
      18500 -- [-649.138] (-653.215) (-645.750) (-649.725) * (-649.408) (-653.072) (-647.771) [-641.378] -- 0:00:53
      19000 -- [-646.812] (-649.909) (-651.993) (-646.961) * (-641.394) [-647.802] (-649.039) (-643.320) -- 0:00:51
      19500 -- (-645.327) (-651.097) (-651.062) [-645.196] * (-641.898) (-644.879) [-643.470] (-646.095) -- 0:00:50
      20000 -- (-655.780) [-651.451] (-644.322) (-659.238) * [-642.009] (-649.702) (-662.367) (-640.857) -- 0:00:49

      Average standard deviation of split frequencies: 0.050422

      20500 -- (-651.799) (-650.784) (-647.809) [-653.569] * (-640.523) (-650.078) [-644.804] (-643.447) -- 0:00:47
      21000 -- [-649.849] (-659.535) (-648.988) (-660.905) * (-640.516) (-653.194) [-646.189] (-643.555) -- 0:00:46
      21500 -- [-649.423] (-655.133) (-649.622) (-651.300) * (-644.235) [-648.339] (-647.596) (-640.897) -- 0:00:45
      22000 -- [-654.743] (-645.406) (-650.058) (-650.790) * (-644.582) (-662.204) (-651.055) [-643.551] -- 0:00:44
      22500 -- [-642.885] (-655.096) (-652.627) (-640.490) * (-642.137) [-648.986] (-643.203) (-644.689) -- 0:00:43
      23000 -- [-640.108] (-647.367) (-652.148) (-640.629) * [-642.956] (-647.619) (-642.460) (-644.803) -- 0:00:42
      23500 -- (-644.703) (-650.315) [-647.595] (-642.571) * (-642.654) (-650.983) [-641.976] (-640.115) -- 0:00:41
      24000 -- (-643.661) [-645.392] (-646.546) (-640.382) * [-640.746] (-649.291) (-640.503) (-641.239) -- 0:00:40
      24500 -- (-644.478) (-646.875) [-648.779] (-640.880) * (-639.441) (-649.110) [-640.814] (-642.158) -- 0:00:39
      25000 -- (-639.940) (-660.036) (-649.001) [-642.091] * (-641.276) (-647.852) [-639.905] (-645.324) -- 0:00:39

      Average standard deviation of split frequencies: 0.031945

      25500 -- (-643.313) (-649.565) (-645.438) [-644.391] * (-641.364) (-649.742) [-639.038] (-642.852) -- 0:01:16
      26000 -- (-645.373) (-641.055) (-647.746) [-641.069] * (-643.648) (-646.149) [-640.958] (-643.374) -- 0:01:14
      26500 -- (-639.043) (-643.886) [-647.217] (-642.126) * (-643.805) (-646.868) [-642.117] (-641.680) -- 0:01:13
      27000 -- (-641.770) (-639.204) [-644.416] (-642.294) * (-640.995) (-649.424) [-641.002] (-642.069) -- 0:01:12
      27500 -- (-640.466) [-643.961] (-655.343) (-642.368) * (-642.046) (-653.803) (-639.452) [-641.146] -- 0:01:10
      28000 -- [-639.699] (-644.984) (-646.802) (-640.838) * (-641.525) (-648.755) (-639.295) [-641.551] -- 0:01:09
      28500 -- (-642.875) (-640.779) (-656.773) [-644.071] * (-645.075) (-658.773) [-639.068] (-639.948) -- 0:01:08
      29000 -- [-642.748] (-639.827) (-659.698) (-643.246) * [-642.177] (-646.517) (-641.085) (-642.620) -- 0:01:06
      29500 -- (-645.631) [-641.792] (-652.490) (-641.256) * (-642.902) (-646.942) (-638.934) [-642.250] -- 0:01:05
      30000 -- (-642.706) (-641.774) (-650.599) [-641.424] * [-641.672] (-652.598) (-640.257) (-639.347) -- 0:01:04

      Average standard deviation of split frequencies: 0.037661

      30500 -- (-642.909) [-642.145] (-650.311) (-640.706) * (-641.050) [-653.513] (-639.229) (-638.972) -- 0:01:03
      31000 -- [-640.143] (-640.780) (-660.698) (-642.929) * (-642.215) (-648.379) (-642.608) [-640.403] -- 0:01:02
      31500 -- (-640.117) [-640.846] (-655.876) (-646.785) * (-643.805) (-645.966) (-641.744) [-641.271] -- 0:01:01
      32000 -- (-641.160) (-640.024) [-650.389] (-643.490) * (-640.033) (-657.167) (-646.369) [-641.805] -- 0:01:00
      32500 -- (-641.067) (-639.757) (-646.709) [-640.759] * (-639.175) (-651.316) (-643.961) [-640.994] -- 0:00:59
      33000 -- (-645.682) (-639.885) [-647.441] (-639.363) * (-641.918) (-649.433) [-640.441] (-640.082) -- 0:00:58
      33500 -- (-642.431) (-643.705) (-650.382) [-638.844] * [-639.041] (-646.953) (-640.091) (-644.949) -- 0:00:57
      34000 -- (-639.627) (-639.472) (-645.050) [-638.758] * (-639.984) [-650.208] (-640.085) (-642.079) -- 0:00:56
      34500 -- (-639.607) (-639.602) [-647.738] (-640.605) * (-639.929) [-647.638] (-644.591) (-638.893) -- 0:00:55
      35000 -- (-642.719) (-639.738) (-661.417) [-641.648] * (-639.457) (-651.134) (-644.252) [-639.086] -- 0:00:55

      Average standard deviation of split frequencies: 0.042921

      35500 -- (-640.004) (-639.425) [-651.124] (-641.801) * [-640.492] (-646.529) (-642.126) (-639.249) -- 0:00:54
      36000 -- (-640.598) (-641.123) [-647.725] (-641.081) * [-640.805] (-649.437) (-645.568) (-639.480) -- 0:00:53
      36500 -- (-642.042) (-640.948) [-648.930] (-639.978) * [-642.848] (-645.200) (-647.874) (-641.966) -- 0:00:52
      37000 -- [-641.399] (-641.463) (-654.215) (-640.616) * (-640.915) (-657.404) [-645.571] (-642.374) -- 0:00:52
      37500 -- [-640.751] (-640.501) (-652.084) (-639.204) * [-640.407] (-651.816) (-642.415) (-640.123) -- 0:00:51
      38000 -- [-641.591] (-639.553) (-652.540) (-639.825) * (-640.252) (-657.896) (-641.608) [-640.906] -- 0:00:50
      38500 -- (-642.330) (-643.541) (-656.086) [-639.347] * (-644.895) [-646.707] (-642.856) (-640.372) -- 0:00:49
      39000 -- (-641.986) (-641.920) (-662.284) [-641.356] * [-639.393] (-655.624) (-642.165) (-641.545) -- 0:00:49
      39500 -- (-640.634) (-640.261) (-646.439) [-643.280] * [-642.740] (-656.916) (-640.182) (-640.986) -- 0:00:48
      40000 -- [-639.303] (-644.215) (-643.329) (-641.344) * (-641.788) (-649.904) (-642.335) [-640.410] -- 0:00:48

      Average standard deviation of split frequencies: 0.038185

      40500 -- (-639.912) (-646.534) [-639.726] (-642.195) * (-642.630) (-652.551) (-641.599) [-640.368] -- 0:00:47
      41000 -- (-640.253) (-641.444) [-639.092] (-641.608) * (-638.864) [-653.821] (-643.676) (-642.258) -- 0:00:46
      41500 -- (-641.392) (-640.973) (-640.129) [-639.221] * [-639.526] (-648.566) (-645.971) (-640.192) -- 0:01:09
      42000 -- (-639.487) (-640.639) [-640.042] (-639.233) * (-639.525) (-651.069) (-640.284) [-640.675] -- 0:01:08
      42500 -- (-641.886) (-640.157) (-639.682) [-641.849] * (-639.985) [-650.756] (-640.918) (-638.951) -- 0:01:07
      43000 -- (-640.227) (-640.576) [-643.093] (-640.324) * [-641.016] (-651.738) (-642.401) (-640.041) -- 0:01:06
      43500 -- [-640.166] (-640.442) (-640.695) (-639.777) * (-640.656) (-653.050) (-642.067) [-642.565] -- 0:01:05
      44000 -- (-643.502) (-644.619) (-639.238) [-639.725] * [-641.344] (-659.102) (-640.891) (-639.612) -- 0:01:05
      44500 -- [-643.094] (-644.068) (-640.650) (-640.374) * (-641.321) (-659.218) (-642.051) [-639.250] -- 0:01:04
      45000 -- (-641.615) (-640.221) (-642.810) [-641.039] * (-640.350) (-649.163) (-643.588) [-642.829] -- 0:01:03

      Average standard deviation of split frequencies: 0.032793

      45500 -- [-640.067] (-640.196) (-639.538) (-645.236) * (-640.837) [-640.234] (-643.061) (-641.912) -- 0:01:02
      46000 -- (-643.118) [-641.920] (-641.702) (-639.974) * (-639.471) (-639.219) (-642.524) [-642.764] -- 0:01:02
      46500 -- (-647.256) (-643.060) (-640.194) [-640.142] * [-639.128] (-642.216) (-641.751) (-644.541) -- 0:01:01
      47000 -- (-645.111) [-641.703] (-643.215) (-640.741) * (-638.990) (-643.801) (-639.925) [-640.231] -- 0:01:00
      47500 -- (-642.183) [-641.022] (-642.581) (-646.283) * (-639.334) [-639.499] (-642.853) (-642.081) -- 0:01:00
      48000 -- (-642.419) (-640.693) (-640.092) [-640.514] * (-641.477) (-642.284) (-645.541) [-641.088] -- 0:00:59
      48500 -- (-639.193) [-640.234] (-640.231) (-643.001) * [-641.244] (-642.913) (-643.573) (-642.241) -- 0:00:58
      49000 -- [-641.656] (-641.233) (-644.334) (-640.249) * (-641.531) (-641.779) (-641.330) [-645.861] -- 0:00:58
      49500 -- (-639.379) (-643.723) [-640.729] (-640.154) * (-642.287) [-642.026] (-640.331) (-642.565) -- 0:00:57
      50000 -- [-643.069] (-639.940) (-640.626) (-641.985) * (-647.581) (-642.506) (-639.485) [-640.293] -- 0:00:57

      Average standard deviation of split frequencies: 0.032047

      50500 -- (-639.494) [-642.685] (-640.838) (-641.422) * (-640.271) (-642.800) [-639.851] (-639.793) -- 0:00:56
      51000 -- (-640.338) (-641.430) [-640.857] (-641.093) * (-644.410) [-642.428] (-639.905) (-640.813) -- 0:00:55
      51500 -- (-643.162) [-640.493] (-640.617) (-639.900) * (-641.513) (-643.447) (-641.168) [-639.722] -- 0:00:55
      52000 -- [-640.167] (-643.399) (-644.291) (-644.823) * (-639.609) [-641.515] (-642.865) (-643.440) -- 0:00:54
      52500 -- (-639.815) (-641.200) [-639.463] (-641.308) * (-640.988) [-642.260] (-641.934) (-645.258) -- 0:00:54
      53000 -- (-640.362) [-641.025] (-641.078) (-644.929) * (-642.511) [-640.855] (-644.947) (-639.877) -- 0:00:53
      53500 -- [-639.658] (-640.203) (-641.380) (-643.138) * (-641.350) [-641.485] (-644.414) (-639.036) -- 0:00:53
      54000 -- (-639.328) [-640.597] (-640.617) (-642.410) * (-640.752) (-640.808) (-646.375) [-639.548] -- 0:00:52
      54500 -- (-639.914) (-639.571) (-639.788) [-642.850] * [-644.143] (-641.135) (-641.998) (-640.875) -- 0:00:52
      55000 -- (-639.789) [-639.459] (-639.725) (-639.778) * (-639.242) (-642.157) [-640.527] (-641.112) -- 0:00:51

      Average standard deviation of split frequencies: 0.028995

      55500 -- (-640.416) (-639.122) (-641.361) [-640.640] * [-639.998] (-640.143) (-642.059) (-646.738) -- 0:00:51
      56000 -- (-640.920) [-646.430] (-640.139) (-646.830) * (-640.108) [-640.191] (-639.707) (-644.271) -- 0:00:50
      56500 -- [-639.532] (-639.464) (-642.363) (-641.955) * (-640.341) [-639.764] (-638.970) (-641.420) -- 0:00:50
      57000 -- (-641.550) [-643.146] (-641.104) (-645.573) * (-640.058) (-641.529) (-643.640) [-641.684] -- 0:00:49
      57500 -- (-643.237) (-643.121) [-639.752] (-648.460) * (-639.869) [-642.120] (-640.219) (-640.861) -- 0:00:49
      58000 -- [-641.058] (-644.125) (-638.957) (-641.222) * (-639.666) [-639.254] (-641.667) (-639.529) -- 0:01:04
      58500 -- (-640.670) [-641.208] (-639.716) (-639.951) * (-644.099) (-639.835) (-639.510) [-640.805] -- 0:01:04
      59000 -- (-643.526) (-643.688) [-640.475] (-643.701) * (-641.399) [-639.054] (-639.574) (-640.710) -- 0:01:03
      59500 -- (-639.982) (-641.052) (-639.240) [-640.042] * (-641.420) (-641.844) (-639.957) [-644.756] -- 0:01:03
      60000 -- (-644.815) (-643.541) [-643.254] (-640.030) * (-643.785) [-640.810] (-639.758) (-646.643) -- 0:01:02

      Average standard deviation of split frequencies: 0.024606

      60500 -- (-642.141) [-639.847] (-643.659) (-640.029) * (-645.812) [-640.523] (-639.403) (-644.021) -- 0:01:02
      61000 -- (-642.032) (-640.247) (-645.165) [-640.613] * (-643.654) [-639.979] (-639.594) (-640.847) -- 0:01:01
      61500 -- (-639.409) (-639.643) [-641.084] (-640.075) * (-641.752) (-641.524) (-639.282) [-640.065] -- 0:01:01
      62000 -- (-640.759) (-644.015) (-642.431) [-639.370] * (-641.213) (-641.595) [-641.688] (-640.082) -- 0:01:00
      62500 -- [-642.105] (-644.302) (-645.205) (-639.339) * [-640.202] (-641.472) (-641.479) (-641.010) -- 0:01:00
      63000 -- (-641.759) [-639.923] (-642.128) (-639.339) * (-640.767) [-642.699] (-640.579) (-643.457) -- 0:00:59
      63500 -- (-638.907) [-639.028] (-642.430) (-646.786) * [-639.387] (-640.022) (-640.788) (-640.700) -- 0:00:58
      64000 -- [-639.385] (-639.635) (-640.863) (-643.262) * (-640.228) (-640.835) [-639.390] (-643.528) -- 0:00:58
      64500 -- (-640.989) (-641.798) [-639.514] (-641.896) * (-645.172) (-640.617) (-641.201) [-644.658] -- 0:00:58
      65000 -- (-641.580) (-639.855) [-639.830] (-642.951) * (-641.882) (-641.587) [-639.588] (-642.564) -- 0:00:57

      Average standard deviation of split frequencies: 0.025939

      65500 -- (-640.336) (-640.059) [-641.041] (-643.073) * (-641.581) (-640.510) [-641.254] (-641.126) -- 0:00:57
      66000 -- (-643.235) [-641.018] (-643.986) (-642.386) * (-642.437) (-641.167) [-642.880] (-643.143) -- 0:00:56
      66500 -- (-640.508) [-640.750] (-639.429) (-642.531) * [-640.634] (-640.601) (-644.247) (-640.068) -- 0:00:56
      67000 -- (-642.323) [-642.497] (-641.915) (-641.905) * [-640.853] (-643.534) (-642.842) (-642.519) -- 0:00:55
      67500 -- (-641.334) [-641.207] (-642.897) (-640.558) * (-639.424) (-640.588) [-641.094] (-644.192) -- 0:00:55
      68000 -- (-641.974) (-642.207) [-643.408] (-639.432) * (-639.179) (-639.467) [-639.803] (-642.379) -- 0:00:54
      68500 -- (-642.845) (-643.451) [-641.743] (-640.301) * (-639.245) (-641.141) (-640.617) [-642.285] -- 0:00:54
      69000 -- (-643.009) (-644.977) (-643.269) [-640.679] * (-639.097) (-639.948) [-639.269] (-640.303) -- 0:00:53
      69500 -- [-641.009] (-640.558) (-644.531) (-640.405) * (-640.599) [-641.182] (-639.678) (-640.118) -- 0:00:53
      70000 -- (-641.193) (-643.237) [-639.751] (-640.057) * (-641.934) (-641.669) [-639.570] (-642.558) -- 0:00:53

      Average standard deviation of split frequencies: 0.025942

      70500 -- (-640.864) (-643.019) [-640.117] (-640.950) * [-639.738] (-643.320) (-641.225) (-640.793) -- 0:00:52
      71000 -- (-642.490) [-642.386] (-639.418) (-640.728) * (-640.156) [-640.894] (-639.129) (-641.239) -- 0:00:52
      71500 -- (-641.816) [-640.399] (-643.076) (-641.209) * (-639.448) [-639.193] (-642.229) (-639.226) -- 0:00:51
      72000 -- (-640.892) (-640.483) [-645.011] (-639.495) * [-641.076] (-641.805) (-642.118) (-639.230) -- 0:00:51
      72500 -- [-638.957] (-639.972) (-641.177) (-639.881) * (-641.663) (-642.873) [-640.785] (-640.899) -- 0:00:51
      73000 -- (-639.885) (-640.134) (-642.068) [-639.674] * (-640.198) [-641.027] (-644.633) (-639.361) -- 0:00:50
      73500 -- (-641.384) (-640.839) (-641.460) [-644.901] * (-642.179) (-639.465) [-639.575] (-640.325) -- 0:00:50
      74000 -- (-648.042) (-640.778) (-643.316) [-641.299] * (-641.202) [-639.554] (-643.381) (-641.611) -- 0:00:50
      74500 -- (-646.149) (-644.354) (-640.385) [-640.246] * (-641.687) (-640.003) [-645.426] (-641.752) -- 0:00:49
      75000 -- [-641.241] (-646.439) (-644.337) (-641.872) * (-641.789) (-646.670) [-641.124] (-640.344) -- 0:01:01

      Average standard deviation of split frequencies: 0.026878

      75500 -- (-642.444) [-640.918] (-638.875) (-642.996) * (-642.209) (-644.060) (-640.469) [-643.805] -- 0:01:01
      76000 -- [-641.201] (-640.471) (-638.806) (-640.685) * (-645.327) (-641.231) [-642.473] (-639.901) -- 0:01:00
      76500 -- (-641.107) (-641.951) [-640.785] (-639.288) * (-640.958) [-640.726] (-642.041) (-641.783) -- 0:01:00
      77000 -- [-641.962] (-641.975) (-640.884) (-641.345) * (-640.443) (-646.922) [-645.860] (-642.222) -- 0:00:59
      77500 -- (-638.982) (-642.135) [-644.140] (-647.323) * (-642.523) [-639.271] (-643.611) (-642.908) -- 0:00:59
      78000 -- [-640.896] (-640.880) (-641.870) (-639.710) * [-641.197] (-645.134) (-641.796) (-641.103) -- 0:00:59
      78500 -- (-641.572) (-646.505) [-639.897] (-640.971) * (-639.552) (-639.555) [-641.469] (-641.394) -- 0:00:58
      79000 -- (-643.596) (-642.232) [-639.395] (-641.210) * [-640.041] (-641.523) (-644.965) (-641.407) -- 0:00:58
      79500 -- (-642.317) (-644.165) [-642.088] (-642.634) * (-640.071) (-641.465) [-641.807] (-641.077) -- 0:00:57
      80000 -- (-640.105) (-641.808) (-640.484) [-641.367] * (-641.598) (-639.716) [-643.798] (-640.440) -- 0:00:57

      Average standard deviation of split frequencies: 0.024106

      80500 -- [-642.803] (-640.477) (-640.584) (-640.127) * (-644.208) (-640.391) [-643.647] (-646.848) -- 0:00:57
      81000 -- [-640.527] (-641.892) (-643.859) (-643.520) * (-640.534) (-641.856) [-640.710] (-645.313) -- 0:00:56
      81500 -- (-639.776) (-640.248) [-640.473] (-641.450) * (-642.544) (-642.039) (-639.807) [-641.699] -- 0:00:56
      82000 -- [-639.395] (-640.063) (-645.809) (-639.487) * (-644.158) (-642.623) (-642.265) [-641.272] -- 0:00:55
      82500 -- (-642.807) (-641.622) (-643.395) [-638.997] * (-643.089) (-641.063) [-642.345] (-645.250) -- 0:00:55
      83000 -- (-644.469) (-640.396) [-641.350] (-641.604) * (-640.613) [-642.489] (-643.108) (-641.457) -- 0:00:55
      83500 -- (-640.057) [-643.054] (-640.582) (-640.673) * (-640.574) [-642.112] (-640.498) (-640.524) -- 0:00:54
      84000 -- (-640.887) (-639.342) [-639.510] (-640.766) * (-639.579) (-643.418) [-641.452] (-641.082) -- 0:00:54
      84500 -- (-640.710) (-643.196) (-640.591) [-641.508] * (-641.077) (-642.589) [-641.172] (-646.128) -- 0:00:54
      85000 -- (-641.726) [-643.337] (-641.855) (-640.815) * (-640.660) [-639.753] (-641.474) (-646.596) -- 0:00:53

      Average standard deviation of split frequencies: 0.024667

      85500 -- (-642.295) (-642.498) [-641.763] (-642.410) * (-643.203) (-640.189) [-641.197] (-646.633) -- 0:00:53
      86000 -- (-642.425) (-639.908) (-640.174) [-641.675] * (-640.803) [-641.230] (-640.936) (-644.212) -- 0:00:53
      86500 -- (-643.440) (-641.148) (-640.491) [-639.286] * (-640.086) [-641.990] (-641.234) (-639.429) -- 0:00:52
      87000 -- [-643.402] (-639.705) (-644.228) (-642.879) * (-645.339) (-639.576) [-643.551] (-640.467) -- 0:00:52
      87500 -- (-641.552) (-639.348) [-640.817] (-641.510) * (-640.166) [-642.634] (-641.745) (-643.032) -- 0:00:52
      88000 -- (-640.999) (-645.409) [-640.799] (-640.401) * (-639.737) (-643.144) [-640.618] (-642.159) -- 0:00:51
      88500 -- (-640.986) (-641.211) [-640.510] (-644.453) * (-639.488) [-640.733] (-639.188) (-639.192) -- 0:00:51
      89000 -- (-642.821) [-641.596] (-642.589) (-641.207) * (-639.285) (-641.558) [-640.603] (-642.090) -- 0:00:51
      89500 -- (-643.047) [-639.403] (-639.916) (-641.429) * (-639.251) (-640.745) [-640.528] (-639.647) -- 0:00:50
      90000 -- (-643.446) (-641.475) [-642.347] (-640.105) * (-640.026) [-641.417] (-640.508) (-640.143) -- 0:00:50

      Average standard deviation of split frequencies: 0.026302

      90500 -- (-642.509) (-645.290) [-643.919] (-639.418) * [-639.674] (-641.546) (-640.003) (-640.423) -- 0:00:50
      91000 -- (-640.186) (-641.062) (-642.654) [-640.551] * (-639.866) [-642.540] (-641.734) (-640.399) -- 0:00:49
      91500 -- [-642.507] (-640.037) (-639.153) (-640.236) * (-640.116) (-643.801) (-640.394) [-639.699] -- 0:00:59
      92000 -- [-646.899] (-641.267) (-639.013) (-641.001) * (-640.761) (-640.702) [-640.944] (-639.942) -- 0:00:59
      92500 -- (-642.555) [-640.541] (-644.581) (-641.664) * (-642.388) (-640.074) (-645.485) [-642.445] -- 0:00:58
      93000 -- (-642.417) (-640.994) (-643.595) [-639.803] * (-640.014) (-640.514) (-639.597) [-639.604] -- 0:00:58
      93500 -- (-639.837) (-640.594) (-644.945) [-639.655] * (-641.206) (-644.143) [-642.542] (-640.573) -- 0:00:58
      94000 -- (-640.366) [-641.086] (-639.998) (-641.702) * (-641.066) (-643.192) (-640.930) [-642.726] -- 0:00:57
      94500 -- (-640.275) [-640.788] (-644.244) (-641.222) * (-640.546) [-641.236] (-644.709) (-642.671) -- 0:00:57
      95000 -- (-639.022) (-639.360) [-641.176] (-645.734) * [-640.312] (-640.637) (-643.125) (-640.204) -- 0:00:57

      Average standard deviation of split frequencies: 0.022915

      95500 -- (-642.259) (-640.380) (-640.491) [-641.604] * (-643.173) [-639.954] (-640.832) (-639.998) -- 0:00:56
      96000 -- (-641.601) (-644.607) (-643.651) [-642.236] * (-640.551) (-640.815) (-642.308) [-642.132] -- 0:00:56
      96500 -- (-641.606) [-642.208] (-643.683) (-641.599) * (-640.848) (-642.705) [-641.929] (-639.829) -- 0:00:56
      97000 -- (-642.822) (-642.872) (-641.430) [-640.012] * [-640.248] (-644.413) (-643.144) (-641.485) -- 0:00:55
      97500 -- [-640.081] (-640.666) (-640.532) (-644.000) * [-641.420] (-646.018) (-640.513) (-639.292) -- 0:00:55
      98000 -- (-641.792) [-640.499] (-642.371) (-640.778) * [-643.496] (-642.379) (-646.882) (-639.055) -- 0:00:55
      98500 -- [-642.068] (-643.062) (-640.554) (-640.297) * [-641.408] (-641.314) (-639.778) (-641.739) -- 0:00:54
      99000 -- (-643.526) (-639.837) (-640.615) [-639.948] * (-640.767) [-639.936] (-640.113) (-640.537) -- 0:00:54
      99500 -- (-641.328) [-640.918] (-639.608) (-642.205) * (-639.349) (-642.731) [-642.325] (-643.408) -- 0:00:54
      100000 -- (-640.214) (-641.647) [-642.437] (-639.733) * (-644.263) [-640.834] (-642.818) (-641.573) -- 0:00:54

      Average standard deviation of split frequencies: 0.022588

      100500 -- [-639.939] (-639.708) (-641.924) (-639.599) * (-638.938) (-642.493) [-642.855] (-640.049) -- 0:00:53
      101000 -- (-641.828) (-641.241) (-640.936) [-639.696] * [-643.575] (-645.967) (-639.269) (-639.295) -- 0:00:53
      101500 -- [-640.888] (-644.873) (-640.789) (-641.306) * (-640.952) [-642.332] (-643.393) (-640.858) -- 0:00:53
      102000 -- (-641.658) (-639.876) (-640.001) [-642.496] * (-641.716) (-641.800) (-642.120) [-639.851] -- 0:00:52
      102500 -- (-646.942) (-642.470) (-641.833) [-639.481] * (-641.486) (-641.761) [-641.838] (-642.209) -- 0:00:52
      103000 -- (-645.011) [-639.752] (-643.961) (-644.273) * (-640.862) [-642.350] (-641.743) (-639.619) -- 0:00:52
      103500 -- (-642.557) (-640.013) [-643.433] (-643.437) * (-639.690) [-641.049] (-642.447) (-639.312) -- 0:00:51
      104000 -- [-641.129] (-641.940) (-643.609) (-640.771) * [-639.774] (-643.594) (-639.648) (-642.750) -- 0:00:51
      104500 -- [-641.500] (-644.041) (-645.138) (-643.962) * (-640.076) (-640.073) [-639.418] (-641.080) -- 0:00:51
      105000 -- (-640.713) (-642.442) (-639.283) [-640.805] * (-639.938) (-640.312) (-640.010) [-642.280] -- 0:00:51

      Average standard deviation of split frequencies: 0.021248

      105500 -- (-642.125) [-641.412] (-639.489) (-640.493) * (-644.839) (-639.989) [-639.939] (-639.630) -- 0:00:50
      106000 -- (-645.673) [-642.869] (-641.921) (-639.236) * (-642.433) (-639.692) (-642.661) [-640.190] -- 0:00:50
      106500 -- (-640.304) [-640.765] (-641.232) (-640.780) * (-641.994) [-641.755] (-641.083) (-640.146) -- 0:00:50
      107000 -- (-640.419) (-642.842) [-639.003] (-642.189) * (-642.996) [-645.206] (-643.587) (-640.253) -- 0:00:50
      107500 -- (-645.321) (-642.254) (-641.381) [-639.592] * (-641.442) [-643.202] (-640.197) (-642.277) -- 0:00:49
      108000 -- [-640.001] (-643.303) (-640.468) (-641.532) * (-639.376) (-643.059) [-639.908] (-644.504) -- 0:00:57
      108500 -- (-644.014) (-646.355) (-641.532) [-641.175] * (-639.788) (-643.857) (-641.731) [-642.027] -- 0:00:57
      109000 -- (-641.112) (-641.608) (-641.327) [-639.619] * [-640.063] (-640.532) (-639.320) (-640.870) -- 0:00:57
      109500 -- [-639.063] (-640.273) (-640.103) (-641.005) * (-640.980) [-639.382] (-639.439) (-641.243) -- 0:00:56
      110000 -- [-641.699] (-640.120) (-642.646) (-641.679) * (-640.069) [-639.824] (-640.464) (-641.048) -- 0:00:56

      Average standard deviation of split frequencies: 0.024611

      110500 -- (-644.928) (-639.710) (-646.396) [-643.520] * (-639.772) [-639.431] (-640.761) (-639.784) -- 0:00:56
      111000 -- [-641.140] (-641.175) (-642.769) (-639.729) * [-640.467] (-643.914) (-642.035) (-640.253) -- 0:00:56
      111500 -- [-639.393] (-642.110) (-640.233) (-639.408) * [-641.460] (-645.918) (-640.047) (-642.250) -- 0:00:55
      112000 -- [-643.321] (-640.833) (-640.114) (-638.861) * [-640.245] (-644.683) (-640.334) (-645.790) -- 0:00:55
      112500 -- (-645.126) (-641.103) [-642.000] (-639.906) * (-640.892) (-639.241) [-640.855] (-646.624) -- 0:00:55
      113000 -- [-642.345] (-642.959) (-642.988) (-644.613) * (-639.920) (-641.890) (-640.229) [-642.474] -- 0:00:54
      113500 -- (-643.079) [-644.045] (-646.149) (-641.171) * (-640.566) (-644.555) (-641.387) [-642.867] -- 0:00:54
      114000 -- (-639.887) (-643.386) (-640.833) [-640.708] * (-640.938) [-642.745] (-643.721) (-642.180) -- 0:00:54
      114500 -- (-641.009) [-641.049] (-639.507) (-642.867) * (-640.478) (-640.480) [-641.293] (-640.074) -- 0:00:54
      115000 -- (-638.912) (-649.687) [-642.393] (-646.380) * (-643.767) [-640.751] (-643.235) (-644.600) -- 0:00:53

      Average standard deviation of split frequencies: 0.021514

      115500 -- (-639.672) [-640.412] (-642.831) (-642.328) * [-643.269] (-641.273) (-641.087) (-640.482) -- 0:00:53
      116000 -- (-640.623) (-639.523) (-640.857) [-639.830] * (-640.759) (-645.134) (-639.326) [-640.449] -- 0:00:53
      116500 -- [-639.363] (-639.364) (-638.791) (-642.568) * (-639.268) [-641.696] (-641.175) (-648.390) -- 0:00:53
      117000 -- (-641.032) [-640.011] (-640.290) (-642.599) * [-644.223] (-642.918) (-643.747) (-646.351) -- 0:00:52
      117500 -- (-643.691) (-641.691) [-640.470] (-639.439) * (-642.131) (-647.114) (-644.415) [-646.209] -- 0:00:52
      118000 -- (-640.129) (-644.315) [-639.662] (-641.003) * (-640.691) (-644.901) [-641.837] (-646.903) -- 0:00:52
      118500 -- (-640.781) (-641.107) (-641.243) [-640.630] * (-641.244) [-643.061] (-643.658) (-640.991) -- 0:00:52
      119000 -- (-641.972) (-641.495) (-641.640) [-639.586] * (-639.038) (-642.745) [-640.045] (-641.113) -- 0:00:51
      119500 -- (-641.856) (-643.152) [-638.990] (-640.864) * (-639.880) (-640.310) [-641.813] (-642.337) -- 0:00:51
      120000 -- (-646.826) (-643.187) [-639.491] (-639.533) * (-642.784) (-643.419) (-639.818) [-640.254] -- 0:00:51

      Average standard deviation of split frequencies: 0.020619

      120500 -- (-642.156) (-641.018) (-640.473) [-640.183] * [-642.341] (-641.066) (-641.779) (-642.395) -- 0:00:51
      121000 -- (-642.760) (-644.842) (-643.051) [-641.764] * (-641.654) [-640.635] (-640.953) (-640.597) -- 0:00:50
      121500 -- (-642.726) [-641.051] (-643.811) (-642.530) * (-647.074) (-640.081) (-641.247) [-639.774] -- 0:00:50
      122000 -- (-641.433) (-643.346) [-640.229] (-642.536) * (-640.652) (-640.088) (-641.892) [-642.365] -- 0:00:50
      122500 -- (-641.282) (-640.515) [-639.726] (-643.318) * (-639.636) (-641.993) (-641.971) [-641.467] -- 0:00:50
      123000 -- [-640.490] (-644.382) (-643.818) (-641.390) * (-639.381) [-643.300] (-642.623) (-644.122) -- 0:00:49
      123500 -- [-640.999] (-639.192) (-640.325) (-639.353) * (-640.069) (-639.849) [-642.640] (-640.013) -- 0:00:49
      124000 -- (-641.005) (-640.087) (-639.561) [-640.421] * (-640.952) (-640.409) [-641.775] (-641.277) -- 0:00:49
      124500 -- [-644.503] (-644.341) (-641.794) (-640.294) * (-641.677) [-640.877] (-640.211) (-645.202) -- 0:00:49
      125000 -- (-643.382) (-641.003) [-640.900] (-641.529) * (-639.648) (-643.387) (-640.767) [-639.382] -- 0:00:56

      Average standard deviation of split frequencies: 0.020676

      125500 -- (-641.858) [-643.487] (-644.266) (-641.206) * (-641.231) (-645.203) [-640.762] (-640.609) -- 0:00:55
      126000 -- [-643.438] (-643.661) (-640.791) (-641.123) * (-641.004) (-642.649) [-643.393] (-642.058) -- 0:00:55
      126500 -- (-641.122) (-645.006) (-641.558) [-640.660] * (-639.844) (-641.990) [-641.813] (-639.744) -- 0:00:55
      127000 -- (-642.347) [-640.373] (-641.430) (-644.436) * (-641.027) [-641.905] (-639.630) (-640.011) -- 0:00:54
      127500 -- (-641.348) (-641.195) (-646.737) [-641.665] * (-641.026) (-640.147) (-641.732) [-641.875] -- 0:00:54
      128000 -- [-639.859] (-641.288) (-644.558) (-642.589) * (-638.861) (-639.607) [-641.756] (-643.745) -- 0:00:54
      128500 -- (-645.663) [-640.241] (-639.034) (-642.442) * (-640.549) (-641.683) (-639.500) [-645.260] -- 0:00:54
      129000 -- (-643.545) [-640.624] (-641.887) (-641.382) * (-640.290) (-639.897) (-643.029) [-643.940] -- 0:00:54
      129500 -- (-640.064) [-642.559] (-640.007) (-643.492) * [-640.260] (-642.667) (-643.139) (-640.366) -- 0:00:53
      130000 -- (-640.504) (-642.543) (-639.535) [-641.923] * (-641.605) (-640.854) (-640.073) [-640.314] -- 0:00:53

      Average standard deviation of split frequencies: 0.015916

      130500 -- [-642.031] (-641.657) (-641.677) (-640.266) * (-639.820) [-640.514] (-641.681) (-642.595) -- 0:00:53
      131000 -- (-641.193) [-641.050] (-641.243) (-642.532) * (-639.811) (-641.298) (-640.827) [-644.123] -- 0:00:53
      131500 -- (-639.793) (-640.364) [-639.716] (-639.709) * (-639.955) (-639.710) [-640.350] (-643.425) -- 0:00:52
      132000 -- (-638.926) (-641.783) (-639.786) [-640.204] * (-639.501) [-639.991] (-640.547) (-645.695) -- 0:00:52
      132500 -- (-640.101) (-640.892) [-641.965] (-642.043) * (-639.077) (-645.147) (-639.883) [-641.356] -- 0:00:52
      133000 -- (-641.701) (-640.526) [-641.007] (-642.790) * (-641.926) (-639.775) [-639.094] (-640.926) -- 0:00:52
      133500 -- (-642.058) (-641.003) [-640.928] (-641.004) * (-639.580) (-642.243) [-641.032] (-639.567) -- 0:00:51
      134000 -- (-639.955) (-640.889) [-642.521] (-642.981) * (-639.937) [-641.254] (-643.095) (-643.203) -- 0:00:51
      134500 -- [-642.198] (-642.724) (-642.255) (-640.910) * (-642.633) [-639.323] (-640.280) (-640.928) -- 0:00:51
      135000 -- (-642.532) (-643.641) [-640.401] (-642.417) * (-641.804) (-640.467) (-642.500) [-640.383] -- 0:00:51

      Average standard deviation of split frequencies: 0.014443

      135500 -- [-641.318] (-640.110) (-643.736) (-642.814) * (-641.275) (-639.731) (-641.050) [-639.805] -- 0:00:51
      136000 -- (-644.222) [-641.466] (-639.829) (-642.708) * [-639.609] (-640.448) (-640.957) (-644.512) -- 0:00:50
      136500 -- [-643.990] (-638.992) (-639.540) (-642.640) * (-642.272) (-644.737) [-641.281] (-640.553) -- 0:00:50
      137000 -- (-639.868) (-641.133) [-640.650] (-646.338) * (-645.480) (-641.311) [-640.820] (-641.250) -- 0:00:50
      137500 -- (-640.786) (-642.441) [-640.477] (-640.692) * (-639.750) (-641.523) [-639.590] (-640.859) -- 0:00:50
      138000 -- (-642.400) [-640.470] (-640.595) (-646.708) * (-640.010) [-642.283] (-641.735) (-639.363) -- 0:00:49
      138500 -- (-646.617) (-640.749) (-643.683) [-639.993] * (-643.037) [-640.377] (-641.275) (-640.158) -- 0:00:49
      139000 -- [-640.314] (-642.989) (-639.538) (-641.342) * (-642.177) (-643.107) (-640.676) [-641.803] -- 0:00:49
      139500 -- (-641.001) (-639.206) [-639.943] (-642.932) * [-641.121] (-643.798) (-642.840) (-641.357) -- 0:00:49
      140000 -- (-640.464) [-641.157] (-640.731) (-645.265) * (-639.494) (-640.739) [-640.028] (-640.203) -- 0:00:49

      Average standard deviation of split frequencies: 0.017128

      140500 -- (-639.946) (-638.890) [-641.677] (-639.777) * (-640.073) [-642.193] (-642.055) (-643.944) -- 0:00:48
      141000 -- [-640.035] (-642.807) (-642.105) (-639.588) * (-639.634) [-642.018] (-640.601) (-643.089) -- 0:00:48
      141500 -- [-641.744] (-643.446) (-640.460) (-641.358) * (-640.559) (-643.297) (-640.279) [-642.302] -- 0:00:54
      142000 -- [-639.833] (-640.723) (-642.640) (-643.533) * (-640.354) (-643.192) (-640.221) [-645.063] -- 0:00:54
      142500 -- (-640.956) [-641.045] (-644.484) (-641.853) * (-641.570) [-640.190] (-641.080) (-642.651) -- 0:00:54
      143000 -- (-641.172) (-639.741) (-644.771) [-645.294] * (-641.699) (-639.040) [-643.393] (-638.859) -- 0:00:53
      143500 -- [-639.895] (-639.710) (-641.857) (-644.882) * [-640.012] (-641.228) (-641.218) (-640.667) -- 0:00:53
      144000 -- (-641.575) (-646.300) (-640.272) [-639.825] * (-639.578) (-640.249) (-639.938) [-640.620] -- 0:00:53
      144500 -- (-645.403) (-640.187) [-642.131] (-642.548) * (-642.477) (-640.154) [-642.891] (-641.847) -- 0:00:53
      145000 -- [-642.782] (-640.425) (-642.171) (-641.582) * (-642.714) [-639.475] (-639.956) (-640.703) -- 0:00:53

      Average standard deviation of split frequencies: 0.017164

      145500 -- (-642.342) [-642.345] (-642.468) (-642.052) * (-640.221) [-639.913] (-642.067) (-644.147) -- 0:00:52
      146000 -- [-640.885] (-644.135) (-641.918) (-638.997) * (-640.064) [-640.240] (-641.562) (-640.880) -- 0:00:52
      146500 -- (-644.353) (-639.983) (-640.887) [-639.825] * [-642.010] (-645.894) (-642.084) (-641.347) -- 0:00:52
      147000 -- (-642.588) [-642.440] (-641.554) (-642.258) * (-641.794) (-640.220) [-642.122] (-640.232) -- 0:00:52
      147500 -- [-642.445] (-640.823) (-642.803) (-643.756) * (-643.506) (-642.080) [-640.059] (-639.474) -- 0:00:52
      148000 -- (-644.914) [-640.361] (-640.738) (-641.385) * [-643.461] (-642.425) (-640.309) (-640.213) -- 0:00:51
      148500 -- (-641.211) (-641.114) (-643.343) [-642.059] * [-640.781] (-641.745) (-639.548) (-642.063) -- 0:00:51
      149000 -- [-643.378] (-645.085) (-641.347) (-642.125) * (-644.454) (-641.042) [-640.051] (-640.441) -- 0:00:51
      149500 -- (-641.414) (-641.241) [-640.932] (-641.696) * (-640.246) [-641.691] (-644.733) (-641.520) -- 0:00:51
      150000 -- (-641.219) (-639.897) (-641.222) [-642.493] * [-640.775] (-642.779) (-644.047) (-642.013) -- 0:00:51

      Average standard deviation of split frequencies: 0.016961

      150500 -- (-642.159) (-643.700) (-640.774) [-641.020] * (-642.405) [-640.425] (-640.269) (-639.529) -- 0:00:50
      151000 -- (-641.245) [-640.967] (-643.149) (-641.118) * (-641.508) [-640.385] (-640.361) (-648.423) -- 0:00:50
      151500 -- (-641.433) [-640.931] (-645.201) (-643.438) * [-644.554] (-643.897) (-641.475) (-645.837) -- 0:00:50
      152000 -- [-642.629] (-640.500) (-640.197) (-644.460) * (-641.994) [-640.875] (-642.284) (-644.043) -- 0:00:50
      152500 -- (-639.176) (-643.913) (-641.864) [-642.516] * (-644.454) (-638.929) [-640.198] (-644.453) -- 0:00:50
      153000 -- (-639.013) (-644.288) (-642.292) [-641.945] * (-640.501) (-639.824) [-640.952] (-641.870) -- 0:00:49
      153500 -- [-639.124] (-643.777) (-641.661) (-642.108) * [-640.443] (-639.705) (-641.656) (-639.633) -- 0:00:49
      154000 -- (-639.333) (-642.547) [-642.360] (-642.087) * (-644.192) (-640.810) (-639.817) [-639.780] -- 0:00:49
      154500 -- [-639.336] (-641.757) (-641.421) (-640.411) * (-648.879) [-641.084] (-640.756) (-642.507) -- 0:00:49
      155000 -- [-640.368] (-644.266) (-645.409) (-640.097) * [-642.281] (-639.130) (-648.273) (-642.917) -- 0:00:49

      Average standard deviation of split frequencies: 0.015268

      155500 -- (-641.999) [-640.089] (-647.880) (-642.379) * (-641.253) [-640.079] (-652.884) (-641.612) -- 0:00:48
      156000 -- (-641.259) [-640.233] (-642.344) (-644.922) * (-642.883) (-640.713) [-639.168] (-642.898) -- 0:00:48
      156500 -- (-641.782) (-642.449) [-639.234] (-645.071) * (-641.111) (-640.533) [-639.842] (-643.353) -- 0:00:48
      157000 -- (-642.359) (-638.797) [-640.849] (-642.440) * [-641.257] (-641.575) (-643.187) (-641.044) -- 0:00:48
      157500 -- [-642.157] (-642.571) (-640.094) (-642.160) * (-644.935) (-640.807) (-641.185) [-640.965] -- 0:00:48
      158000 -- (-641.083) (-640.593) [-640.511] (-640.478) * (-650.268) (-641.651) (-642.162) [-640.909] -- 0:00:53
      158500 -- (-639.062) (-640.322) (-641.235) [-639.421] * [-644.238] (-640.300) (-641.680) (-643.558) -- 0:00:53
      159000 -- (-640.301) [-641.572] (-641.512) (-644.803) * (-639.742) (-640.161) (-640.373) [-642.106] -- 0:00:52
      159500 -- [-640.265] (-642.737) (-639.295) (-644.587) * (-639.628) (-640.011) (-641.472) [-641.558] -- 0:00:52
      160000 -- [-640.328] (-640.625) (-639.287) (-640.849) * (-641.659) [-641.609] (-644.182) (-643.722) -- 0:00:52

      Average standard deviation of split frequencies: 0.015597

      160500 -- [-642.068] (-640.648) (-643.039) (-641.778) * (-639.452) (-639.922) [-641.845] (-642.479) -- 0:00:52
      161000 -- (-639.909) [-641.014] (-640.428) (-642.201) * [-643.398] (-640.407) (-640.035) (-644.391) -- 0:00:52
      161500 -- (-639.333) [-639.660] (-642.705) (-640.966) * [-640.663] (-640.838) (-641.810) (-644.292) -- 0:00:51
      162000 -- (-640.478) [-639.756] (-643.384) (-639.672) * [-641.197] (-640.761) (-642.283) (-641.756) -- 0:00:51
      162500 -- (-639.675) (-641.765) (-640.243) [-642.648] * (-640.392) [-642.028] (-641.190) (-643.872) -- 0:00:51
      163000 -- (-642.114) (-641.498) (-640.717) [-641.305] * [-640.195] (-644.239) (-640.604) (-641.213) -- 0:00:51
      163500 -- (-639.438) [-641.868] (-640.022) (-642.429) * (-639.114) [-644.609] (-640.357) (-642.199) -- 0:00:51
      164000 -- (-640.542) (-642.297) [-643.571] (-642.683) * [-639.439] (-642.517) (-640.051) (-640.206) -- 0:00:50
      164500 -- [-642.855] (-641.598) (-641.191) (-639.310) * (-639.422) [-642.854] (-639.170) (-638.867) -- 0:00:50
      165000 -- (-641.087) [-641.258] (-639.815) (-640.091) * [-639.899] (-641.037) (-641.673) (-639.774) -- 0:00:50

      Average standard deviation of split frequencies: 0.014348

      165500 -- (-641.587) (-641.963) [-639.404] (-643.377) * [-642.512] (-641.331) (-644.335) (-641.681) -- 0:00:50
      166000 -- (-639.966) (-641.499) (-639.474) [-641.854] * [-641.387] (-644.211) (-638.762) (-640.180) -- 0:00:50
      166500 -- (-639.844) (-641.317) [-640.125] (-639.893) * [-643.841] (-641.428) (-642.180) (-641.819) -- 0:00:50
      167000 -- (-640.662) (-641.278) [-638.919] (-640.533) * [-639.071] (-647.705) (-639.441) (-640.524) -- 0:00:49
      167500 -- (-640.404) (-640.571) (-639.443) [-640.141] * (-644.867) (-643.340) [-639.468] (-643.001) -- 0:00:49
      168000 -- (-643.931) [-639.486] (-641.880) (-641.635) * [-642.679] (-639.543) (-641.161) (-640.845) -- 0:00:49
      168500 -- (-644.521) [-640.103] (-639.937) (-643.359) * (-640.512) (-639.809) [-639.312] (-643.877) -- 0:00:49
      169000 -- (-643.079) [-639.985] (-640.075) (-639.085) * (-641.558) [-640.601] (-641.965) (-640.700) -- 0:00:49
      169500 -- [-641.274] (-640.143) (-641.988) (-643.191) * [-642.273] (-642.033) (-642.627) (-640.576) -- 0:00:48
      170000 -- [-642.308] (-641.841) (-639.688) (-640.927) * (-641.025) (-640.983) (-645.742) [-641.462] -- 0:00:48

      Average standard deviation of split frequencies: 0.015744

      170500 -- (-639.651) (-640.752) [-639.321] (-639.786) * [-639.596] (-640.253) (-639.713) (-650.989) -- 0:00:48
      171000 -- (-642.666) [-644.023] (-639.710) (-639.805) * [-639.552] (-640.971) (-641.575) (-649.215) -- 0:00:48
      171500 -- (-641.102) (-640.475) [-639.515] (-639.221) * (-640.408) (-640.898) [-641.055] (-640.881) -- 0:00:48
      172000 -- (-640.655) [-641.140] (-640.315) (-639.354) * [-642.626] (-639.906) (-641.090) (-639.724) -- 0:00:48
      172500 -- (-641.057) [-641.008] (-640.339) (-645.393) * (-649.493) [-641.899] (-643.607) (-639.526) -- 0:00:47
      173000 -- (-640.210) (-640.699) [-642.200] (-645.008) * (-650.382) (-639.739) [-642.110] (-640.525) -- 0:00:47
      173500 -- (-641.833) (-639.601) (-640.164) [-644.254] * (-641.629) [-640.751] (-640.283) (-643.209) -- 0:00:47
      174000 -- [-639.099] (-641.737) (-641.371) (-643.096) * (-641.302) (-640.115) [-642.565] (-645.717) -- 0:00:52
      174500 -- (-639.477) (-642.275) [-641.773] (-642.618) * (-642.396) (-640.384) (-641.705) [-641.994] -- 0:00:52
      175000 -- [-640.701] (-642.855) (-641.033) (-640.078) * (-645.703) (-641.421) (-643.385) [-642.798] -- 0:00:51

      Average standard deviation of split frequencies: 0.016071

      175500 -- (-639.975) [-642.826] (-640.203) (-640.075) * (-643.980) (-642.120) (-641.205) [-642.436] -- 0:00:51
      176000 -- (-642.926) [-640.467] (-639.733) (-645.795) * [-642.283] (-641.034) (-639.625) (-644.695) -- 0:00:51
      176500 -- [-640.996] (-639.650) (-641.046) (-645.579) * [-638.923] (-639.716) (-639.423) (-642.570) -- 0:00:51
      177000 -- (-640.039) (-642.469) (-640.997) [-640.059] * (-647.633) [-640.417] (-639.501) (-640.133) -- 0:00:51
      177500 -- [-643.440] (-640.218) (-641.407) (-640.791) * (-646.227) [-638.744] (-638.899) (-641.149) -- 0:00:50
      178000 -- (-640.452) (-639.406) [-639.566] (-639.412) * (-644.925) (-639.759) [-640.760] (-641.087) -- 0:00:50
      178500 -- (-645.300) [-640.160] (-640.520) (-639.122) * (-642.556) [-640.226] (-640.163) (-639.113) -- 0:00:50
      179000 -- (-640.514) (-639.892) [-639.550] (-640.588) * (-639.778) (-643.243) [-639.263] (-639.219) -- 0:00:50
      179500 -- (-643.253) (-641.011) (-641.017) [-639.894] * (-642.867) [-642.588] (-639.287) (-639.219) -- 0:00:50
      180000 -- (-642.311) [-641.442] (-639.299) (-643.090) * (-641.445) [-639.896] (-639.364) (-639.834) -- 0:00:50

      Average standard deviation of split frequencies: 0.016342

      180500 -- (-642.581) [-641.701] (-642.046) (-642.262) * [-641.608] (-640.938) (-643.845) (-641.002) -- 0:00:49
      181000 -- [-642.035] (-642.057) (-641.360) (-644.241) * (-640.063) (-644.002) [-639.721] (-640.208) -- 0:00:49
      181500 -- (-640.535) (-642.166) [-642.698] (-641.280) * (-643.486) [-640.391] (-642.621) (-638.938) -- 0:00:49
      182000 -- (-641.237) (-644.081) (-642.134) [-641.675] * (-641.820) (-641.437) [-639.150] (-650.677) -- 0:00:49
      182500 -- [-641.271] (-646.215) (-641.579) (-642.530) * (-644.040) (-642.841) (-640.993) [-645.975] -- 0:00:49
      183000 -- (-646.400) [-640.486] (-640.193) (-640.145) * (-641.265) (-642.220) [-641.913] (-644.275) -- 0:00:49
      183500 -- (-641.528) (-639.549) [-641.496] (-640.655) * (-646.450) (-642.537) (-640.211) [-643.305] -- 0:00:48
      184000 -- (-639.715) (-641.370) [-641.746] (-639.773) * (-645.620) (-643.988) (-640.982) [-641.843] -- 0:00:48
      184500 -- [-639.165] (-639.611) (-645.230) (-640.367) * (-639.284) (-641.246) (-639.546) [-640.721] -- 0:00:48
      185000 -- (-640.119) (-640.687) (-640.783) [-642.515] * (-641.595) (-641.546) [-640.212] (-644.651) -- 0:00:48

      Average standard deviation of split frequencies: 0.016407

      185500 -- [-642.599] (-641.577) (-645.241) (-639.266) * (-641.657) [-640.820] (-639.871) (-645.712) -- 0:00:48
      186000 -- (-644.302) (-641.774) (-640.812) [-642.375] * (-642.559) [-641.186] (-639.865) (-639.315) -- 0:00:48
      186500 -- (-641.892) (-639.187) [-641.288] (-640.074) * (-645.090) [-643.266] (-638.884) (-639.900) -- 0:00:47
      187000 -- (-640.998) [-640.367] (-639.653) (-640.653) * (-642.203) (-642.317) [-639.801] (-640.945) -- 0:00:47
      187500 -- (-642.520) (-638.983) [-638.924] (-640.547) * (-640.510) [-640.965] (-639.381) (-641.051) -- 0:00:47
      188000 -- (-644.788) (-644.620) [-639.467] (-641.922) * (-641.783) [-641.063] (-639.021) (-640.320) -- 0:00:47
      188500 -- (-640.477) (-640.357) [-642.013] (-639.925) * (-645.358) (-642.366) (-642.510) [-639.816] -- 0:00:47
      189000 -- (-640.979) [-640.291] (-646.818) (-639.816) * [-641.089] (-640.924) (-641.926) (-639.437) -- 0:00:47
      189500 -- (-641.745) (-640.887) (-640.798) [-642.221] * [-639.581] (-640.091) (-641.897) (-642.740) -- 0:00:47
      190000 -- (-641.912) (-640.152) (-640.480) [-641.018] * [-643.925] (-641.331) (-639.439) (-639.989) -- 0:00:46

      Average standard deviation of split frequencies: 0.018608

      190500 -- [-639.778] (-642.787) (-640.711) (-641.468) * (-640.397) [-642.207] (-640.552) (-639.288) -- 0:00:50
      191000 -- (-641.199) [-642.517] (-642.772) (-645.610) * (-639.852) (-642.316) [-639.685] (-643.138) -- 0:00:50
      191500 -- (-643.079) [-639.961] (-645.263) (-643.347) * (-639.798) (-644.102) [-640.213] (-640.935) -- 0:00:50
      192000 -- (-640.760) (-639.677) [-645.891] (-644.613) * (-642.504) (-644.474) [-643.188] (-642.148) -- 0:00:50
      192500 -- (-640.951) (-639.233) (-644.858) [-641.639] * (-641.985) [-642.977] (-639.857) (-641.057) -- 0:00:50
      193000 -- [-642.954] (-645.128) (-640.080) (-639.393) * (-644.247) (-643.918) (-644.322) [-640.805] -- 0:00:50
      193500 -- (-641.267) [-640.481] (-640.933) (-640.134) * (-642.801) [-640.284] (-645.119) (-639.817) -- 0:00:50
      194000 -- (-641.386) [-639.664] (-640.661) (-639.032) * (-641.915) [-641.527] (-639.056) (-643.353) -- 0:00:49
      194500 -- [-640.586] (-640.723) (-640.963) (-639.749) * (-644.208) (-639.659) (-639.542) [-645.669] -- 0:00:49
      195000 -- (-639.749) (-640.649) [-640.689] (-639.913) * [-642.522] (-640.107) (-639.456) (-647.118) -- 0:00:49

      Average standard deviation of split frequencies: 0.018988

      195500 -- (-639.704) (-640.796) (-640.787) [-641.099] * [-643.662] (-641.629) (-639.949) (-644.529) -- 0:00:49
      196000 -- (-643.859) (-639.849) [-639.331] (-641.835) * (-644.509) (-641.645) (-642.461) [-640.743] -- 0:00:49
      196500 -- (-642.943) [-639.539] (-639.217) (-644.557) * (-641.822) [-643.838] (-639.517) (-643.069) -- 0:00:49
      197000 -- (-642.007) [-643.195] (-641.236) (-641.689) * [-640.248] (-643.074) (-640.602) (-641.026) -- 0:00:48
      197500 -- (-639.599) (-641.826) (-639.944) [-644.384] * (-642.738) (-640.817) [-643.301] (-640.236) -- 0:00:48
      198000 -- (-644.389) (-643.595) [-641.690] (-644.368) * [-643.222] (-641.718) (-640.570) (-640.966) -- 0:00:48
      198500 -- (-639.509) (-642.171) [-640.155] (-642.417) * (-640.438) (-642.360) (-639.445) [-642.481] -- 0:00:48
      199000 -- [-639.487] (-645.945) (-639.337) (-643.424) * (-644.146) (-640.170) [-639.732] (-641.928) -- 0:00:48
      199500 -- (-638.831) [-641.922] (-639.537) (-640.324) * [-640.524] (-642.644) (-639.139) (-641.985) -- 0:00:48
      200000 -- [-639.589] (-641.886) (-639.989) (-645.894) * (-641.311) [-643.489] (-639.129) (-643.550) -- 0:00:48

      Average standard deviation of split frequencies: 0.020154

      200500 -- (-643.276) (-640.585) [-641.469] (-640.251) * (-640.823) (-641.073) (-640.972) [-639.531] -- 0:00:47
      201000 -- (-641.689) [-641.186] (-640.049) (-643.188) * (-644.891) [-641.702] (-639.986) (-640.522) -- 0:00:47
      201500 -- [-640.534] (-644.715) (-639.381) (-640.021) * (-640.803) [-642.185] (-642.740) (-640.512) -- 0:00:47
      202000 -- (-640.829) (-641.042) (-639.641) [-640.284] * (-639.389) [-643.118] (-639.492) (-639.427) -- 0:00:47
      202500 -- (-644.705) (-641.238) (-639.195) [-640.715] * (-639.198) (-640.349) [-640.052] (-640.425) -- 0:00:47
      203000 -- (-641.588) (-641.112) (-641.801) [-643.755] * [-639.699] (-641.210) (-640.309) (-640.372) -- 0:00:47
      203500 -- [-644.372] (-640.804) (-642.069) (-640.349) * (-641.709) (-642.203) (-640.956) [-639.634] -- 0:00:46
      204000 -- (-640.126) (-641.373) (-645.283) [-643.320] * (-641.001) (-642.295) [-642.987] (-641.077) -- 0:00:46
      204500 -- (-640.231) (-644.083) [-641.785] (-641.011) * (-639.172) (-640.872) (-640.490) [-639.512] -- 0:00:46
      205000 -- (-640.744) (-643.863) [-639.786] (-640.116) * (-639.162) (-644.767) (-642.712) [-638.928] -- 0:00:46

      Average standard deviation of split frequencies: 0.021679

      205500 -- (-643.602) (-640.021) (-642.083) [-641.227] * (-639.687) (-642.230) (-639.840) [-639.082] -- 0:00:46
      206000 -- [-640.718] (-641.806) (-640.415) (-640.279) * [-641.274] (-645.472) (-643.003) (-639.557) -- 0:00:46
      206500 -- [-645.407] (-641.156) (-641.814) (-640.731) * (-640.542) [-645.465] (-643.749) (-640.317) -- 0:00:46
      207000 -- (-647.158) (-644.253) [-642.240] (-643.087) * [-640.302] (-643.381) (-643.044) (-640.519) -- 0:00:49
      207500 -- (-641.170) (-639.292) (-644.307) [-640.897] * (-643.124) [-640.150] (-640.800) (-639.248) -- 0:00:49
      208000 -- (-641.624) [-640.860] (-639.786) (-640.113) * (-642.297) (-641.423) [-640.577] (-639.084) -- 0:00:49
      208500 -- (-643.174) (-639.466) (-648.960) [-640.085] * [-641.511] (-639.848) (-644.612) (-639.299) -- 0:00:49
      209000 -- [-640.207] (-639.741) (-645.159) (-639.396) * (-638.837) (-642.528) (-639.931) [-640.269] -- 0:00:49
      209500 -- (-640.005) (-640.546) [-640.268] (-641.588) * (-639.850) [-642.444] (-640.209) (-640.583) -- 0:00:49
      210000 -- (-642.169) [-641.338] (-640.774) (-646.813) * (-642.267) [-640.781] (-639.923) (-639.335) -- 0:00:48

      Average standard deviation of split frequencies: 0.021146

      210500 -- (-644.371) [-640.118] (-640.318) (-639.855) * (-641.419) (-640.384) [-639.970] (-640.625) -- 0:00:48
      211000 -- (-642.516) (-640.836) [-640.248] (-639.880) * [-641.779] (-641.822) (-639.276) (-640.492) -- 0:00:48
      211500 -- [-638.800] (-642.392) (-644.318) (-643.745) * (-643.174) (-643.978) (-642.110) [-640.390] -- 0:00:48
      212000 -- [-638.902] (-640.819) (-642.955) (-643.594) * (-642.542) (-645.219) [-639.547] (-643.499) -- 0:00:48
      212500 -- (-639.547) (-639.529) (-641.107) [-641.389] * (-640.582) (-647.210) [-641.889] (-641.296) -- 0:00:48
      213000 -- (-640.681) [-641.565] (-648.501) (-645.064) * (-641.673) (-647.829) [-642.047] (-641.970) -- 0:00:48
      213500 -- [-641.006] (-641.183) (-644.784) (-640.532) * (-641.177) (-644.771) (-640.445) [-639.605] -- 0:00:47
      214000 -- (-640.960) (-641.092) (-641.006) [-639.598] * [-643.384] (-641.672) (-642.291) (-647.507) -- 0:00:47
      214500 -- (-641.988) [-640.396] (-642.443) (-639.178) * (-640.638) (-642.230) [-641.495] (-650.260) -- 0:00:47
      215000 -- (-641.242) (-643.693) [-639.938] (-639.545) * (-640.764) [-640.977] (-642.360) (-641.777) -- 0:00:47

      Average standard deviation of split frequencies: 0.022188

      215500 -- (-640.602) (-640.181) [-639.067] (-641.613) * (-641.877) (-642.084) (-641.422) [-640.199] -- 0:00:47
      216000 -- (-640.213) (-639.442) [-641.654] (-639.093) * [-641.902] (-640.833) (-640.399) (-639.296) -- 0:00:47
      216500 -- [-639.607] (-641.852) (-643.635) (-640.734) * [-641.602] (-639.586) (-639.827) (-640.466) -- 0:00:47
      217000 -- (-641.352) (-640.354) [-642.327] (-639.682) * (-639.522) (-644.729) (-641.945) [-642.203] -- 0:00:46
      217500 -- [-640.797] (-640.515) (-642.362) (-642.502) * [-644.049] (-640.298) (-642.051) (-642.255) -- 0:00:46
      218000 -- (-639.758) (-640.207) [-640.947] (-641.738) * (-643.923) (-639.534) (-642.267) [-639.598] -- 0:00:46
      218500 -- (-641.272) (-640.206) [-640.147] (-640.320) * (-639.770) (-639.921) [-640.272] (-641.932) -- 0:00:46
      219000 -- (-642.280) (-641.839) (-641.238) [-641.840] * [-641.905] (-640.637) (-639.056) (-641.352) -- 0:00:46
      219500 -- (-640.415) [-641.652] (-642.640) (-640.868) * (-643.527) (-642.048) [-645.867] (-641.008) -- 0:00:46
      220000 -- (-640.523) (-640.261) [-639.750] (-643.161) * (-641.479) (-643.994) [-646.795] (-642.174) -- 0:00:46

      Average standard deviation of split frequencies: 0.019867

      220500 -- [-641.794] (-642.201) (-640.003) (-641.546) * (-644.438) (-639.782) (-641.664) [-641.802] -- 0:00:45
      221000 -- (-640.976) (-642.200) [-639.136] (-640.855) * (-643.822) [-640.858] (-641.848) (-640.439) -- 0:00:45
      221500 -- [-640.145] (-643.147) (-641.768) (-641.292) * (-641.801) (-641.569) (-645.665) [-639.571] -- 0:00:45
      222000 -- [-640.736] (-642.106) (-643.041) (-640.933) * [-639.914] (-648.543) (-641.047) (-640.316) -- 0:00:45
      222500 -- [-642.498] (-640.770) (-639.331) (-640.931) * (-639.706) (-639.347) (-640.526) [-640.961] -- 0:00:45
      223000 -- (-643.981) (-640.626) [-639.099] (-643.059) * (-639.732) (-639.099) (-642.252) [-641.348] -- 0:00:45
      223500 -- (-639.666) [-640.987] (-640.805) (-638.824) * (-642.086) [-639.926] (-641.788) (-641.193) -- 0:00:48
      224000 -- (-641.537) [-640.320] (-640.348) (-641.724) * (-640.334) (-640.687) (-639.431) [-640.668] -- 0:00:48
      224500 -- (-641.389) (-641.627) (-641.229) [-643.299] * (-640.758) (-639.367) [-640.111] (-639.863) -- 0:00:48
      225000 -- [-640.266] (-639.202) (-639.726) (-642.360) * (-640.384) (-640.702) (-647.082) [-641.644] -- 0:00:48

      Average standard deviation of split frequencies: 0.019816

      225500 -- (-639.597) (-639.282) [-639.192] (-642.611) * (-640.455) (-640.515) (-641.054) [-639.255] -- 0:00:48
      226000 -- (-638.752) [-639.481] (-640.072) (-644.816) * (-650.378) (-643.648) [-640.384] (-640.828) -- 0:00:47
      226500 -- (-638.795) [-640.733] (-642.014) (-640.682) * (-642.343) [-640.331] (-642.821) (-642.478) -- 0:00:47
      227000 -- (-640.517) (-642.066) [-642.728] (-639.158) * (-642.551) (-643.019) (-643.489) [-642.806] -- 0:00:47
      227500 -- (-643.538) (-640.417) [-639.046] (-639.678) * (-641.705) (-640.512) (-640.243) [-639.464] -- 0:00:47
      228000 -- (-640.925) (-641.204) (-639.728) [-639.285] * (-641.621) [-639.552] (-639.564) (-640.314) -- 0:00:47
      228500 -- [-640.363] (-642.836) (-642.209) (-640.521) * (-642.553) (-640.691) (-641.159) [-643.072] -- 0:00:47
      229000 -- [-639.178] (-641.841) (-641.749) (-640.399) * (-641.914) (-640.894) [-640.170] (-642.110) -- 0:00:47
      229500 -- (-638.969) (-640.597) (-642.206) [-639.632] * (-639.637) (-642.673) [-640.377] (-640.877) -- 0:00:47
      230000 -- (-639.805) (-642.181) (-643.223) [-641.359] * (-641.606) [-641.748] (-642.611) (-640.962) -- 0:00:46

      Average standard deviation of split frequencies: 0.018904

      230500 -- [-639.882] (-640.113) (-641.756) (-642.923) * (-640.339) (-639.003) [-640.054] (-641.406) -- 0:00:46
      231000 -- [-639.568] (-639.496) (-641.100) (-639.305) * (-639.579) [-642.936] (-640.211) (-640.211) -- 0:00:46
      231500 -- (-640.460) (-639.299) (-641.550) [-642.809] * (-641.888) (-642.849) [-644.867] (-642.716) -- 0:00:46
      232000 -- (-641.352) (-639.893) (-640.850) [-642.010] * [-640.552] (-641.736) (-641.226) (-641.359) -- 0:00:46
      232500 -- (-642.236) [-638.847] (-639.927) (-642.242) * (-640.681) [-640.316] (-640.693) (-641.970) -- 0:00:46
      233000 -- (-642.419) [-638.990] (-641.428) (-643.387) * (-640.478) [-641.014] (-640.001) (-640.359) -- 0:00:46
      233500 -- (-642.354) (-642.183) (-640.673) [-643.511] * (-646.008) (-641.938) [-642.105] (-640.804) -- 0:00:45
      234000 -- (-645.159) (-643.731) [-641.444] (-641.584) * (-642.390) [-639.709] (-646.273) (-641.644) -- 0:00:45
      234500 -- (-639.434) [-641.098] (-640.344) (-641.272) * [-641.629] (-640.245) (-644.010) (-640.604) -- 0:00:45
      235000 -- (-641.301) [-640.742] (-642.497) (-642.260) * (-643.641) [-639.945] (-641.680) (-643.166) -- 0:00:45

      Average standard deviation of split frequencies: 0.018776

      235500 -- (-644.589) (-641.427) [-642.035] (-641.107) * [-645.109] (-641.194) (-639.290) (-640.256) -- 0:00:45
      236000 -- (-646.346) (-640.407) (-642.018) [-641.566] * [-640.686] (-644.141) (-640.670) (-641.475) -- 0:00:45
      236500 -- [-642.896] (-643.110) (-640.777) (-639.163) * (-641.204) (-646.548) (-641.267) [-640.692] -- 0:00:45
      237000 -- (-641.528) [-640.353] (-641.726) (-641.827) * (-645.181) (-640.758) (-640.727) [-642.759] -- 0:00:45
      237500 -- [-640.621] (-643.187) (-639.764) (-641.721) * (-641.128) (-641.104) (-644.148) [-639.863] -- 0:00:44
      238000 -- (-642.107) [-640.479] (-640.328) (-640.644) * (-643.184) [-641.341] (-643.607) (-642.375) -- 0:00:44
      238500 -- (-646.019) (-642.121) (-646.661) [-643.902] * (-643.296) (-640.767) [-641.949] (-644.826) -- 0:00:44
      239000 -- [-642.728] (-642.024) (-644.107) (-642.309) * [-641.605] (-646.742) (-639.718) (-642.488) -- 0:00:44
      239500 -- (-640.601) (-643.317) (-643.492) [-643.372] * (-641.087) (-644.747) [-640.974] (-639.719) -- 0:00:44
      240000 -- (-641.536) (-643.068) [-639.883] (-640.349) * [-640.991] (-640.640) (-641.627) (-640.428) -- 0:00:44

      Average standard deviation of split frequencies: 0.017629

      240500 -- [-640.593] (-642.964) (-639.175) (-642.466) * (-641.361) (-640.502) (-641.464) [-640.832] -- 0:00:47
      241000 -- (-641.455) (-641.585) (-642.913) [-641.092] * (-639.527) [-641.704] (-643.399) (-640.435) -- 0:00:47
      241500 -- (-641.061) [-642.342] (-645.598) (-641.926) * (-642.587) (-641.489) [-640.598] (-640.114) -- 0:00:47
      242000 -- [-646.251] (-641.245) (-642.104) (-641.748) * [-639.565] (-641.543) (-646.988) (-643.372) -- 0:00:46
      242500 -- [-640.512] (-641.265) (-641.185) (-640.433) * (-640.270) (-644.034) (-639.860) [-642.663] -- 0:00:46
      243000 -- [-639.178] (-643.392) (-641.237) (-641.839) * (-639.632) [-640.021] (-639.239) (-641.988) -- 0:00:46
      243500 -- (-646.545) [-639.988] (-642.889) (-645.428) * (-644.534) (-641.198) (-638.936) [-639.141] -- 0:00:46
      244000 -- (-645.119) [-640.522] (-640.977) (-645.121) * (-640.821) (-639.542) (-641.602) [-639.112] -- 0:00:46
      244500 -- (-640.992) (-644.673) (-640.130) [-639.943] * (-640.020) (-641.535) [-639.946] (-640.330) -- 0:00:46
      245000 -- [-640.057] (-640.743) (-641.045) (-643.444) * (-644.831) (-640.208) (-646.188) [-639.641] -- 0:00:46

      Average standard deviation of split frequencies: 0.017726

      245500 -- (-641.271) (-641.899) (-648.195) [-643.325] * (-641.286) [-639.497] (-643.489) (-641.564) -- 0:00:46
      246000 -- (-643.524) (-641.073) (-645.903) [-644.278] * (-640.526) [-640.459] (-644.734) (-639.766) -- 0:00:45
      246500 -- (-641.901) (-641.327) (-645.036) [-642.595] * (-640.613) (-639.419) (-641.749) [-640.377] -- 0:00:45
      247000 -- [-643.172] (-641.095) (-645.012) (-642.808) * [-640.256] (-642.488) (-640.477) (-640.195) -- 0:00:45
      247500 -- (-641.156) (-640.950) (-641.292) [-640.329] * (-639.187) [-641.963] (-643.285) (-645.063) -- 0:00:45
      248000 -- (-640.512) (-641.892) [-642.828] (-640.586) * (-639.481) (-644.482) [-639.379] (-643.414) -- 0:00:45
      248500 -- [-639.489] (-641.477) (-643.944) (-640.984) * (-642.286) [-640.074] (-640.939) (-643.786) -- 0:00:45
      249000 -- (-640.711) (-643.649) [-641.330] (-641.412) * [-641.253] (-643.308) (-641.760) (-642.396) -- 0:00:45
      249500 -- (-643.535) (-645.097) (-643.023) [-643.221] * (-640.671) (-642.936) [-641.556] (-644.023) -- 0:00:45
      250000 -- (-639.121) (-642.728) (-640.486) [-641.278] * (-640.608) (-640.479) [-642.337] (-642.010) -- 0:00:45

      Average standard deviation of split frequencies: 0.018242

      250500 -- [-640.015] (-644.108) (-640.724) (-641.150) * (-641.237) (-642.090) [-640.392] (-645.300) -- 0:00:44
      251000 -- (-641.031) (-640.466) [-641.571] (-640.234) * (-641.918) [-640.404] (-641.129) (-640.118) -- 0:00:44
      251500 -- (-640.371) (-642.757) (-640.301) [-642.303] * (-641.998) (-641.948) [-640.381] (-639.815) -- 0:00:44
      252000 -- (-640.456) (-639.214) [-639.548] (-641.122) * (-640.214) [-644.234] (-642.059) (-641.201) -- 0:00:44
      252500 -- [-639.497] (-640.007) (-645.148) (-641.931) * (-641.891) [-642.042] (-641.754) (-640.037) -- 0:00:44
      253000 -- [-645.106] (-647.566) (-643.576) (-642.011) * (-642.375) (-640.383) [-640.826] (-640.194) -- 0:00:44
      253500 -- (-641.018) (-639.603) [-641.666] (-640.541) * [-641.901] (-639.763) (-639.474) (-640.260) -- 0:00:44
      254000 -- [-643.857] (-641.466) (-643.908) (-640.842) * [-643.086] (-640.216) (-640.270) (-640.634) -- 0:00:44
      254500 -- [-642.209] (-639.783) (-641.050) (-640.511) * (-639.976) (-641.685) (-639.101) [-640.591] -- 0:00:43
      255000 -- (-642.913) (-639.803) [-641.485] (-639.491) * (-644.111) (-640.080) (-641.813) [-639.864] -- 0:00:43

      Average standard deviation of split frequencies: 0.020051

      255500 -- [-639.992] (-643.026) (-640.077) (-640.332) * (-641.868) [-642.124] (-641.711) (-640.656) -- 0:00:43
      256000 -- [-640.026] (-639.217) (-639.452) (-639.350) * (-640.437) (-640.115) [-641.967] (-640.492) -- 0:00:43
      256500 -- (-640.562) (-639.921) (-643.367) [-641.287] * (-641.519) [-643.305] (-640.792) (-643.031) -- 0:00:43
      257000 -- [-640.765] (-642.570) (-644.416) (-643.972) * [-640.139] (-647.250) (-644.660) (-641.518) -- 0:00:46
      257500 -- (-641.568) [-642.403] (-644.130) (-645.364) * [-639.845] (-643.810) (-640.753) (-640.477) -- 0:00:46
      258000 -- (-638.847) (-640.510) (-644.232) [-643.513] * (-642.120) [-641.313] (-641.142) (-641.770) -- 0:00:46
      258500 -- (-639.348) [-640.619] (-641.209) (-642.322) * (-641.410) (-640.823) (-640.525) [-639.952] -- 0:00:45
      259000 -- [-643.697] (-640.866) (-641.984) (-640.877) * (-641.519) (-641.587) (-641.888) [-639.515] -- 0:00:45
      259500 -- (-641.715) (-639.843) (-642.354) [-644.806] * (-645.398) (-643.276) (-641.098) [-639.662] -- 0:00:45
      260000 -- [-640.940] (-639.872) (-643.872) (-640.702) * (-639.045) [-640.035] (-641.400) (-639.860) -- 0:00:45

      Average standard deviation of split frequencies: 0.019290

      260500 -- (-641.964) (-640.447) (-641.076) [-641.493] * [-640.593] (-642.385) (-643.324) (-640.314) -- 0:00:45
      261000 -- (-642.520) (-641.846) (-644.210) [-639.739] * (-639.494) (-639.574) [-645.744] (-639.605) -- 0:00:45
      261500 -- [-640.572] (-640.877) (-641.002) (-639.481) * (-640.750) (-642.183) [-640.370] (-643.268) -- 0:00:45
      262000 -- [-643.543] (-640.273) (-640.355) (-641.916) * (-642.630) (-639.979) [-640.276] (-641.642) -- 0:00:45
      262500 -- (-641.842) (-640.497) [-643.119] (-640.562) * [-639.373] (-642.135) (-640.453) (-642.637) -- 0:00:44
      263000 -- (-643.723) (-640.350) [-640.846] (-642.169) * (-640.854) [-642.175] (-640.612) (-640.856) -- 0:00:44
      263500 -- (-641.733) (-639.852) (-638.929) [-641.452] * (-641.362) (-641.636) (-644.954) [-640.145] -- 0:00:44
      264000 -- [-639.835] (-639.535) (-641.797) (-640.628) * (-647.348) (-641.927) (-642.559) [-640.686] -- 0:00:44
      264500 -- [-641.989] (-638.940) (-641.062) (-645.887) * (-644.924) (-641.694) (-640.404) [-640.511] -- 0:00:44
      265000 -- [-640.595] (-643.101) (-640.229) (-639.360) * (-640.453) (-639.282) [-642.224] (-643.669) -- 0:00:44

      Average standard deviation of split frequencies: 0.018095

      265500 -- [-641.454] (-640.045) (-641.009) (-643.415) * [-639.591] (-640.277) (-641.675) (-645.112) -- 0:00:44
      266000 -- [-641.655] (-643.363) (-640.078) (-643.084) * (-642.928) (-640.870) (-642.254) [-642.733] -- 0:00:44
      266500 -- [-640.672] (-643.053) (-640.569) (-640.117) * (-639.528) (-639.695) [-638.994] (-640.994) -- 0:00:44
      267000 -- [-641.455] (-639.238) (-639.884) (-639.691) * [-646.631] (-644.782) (-640.111) (-640.100) -- 0:00:43
      267500 -- (-642.639) [-642.187] (-640.786) (-639.069) * [-643.755] (-641.231) (-640.055) (-640.298) -- 0:00:43
      268000 -- (-642.644) (-639.972) [-639.548] (-639.008) * (-642.411) [-640.645] (-640.265) (-641.476) -- 0:00:43
      268500 -- [-642.501] (-642.995) (-641.089) (-639.173) * [-640.071] (-645.777) (-643.082) (-648.089) -- 0:00:43
      269000 -- (-640.079) (-644.721) [-641.419] (-639.749) * (-639.570) (-640.125) [-644.057] (-641.599) -- 0:00:43
      269500 -- [-639.983] (-643.718) (-640.606) (-640.801) * [-641.588] (-640.591) (-642.317) (-642.182) -- 0:00:43
      270000 -- (-641.008) (-643.117) [-639.652] (-641.283) * (-640.864) [-639.221] (-640.264) (-641.629) -- 0:00:43

      Average standard deviation of split frequencies: 0.017329

      270500 -- (-643.188) [-641.379] (-641.151) (-640.670) * (-642.051) (-641.707) (-640.664) [-642.459] -- 0:00:43
      271000 -- (-641.164) [-641.883] (-642.553) (-639.911) * (-639.863) [-642.790] (-642.227) (-641.880) -- 0:00:43
      271500 -- (-640.382) (-643.580) [-639.361] (-640.812) * (-645.834) (-641.133) [-640.307] (-642.669) -- 0:00:42
      272000 -- (-642.769) (-642.022) (-641.281) [-642.374] * (-643.472) [-642.322] (-641.116) (-645.687) -- 0:00:42
      272500 -- (-640.573) (-647.340) (-641.912) [-641.062] * [-639.720] (-640.851) (-639.033) (-643.460) -- 0:00:42
      273000 -- [-640.958] (-641.625) (-644.785) (-642.038) * (-639.145) (-641.100) (-639.822) [-641.738] -- 0:00:45
      273500 -- (-639.923) (-642.636) (-641.447) [-641.096] * (-640.770) [-640.196] (-640.614) (-645.150) -- 0:00:45
      274000 -- (-640.520) (-639.924) (-640.316) [-641.233] * (-643.976) (-643.581) (-640.591) [-642.540] -- 0:00:45
      274500 -- [-641.415] (-639.368) (-640.721) (-641.828) * (-643.525) (-642.286) (-642.687) [-643.699] -- 0:00:44
      275000 -- (-639.372) [-641.155] (-641.004) (-641.833) * (-642.168) (-640.678) (-641.328) [-640.661] -- 0:00:44

      Average standard deviation of split frequencies: 0.017619

      275500 -- (-642.240) (-643.442) [-641.560] (-640.440) * (-642.109) (-640.519) [-641.506] (-643.159) -- 0:00:44
      276000 -- (-641.149) (-640.650) (-643.332) [-646.582] * (-642.292) (-641.915) [-641.121] (-643.398) -- 0:00:44
      276500 -- [-639.311] (-643.377) (-641.884) (-642.030) * (-640.446) (-644.391) (-639.569) [-642.285] -- 0:00:44
      277000 -- [-642.434] (-642.625) (-640.436) (-640.362) * (-639.505) (-642.142) (-640.565) [-639.715] -- 0:00:44
      277500 -- (-641.715) (-643.096) [-640.253] (-640.214) * (-641.189) (-641.758) [-641.399] (-640.856) -- 0:00:44
      278000 -- (-640.673) (-641.803) (-644.032) [-642.047] * (-642.297) (-643.480) [-640.531] (-643.146) -- 0:00:44
      278500 -- (-640.962) (-640.422) (-641.416) [-639.253] * (-642.735) (-639.496) [-641.982] (-640.831) -- 0:00:44
      279000 -- (-641.376) (-639.624) [-639.968] (-639.635) * (-641.032) (-642.156) (-640.474) [-641.682] -- 0:00:43
      279500 -- (-642.697) (-640.618) (-644.904) [-642.318] * (-646.468) (-641.939) (-640.725) [-642.100] -- 0:00:43
      280000 -- (-644.032) [-640.695] (-640.327) (-643.213) * (-642.561) (-640.663) (-640.132) [-640.637] -- 0:00:43

      Average standard deviation of split frequencies: 0.016619

      280500 -- [-644.650] (-644.338) (-642.355) (-644.908) * (-643.226) [-641.256] (-639.413) (-644.034) -- 0:00:43
      281000 -- [-642.842] (-640.419) (-640.126) (-644.072) * (-644.814) (-640.908) [-642.110] (-642.221) -- 0:00:43
      281500 -- (-643.618) (-641.614) (-638.720) [-639.860] * (-640.071) (-639.167) (-640.770) [-641.493] -- 0:00:43
      282000 -- [-650.140] (-642.241) (-639.789) (-642.956) * (-640.771) [-640.803] (-643.749) (-640.394) -- 0:00:43
      282500 -- (-640.941) (-639.896) [-641.193] (-642.202) * (-643.379) [-639.634] (-640.369) (-640.382) -- 0:00:43
      283000 -- (-639.262) [-640.354] (-643.227) (-641.961) * [-642.653] (-639.588) (-640.347) (-644.963) -- 0:00:43
      283500 -- (-642.502) [-638.957] (-642.139) (-641.734) * (-643.848) [-642.340] (-640.091) (-642.067) -- 0:00:42
      284000 -- (-643.166) (-641.000) [-642.820] (-644.010) * [-642.537] (-645.732) (-640.080) (-642.155) -- 0:00:42
      284500 -- (-639.816) [-639.416] (-639.483) (-645.675) * (-641.892) (-643.067) [-639.577] (-643.887) -- 0:00:42
      285000 -- (-642.505) (-641.195) [-639.977] (-643.209) * [-642.036] (-640.798) (-639.074) (-640.456) -- 0:00:42

      Average standard deviation of split frequencies: 0.017003

      285500 -- [-638.891] (-640.399) (-639.758) (-639.243) * [-639.490] (-641.208) (-641.480) (-640.749) -- 0:00:42
      286000 -- (-643.546) (-641.765) [-639.794] (-639.482) * (-641.534) (-648.514) [-639.896] (-640.848) -- 0:00:42
      286500 -- (-643.655) (-641.543) (-639.701) [-640.991] * (-641.477) (-640.795) (-639.379) [-640.441] -- 0:00:42
      287000 -- (-640.881) (-640.135) [-640.718] (-643.382) * [-640.793] (-640.016) (-640.520) (-640.359) -- 0:00:42
      287500 -- (-642.913) (-642.358) (-639.795) [-641.105] * (-642.208) [-639.682] (-641.955) (-639.033) -- 0:00:42
      288000 -- [-642.074] (-639.832) (-640.114) (-641.915) * [-639.085] (-644.350) (-642.664) (-643.270) -- 0:00:42
      288500 -- (-642.494) [-642.140] (-641.346) (-640.923) * (-642.339) (-641.896) [-641.253] (-640.775) -- 0:00:41
      289000 -- [-641.539] (-641.635) (-640.123) (-649.105) * (-640.015) (-644.476) (-640.109) [-641.887] -- 0:00:41
      289500 -- [-646.605] (-639.559) (-641.262) (-640.288) * (-642.496) [-640.423] (-641.264) (-640.631) -- 0:00:41
      290000 -- (-640.747) [-641.511] (-642.452) (-643.310) * (-640.499) [-641.303] (-640.721) (-641.081) -- 0:00:44

      Average standard deviation of split frequencies: 0.016056

      290500 -- (-643.231) [-640.782] (-642.881) (-642.185) * (-643.407) [-639.999] (-640.126) (-640.754) -- 0:00:43
      291000 -- [-642.348] (-642.100) (-643.980) (-641.938) * (-639.854) (-639.410) (-643.269) [-641.038] -- 0:00:43
      291500 -- (-641.255) [-641.206] (-645.133) (-640.234) * (-641.178) (-640.765) (-641.999) [-641.584] -- 0:00:43
      292000 -- (-640.137) (-639.687) (-644.628) [-642.497] * (-639.208) [-640.244] (-640.301) (-640.122) -- 0:00:43
      292500 -- [-639.478] (-644.618) (-639.266) (-639.270) * (-643.788) (-640.530) (-641.968) [-642.346] -- 0:00:43
      293000 -- (-643.809) (-640.734) [-639.680] (-640.026) * (-640.491) (-643.386) (-640.147) [-641.064] -- 0:00:43
      293500 -- [-642.054] (-640.312) (-640.348) (-639.701) * (-639.793) [-642.543] (-643.818) (-642.204) -- 0:00:43
      294000 -- (-640.744) [-644.281] (-643.353) (-639.807) * (-640.878) (-645.172) (-639.869) [-640.049] -- 0:00:43
      294500 -- (-639.901) (-642.133) (-644.121) [-639.392] * (-641.357) (-644.123) [-639.250] (-643.466) -- 0:00:43
      295000 -- (-643.013) [-645.295] (-639.624) (-641.712) * (-644.361) (-643.670) [-640.601] (-648.629) -- 0:00:43

      Average standard deviation of split frequencies: 0.016642

      295500 -- [-640.259] (-640.370) (-639.472) (-640.783) * (-644.278) (-642.996) (-642.209) [-641.269] -- 0:00:42
      296000 -- (-643.969) (-640.956) [-641.760] (-639.119) * (-640.977) [-644.394] (-648.638) (-640.645) -- 0:00:42
      296500 -- (-645.882) [-639.920] (-639.841) (-641.266) * (-639.671) [-640.130] (-640.902) (-641.770) -- 0:00:42
      297000 -- (-642.074) (-639.972) [-642.656] (-643.619) * (-640.665) (-644.622) (-642.088) [-644.282] -- 0:00:42
      297500 -- [-643.691] (-641.560) (-640.520) (-644.577) * [-639.434] (-641.185) (-642.951) (-641.286) -- 0:00:42
      298000 -- (-642.463) (-643.605) [-640.011] (-641.898) * [-640.606] (-641.256) (-644.230) (-645.121) -- 0:00:42
      298500 -- [-639.616] (-641.733) (-640.159) (-639.628) * (-641.436) (-644.125) (-642.830) [-639.305] -- 0:00:42
      299000 -- (-642.588) [-640.029] (-640.983) (-640.547) * (-640.787) [-641.623] (-645.433) (-643.631) -- 0:00:42
      299500 -- (-642.181) (-644.787) [-642.236] (-642.425) * (-643.190) (-642.259) [-639.328] (-640.622) -- 0:00:42
      300000 -- (-642.756) (-640.833) [-640.529] (-643.830) * (-640.229) [-640.516] (-639.317) (-639.972) -- 0:00:42

      Average standard deviation of split frequencies: 0.016999

      300500 -- (-641.984) (-639.133) [-639.733] (-641.659) * (-642.515) [-643.044] (-640.583) (-640.505) -- 0:00:41
      301000 -- (-639.764) (-639.957) [-640.121] (-642.046) * (-643.963) (-642.521) [-640.331] (-640.529) -- 0:00:41
      301500 -- (-642.483) [-640.603] (-642.536) (-642.278) * (-642.700) (-645.348) [-642.152] (-641.706) -- 0:00:41
      302000 -- [-641.187] (-640.322) (-640.706) (-643.576) * (-642.560) (-642.512) (-643.946) [-641.176] -- 0:00:41
      302500 -- (-640.639) (-639.067) [-644.067] (-639.475) * [-639.909] (-640.908) (-648.862) (-640.495) -- 0:00:41
      303000 -- (-642.311) (-639.622) (-649.046) [-640.627] * (-639.083) [-641.266] (-649.069) (-644.867) -- 0:00:41
      303500 -- [-642.156] (-638.853) (-643.808) (-640.501) * [-641.568] (-642.061) (-641.666) (-641.054) -- 0:00:41
      304000 -- (-644.554) (-640.603) (-640.424) [-640.280] * [-640.069] (-641.999) (-641.946) (-642.405) -- 0:00:41
      304500 -- (-642.008) (-640.075) [-640.858] (-642.668) * (-641.397) (-641.146) (-640.695) [-641.588] -- 0:00:41
      305000 -- (-641.999) (-641.003) (-640.982) [-642.013] * (-639.907) (-641.683) [-640.107] (-640.527) -- 0:00:41

      Average standard deviation of split frequencies: 0.017108

      305500 -- (-639.106) [-640.042] (-641.463) (-639.185) * (-645.410) (-642.070) [-640.893] (-642.731) -- 0:00:40
      306000 -- [-639.692] (-639.331) (-643.873) (-640.042) * (-641.304) (-642.902) (-640.810) [-641.622] -- 0:00:43
      306500 -- (-641.628) [-639.053] (-648.074) (-641.789) * (-641.114) [-640.866] (-640.087) (-640.724) -- 0:00:42
      307000 -- (-641.170) [-640.541] (-641.598) (-643.853) * [-641.114] (-641.041) (-639.848) (-639.783) -- 0:00:42
      307500 -- [-641.540] (-646.352) (-642.239) (-640.721) * (-639.190) [-640.614] (-641.113) (-641.872) -- 0:00:42
      308000 -- (-639.353) (-646.855) (-641.416) [-640.682] * (-643.099) (-642.509) (-644.379) [-642.366] -- 0:00:42
      308500 -- (-639.279) (-643.758) [-640.360] (-643.367) * (-643.239) (-641.164) (-641.947) [-643.781] -- 0:00:42
      309000 -- (-638.978) (-639.601) [-639.623] (-642.145) * [-639.391] (-641.434) (-639.158) (-641.515) -- 0:00:42
      309500 -- (-640.405) (-641.701) [-643.382] (-639.878) * (-639.410) (-641.169) [-640.365] (-640.211) -- 0:00:42
      310000 -- (-642.879) (-641.922) (-640.347) [-640.075] * (-643.217) (-642.580) (-641.375) [-639.134] -- 0:00:42

      Average standard deviation of split frequencies: 0.017250

      310500 -- (-645.762) [-643.183] (-640.612) (-641.743) * (-640.530) (-639.901) (-643.373) [-643.958] -- 0:00:42
      311000 -- (-640.927) (-639.943) (-640.396) [-640.783] * (-639.856) (-639.267) [-640.258] (-640.628) -- 0:00:42
      311500 -- (-642.614) (-639.334) [-641.908] (-642.725) * [-641.033] (-640.011) (-640.644) (-640.860) -- 0:00:41
      312000 -- (-642.966) [-641.899] (-640.875) (-639.012) * (-641.143) [-640.231] (-644.772) (-641.616) -- 0:00:41
      312500 -- (-638.940) [-640.613] (-643.584) (-639.911) * (-640.059) [-639.926] (-640.910) (-641.905) -- 0:00:41
      313000 -- [-641.870] (-646.269) (-640.861) (-641.320) * [-640.170] (-639.456) (-645.834) (-640.041) -- 0:00:41
      313500 -- (-640.000) (-641.022) (-642.060) [-640.797] * (-641.157) (-640.057) (-639.691) [-640.067] -- 0:00:41
      314000 -- (-640.008) (-641.117) (-641.224) [-640.509] * (-638.940) (-639.528) (-639.882) [-639.645] -- 0:00:41
      314500 -- (-639.795) (-643.056) [-644.035] (-640.312) * (-642.246) (-639.959) [-639.615] (-643.924) -- 0:00:41
      315000 -- [-640.301] (-639.490) (-641.063) (-643.437) * (-642.562) (-643.127) [-643.701] (-639.347) -- 0:00:41

      Average standard deviation of split frequencies: 0.017273

      315500 -- (-640.849) (-641.016) (-644.506) [-639.851] * (-644.385) [-642.842] (-640.176) (-642.489) -- 0:00:41
      316000 -- [-641.125] (-641.254) (-645.540) (-639.683) * (-642.094) (-644.677) [-640.253] (-642.193) -- 0:00:41
      316500 -- (-642.850) [-641.475] (-645.200) (-639.860) * (-640.224) [-643.191] (-641.645) (-641.707) -- 0:00:41
      317000 -- [-640.810] (-639.382) (-643.071) (-643.722) * [-643.126] (-641.483) (-639.570) (-644.444) -- 0:00:40
      317500 -- (-639.162) [-639.884] (-641.623) (-641.887) * [-642.285] (-640.012) (-641.347) (-644.076) -- 0:00:40
      318000 -- (-640.619) [-639.353] (-642.077) (-643.961) * [-641.179] (-640.941) (-641.050) (-643.575) -- 0:00:40
      318500 -- [-640.738] (-641.417) (-642.273) (-643.864) * (-640.885) [-640.915] (-640.054) (-640.649) -- 0:00:40
      319000 -- (-639.155) (-641.155) (-643.325) [-647.060] * [-639.822] (-645.670) (-639.511) (-639.819) -- 0:00:40
      319500 -- (-639.952) [-640.683] (-641.152) (-643.658) * (-642.544) (-641.084) [-645.305] (-641.190) -- 0:00:40
      320000 -- (-641.087) (-641.918) [-640.200] (-642.080) * (-642.744) (-639.453) (-644.437) [-639.396] -- 0:00:40

      Average standard deviation of split frequencies: 0.018028

      320500 -- [-639.908] (-641.922) (-642.524) (-640.685) * (-639.717) [-641.041] (-641.073) (-639.110) -- 0:00:40
      321000 -- (-641.093) [-639.603] (-643.459) (-641.546) * (-639.477) [-640.373] (-641.166) (-638.994) -- 0:00:40
      321500 -- [-640.893] (-640.581) (-639.483) (-642.455) * (-641.731) (-646.745) (-641.450) [-640.225] -- 0:00:40
      322000 -- (-642.297) (-644.298) (-643.735) [-641.045] * (-641.599) (-644.551) [-644.291] (-640.123) -- 0:00:40
      322500 -- [-640.638] (-640.068) (-640.832) (-639.864) * (-640.459) (-645.320) (-643.474) [-640.362] -- 0:00:39
      323000 -- (-641.753) (-639.107) (-639.895) [-641.515] * (-640.839) (-641.108) [-640.047] (-641.290) -- 0:00:41
      323500 -- (-640.196) (-639.606) [-642.494] (-646.686) * [-640.902] (-640.839) (-640.168) (-642.003) -- 0:00:41
      324000 -- (-640.859) [-639.406] (-641.159) (-648.237) * (-642.067) (-641.825) [-644.244] (-642.648) -- 0:00:41
      324500 -- (-642.069) [-639.441] (-641.186) (-642.176) * (-639.676) (-639.889) (-649.744) [-643.023] -- 0:00:41
      325000 -- [-640.141] (-641.675) (-644.334) (-639.805) * (-641.211) (-643.808) [-642.987] (-641.895) -- 0:00:41

      Average standard deviation of split frequencies: 0.017208

      325500 -- (-640.531) (-640.928) [-641.415] (-639.162) * (-641.810) (-642.921) [-641.091] (-641.940) -- 0:00:41
      326000 -- (-639.465) (-642.489) [-641.764] (-640.392) * (-642.174) (-639.372) (-639.152) [-643.539] -- 0:00:41
      326500 -- (-641.295) (-641.011) (-640.953) [-641.846] * (-644.277) (-641.520) (-640.698) [-640.142] -- 0:00:41
      327000 -- (-643.180) (-646.258) (-641.905) [-644.482] * [-640.418] (-639.158) (-639.166) (-641.776) -- 0:00:41
      327500 -- (-639.019) (-640.029) (-642.914) [-641.076] * (-641.376) [-639.005] (-639.673) (-642.023) -- 0:00:41
      328000 -- (-639.196) (-645.266) [-641.477] (-643.220) * (-640.432) (-640.465) (-640.813) [-639.606] -- 0:00:40
      328500 -- [-638.982] (-639.775) (-641.254) (-645.049) * (-639.706) (-639.234) [-640.075] (-639.281) -- 0:00:40
      329000 -- [-639.052] (-647.349) (-642.621) (-642.440) * (-642.276) [-641.229] (-643.303) (-642.390) -- 0:00:40
      329500 -- [-638.859] (-642.081) (-640.370) (-645.891) * (-639.983) [-640.441] (-642.141) (-640.357) -- 0:00:40
      330000 -- [-639.021] (-641.282) (-640.319) (-644.987) * (-642.608) (-639.185) (-642.615) [-641.369] -- 0:00:40

      Average standard deviation of split frequencies: 0.017257

      330500 -- [-641.470] (-640.538) (-641.483) (-651.368) * [-641.353] (-643.426) (-643.229) (-643.208) -- 0:00:40
      331000 -- (-642.217) [-641.156] (-643.084) (-651.286) * (-640.226) (-643.078) (-641.375) [-641.123] -- 0:00:40
      331500 -- (-642.652) (-643.867) [-639.883] (-642.448) * (-641.602) [-640.334] (-645.098) (-642.683) -- 0:00:40
      332000 -- [-641.866] (-641.984) (-640.923) (-641.455) * (-641.657) (-639.826) (-642.789) [-641.136] -- 0:00:40
      332500 -- [-642.391] (-640.216) (-643.487) (-639.301) * (-640.766) [-640.030] (-640.597) (-641.163) -- 0:00:40
      333000 -- (-640.534) [-641.725] (-641.062) (-639.719) * [-640.621] (-641.952) (-647.719) (-642.880) -- 0:00:40
      333500 -- [-639.764] (-640.932) (-640.074) (-642.495) * (-641.305) (-643.706) [-641.373] (-639.828) -- 0:00:39
      334000 -- [-639.292] (-642.927) (-642.325) (-641.216) * (-640.766) [-639.441] (-640.786) (-642.140) -- 0:00:39
      334500 -- (-639.628) (-644.276) [-639.656] (-641.455) * [-640.496] (-644.763) (-641.721) (-644.075) -- 0:00:39
      335000 -- [-640.307] (-643.461) (-639.312) (-645.923) * (-641.874) (-642.293) (-645.759) [-642.982] -- 0:00:39

      Average standard deviation of split frequencies: 0.017722

      335500 -- (-643.884) (-643.346) (-642.275) [-639.671] * [-639.441] (-642.497) (-643.918) (-640.865) -- 0:00:39
      336000 -- (-641.024) (-648.655) [-643.269] (-641.912) * (-641.400) (-644.440) [-641.935] (-640.872) -- 0:00:39
      336500 -- (-641.723) [-644.737] (-641.439) (-640.003) * (-643.863) (-642.837) [-643.944] (-639.534) -- 0:00:39
      337000 -- [-643.209] (-640.330) (-642.003) (-638.800) * (-646.823) (-648.461) (-640.861) [-639.828] -- 0:00:39
      337500 -- (-641.094) [-639.741] (-641.075) (-643.125) * (-642.432) (-639.136) (-643.185) [-641.354] -- 0:00:39
      338000 -- (-644.193) [-644.587] (-640.698) (-640.323) * (-640.898) [-640.805] (-643.318) (-643.146) -- 0:00:39
      338500 -- (-643.542) [-644.204] (-642.340) (-642.600) * (-638.906) (-643.919) [-641.681] (-643.770) -- 0:00:39
      339000 -- (-643.251) [-643.602] (-643.174) (-642.230) * (-641.891) [-641.316] (-640.217) (-643.935) -- 0:00:38
      339500 -- (-641.296) (-641.921) (-640.527) [-644.763] * (-642.643) (-639.968) [-640.295] (-645.741) -- 0:00:40
      340000 -- (-640.662) [-640.743] (-640.695) (-640.931) * (-639.311) (-639.514) [-640.010] (-640.123) -- 0:00:40

      Average standard deviation of split frequencies: 0.018450

      340500 -- [-639.604] (-644.127) (-642.629) (-639.690) * [-643.480] (-642.672) (-641.620) (-643.334) -- 0:00:40
      341000 -- (-639.886) [-639.455] (-641.210) (-640.255) * (-642.114) (-643.883) (-641.127) [-640.591] -- 0:00:40
      341500 -- (-641.061) (-640.780) [-644.079] (-640.671) * (-643.348) [-641.627] (-642.413) (-640.624) -- 0:00:40
      342000 -- (-642.653) [-639.491] (-643.796) (-644.857) * (-640.310) (-640.527) (-640.433) [-640.586] -- 0:00:40
      342500 -- (-641.992) [-643.449] (-644.588) (-644.345) * (-640.687) [-640.080] (-640.173) (-640.653) -- 0:00:40
      343000 -- (-641.852) (-643.207) (-642.049) [-639.465] * (-639.525) (-640.148) [-640.336] (-639.013) -- 0:00:40
      343500 -- [-643.170] (-642.545) (-645.854) (-640.039) * (-644.204) (-640.932) (-641.979) [-638.947] -- 0:00:40
      344000 -- (-642.892) (-641.838) (-642.317) [-640.603] * (-649.366) (-639.785) (-640.681) [-641.011] -- 0:00:40
      344500 -- (-640.303) (-645.640) [-640.411] (-640.033) * (-640.905) (-639.695) (-641.241) [-640.537] -- 0:00:39
      345000 -- (-641.736) (-643.051) [-639.846] (-640.867) * (-639.615) (-642.256) [-640.732] (-640.535) -- 0:00:39

      Average standard deviation of split frequencies: 0.017568

      345500 -- (-642.677) (-644.536) (-641.699) [-641.725] * (-644.677) (-648.094) [-647.314] (-642.665) -- 0:00:39
      346000 -- (-640.970) (-649.995) [-639.357] (-641.731) * [-642.055] (-649.833) (-642.134) (-644.877) -- 0:00:39
      346500 -- (-639.635) (-639.976) [-639.572] (-642.356) * (-647.472) [-648.389] (-642.503) (-642.090) -- 0:00:39
      347000 -- (-642.123) [-641.971] (-640.162) (-641.751) * (-640.223) (-643.455) [-639.509] (-642.756) -- 0:00:39
      347500 -- (-643.353) (-643.207) (-642.261) [-641.712] * (-641.437) [-640.496] (-640.636) (-643.170) -- 0:00:39
      348000 -- (-647.057) (-640.383) [-642.395] (-642.205) * (-640.602) (-639.652) (-640.992) [-639.278] -- 0:00:39
      348500 -- (-642.360) [-639.124] (-642.749) (-641.369) * (-641.907) (-642.206) (-640.048) [-639.899] -- 0:00:39
      349000 -- (-644.518) (-641.442) (-642.925) [-639.726] * (-639.324) (-639.702) [-639.223] (-639.917) -- 0:00:39
      349500 -- [-641.159] (-640.595) (-643.660) (-640.162) * (-641.535) (-639.798) (-642.138) [-641.131] -- 0:00:39
      350000 -- (-640.407) (-640.954) [-641.802] (-643.134) * (-642.980) [-642.386] (-642.269) (-641.004) -- 0:00:39

      Average standard deviation of split frequencies: 0.018298

      350500 -- [-640.760] (-641.483) (-639.967) (-642.961) * (-644.673) [-639.401] (-643.989) (-641.302) -- 0:00:38
      351000 -- [-639.989] (-644.456) (-638.835) (-640.785) * (-641.878) [-643.984] (-642.013) (-644.499) -- 0:00:38
      351500 -- (-639.741) (-642.359) [-640.424] (-641.392) * (-641.471) (-642.187) [-643.326] (-643.582) -- 0:00:38
      352000 -- (-641.708) (-641.002) (-639.247) [-639.395] * (-645.039) (-645.724) [-641.046] (-642.684) -- 0:00:38
      352500 -- [-640.735] (-640.907) (-643.762) (-639.824) * (-641.821) [-639.396] (-640.835) (-640.080) -- 0:00:38
      353000 -- (-640.363) [-640.558] (-641.727) (-641.880) * [-639.884] (-639.719) (-639.224) (-640.519) -- 0:00:38
      353500 -- (-642.854) (-640.804) [-640.992] (-642.200) * (-639.202) (-642.622) (-640.452) [-644.073] -- 0:00:38
      354000 -- (-640.585) (-643.632) [-639.144] (-644.714) * (-640.087) (-641.706) [-642.592] (-641.137) -- 0:00:38
      354500 -- (-641.792) [-644.602] (-642.490) (-640.252) * (-643.181) (-645.874) (-641.942) [-640.068] -- 0:00:38
      355000 -- [-641.290] (-641.991) (-641.254) (-641.588) * (-641.023) (-642.561) [-640.367] (-642.028) -- 0:00:38

      Average standard deviation of split frequencies: 0.017759

      355500 -- [-639.907] (-641.818) (-640.874) (-640.203) * [-640.471] (-642.321) (-641.400) (-639.393) -- 0:00:39
      356000 -- (-640.141) (-643.065) [-640.101] (-641.012) * (-646.476) [-642.487] (-644.732) (-639.447) -- 0:00:39
      356500 -- (-641.045) (-641.850) [-640.178] (-643.119) * (-641.108) [-641.370] (-642.128) (-639.115) -- 0:00:39
      357000 -- (-640.919) (-641.438) (-644.392) [-641.141] * (-642.049) [-640.341] (-641.954) (-643.019) -- 0:00:39
      357500 -- (-641.038) (-639.493) (-640.519) [-639.708] * (-646.944) [-642.815] (-639.466) (-639.728) -- 0:00:39
      358000 -- (-643.540) (-643.868) [-639.921] (-643.049) * [-644.287] (-639.786) (-641.070) (-640.797) -- 0:00:39
      358500 -- (-641.612) (-641.996) [-643.880] (-644.148) * [-640.606] (-642.945) (-641.359) (-641.172) -- 0:00:39
      359000 -- (-639.284) [-640.626] (-640.118) (-640.137) * (-640.383) (-649.661) (-640.848) [-640.238] -- 0:00:39
      359500 -- (-640.262) (-642.345) [-640.868] (-640.706) * (-641.670) (-644.908) (-640.409) [-639.899] -- 0:00:39
      360000 -- [-641.557] (-645.633) (-642.671) (-639.251) * (-641.778) (-641.475) [-639.550] (-640.540) -- 0:00:39

      Average standard deviation of split frequencies: 0.018662

      360500 -- (-641.019) (-640.088) (-642.870) [-641.135] * [-642.310] (-642.613) (-641.753) (-644.743) -- 0:00:39
      361000 -- [-641.992] (-639.465) (-641.700) (-641.189) * (-640.889) (-646.104) (-642.238) [-640.710] -- 0:00:38
      361500 -- (-642.587) (-642.472) (-641.644) [-640.260] * (-641.687) (-642.568) [-641.054] (-643.160) -- 0:00:38
      362000 -- (-641.723) [-639.355] (-640.618) (-643.973) * (-641.930) (-640.979) [-641.762] (-639.190) -- 0:00:38
      362500 -- (-642.473) [-642.015] (-641.224) (-642.376) * [-639.836] (-642.620) (-642.360) (-642.096) -- 0:00:38
      363000 -- (-639.581) [-642.778] (-640.893) (-640.914) * (-640.732) [-641.578] (-641.115) (-641.588) -- 0:00:38
      363500 -- [-640.300] (-639.384) (-640.038) (-639.569) * [-639.760] (-641.863) (-639.739) (-641.053) -- 0:00:38
      364000 -- (-639.968) (-641.163) (-640.387) [-640.015] * (-641.770) [-640.338] (-641.206) (-643.907) -- 0:00:38
      364500 -- (-639.627) [-641.337] (-641.603) (-642.687) * (-644.052) [-641.170] (-644.880) (-642.582) -- 0:00:38
      365000 -- (-641.190) (-641.976) (-640.964) [-641.320] * [-640.300] (-640.660) (-642.717) (-640.352) -- 0:00:38

      Average standard deviation of split frequencies: 0.017531

      365500 -- (-641.167) [-640.870] (-640.073) (-639.464) * (-645.750) (-641.618) (-640.092) [-642.199] -- 0:00:38
      366000 -- (-642.902) (-640.868) [-640.693] (-641.848) * (-640.536) [-640.951] (-641.247) (-641.382) -- 0:00:38
      366500 -- (-641.550) (-645.190) (-643.214) [-641.384] * (-639.644) (-646.127) (-639.018) [-640.282] -- 0:00:38
      367000 -- (-641.507) [-644.267] (-644.111) (-641.096) * (-640.795) [-640.341] (-642.115) (-643.489) -- 0:00:37
      367500 -- (-642.948) [-647.373] (-643.655) (-641.780) * (-640.955) [-641.767] (-642.362) (-644.607) -- 0:00:37
      368000 -- (-644.122) (-643.921) [-643.863] (-640.408) * (-644.072) (-641.773) (-638.939) [-642.295] -- 0:00:37
      368500 -- [-643.417] (-640.551) (-640.278) (-644.498) * [-639.362] (-641.377) (-647.580) (-640.235) -- 0:00:37
      369000 -- (-640.074) (-639.258) (-639.439) [-640.009] * (-643.475) (-641.948) [-641.473] (-640.221) -- 0:00:37
      369500 -- [-640.087] (-640.076) (-640.109) (-641.027) * [-642.616] (-642.255) (-641.116) (-640.462) -- 0:00:37
      370000 -- (-645.855) (-639.083) [-641.246] (-642.066) * (-640.090) (-643.552) [-644.183] (-639.973) -- 0:00:37

      Average standard deviation of split frequencies: 0.017664

      370500 -- (-643.643) (-639.082) [-640.645] (-639.800) * (-640.356) (-641.250) [-639.248] (-641.140) -- 0:00:37
      371000 -- [-642.810] (-645.011) (-642.723) (-641.891) * (-641.744) [-640.307] (-642.282) (-639.524) -- 0:00:37
      371500 -- (-639.481) (-642.010) [-639.801] (-642.973) * (-645.673) (-640.536) (-641.354) [-639.832] -- 0:00:37
      372000 -- [-639.758] (-639.327) (-639.848) (-638.908) * [-642.678] (-641.178) (-639.114) (-640.715) -- 0:00:37
      372500 -- [-640.024] (-640.195) (-640.055) (-641.876) * (-644.473) (-640.362) [-639.513] (-642.794) -- 0:00:38
      373000 -- [-639.038] (-639.767) (-640.685) (-641.584) * [-646.636] (-641.599) (-641.126) (-643.120) -- 0:00:38
      373500 -- [-640.612] (-642.432) (-639.851) (-639.631) * [-640.691] (-640.050) (-642.992) (-641.448) -- 0:00:38
      374000 -- (-639.844) [-641.815] (-640.092) (-644.406) * [-639.629] (-641.149) (-640.302) (-643.135) -- 0:00:38
      374500 -- (-639.636) (-641.870) [-640.391] (-642.202) * (-642.262) (-640.035) [-639.225] (-639.520) -- 0:00:38
      375000 -- (-643.093) (-641.164) [-639.224] (-641.810) * [-643.857] (-641.731) (-641.897) (-639.964) -- 0:00:38

      Average standard deviation of split frequencies: 0.017901

      375500 -- (-640.692) (-641.522) [-641.548] (-639.958) * (-642.611) (-639.902) (-641.316) [-641.515] -- 0:00:38
      376000 -- (-642.680) (-639.940) [-642.007] (-641.060) * (-640.634) [-640.574] (-642.588) (-639.281) -- 0:00:38
      376500 -- (-644.135) [-639.129] (-639.530) (-640.690) * (-639.745) (-642.259) (-639.828) [-639.283] -- 0:00:38
      377000 -- (-642.506) (-639.539) [-640.185] (-640.397) * (-639.677) [-641.187] (-639.871) (-640.571) -- 0:00:38
      377500 -- (-641.334) [-642.960] (-640.839) (-641.901) * [-642.179] (-639.229) (-639.112) (-641.084) -- 0:00:37
      378000 -- [-645.245] (-642.885) (-641.501) (-641.916) * (-641.027) [-639.096] (-641.071) (-640.645) -- 0:00:37
      378500 -- (-646.149) [-641.220] (-648.018) (-641.197) * (-639.705) [-640.053] (-639.841) (-643.004) -- 0:00:37
      379000 -- [-641.479] (-643.580) (-640.532) (-640.244) * [-640.258] (-640.614) (-641.974) (-640.868) -- 0:00:37
      379500 -- (-641.127) (-641.876) [-638.923] (-639.705) * [-645.227] (-644.289) (-641.571) (-639.262) -- 0:00:37
      380000 -- (-642.351) [-644.198] (-640.345) (-639.374) * [-645.757] (-642.370) (-645.758) (-639.195) -- 0:00:37

      Average standard deviation of split frequencies: 0.017264

      380500 -- [-640.216] (-644.772) (-639.776) (-639.318) * [-640.172] (-644.100) (-640.016) (-639.893) -- 0:00:37
      381000 -- (-642.570) [-644.198] (-642.127) (-642.730) * (-643.697) (-641.114) (-640.360) [-640.482] -- 0:00:37
      381500 -- [-641.699] (-640.292) (-641.867) (-639.952) * (-640.408) (-641.943) (-644.717) [-646.948] -- 0:00:37
      382000 -- (-641.090) (-640.553) [-639.357] (-639.908) * (-640.890) (-641.529) (-643.463) [-642.353] -- 0:00:37
      382500 -- (-644.188) (-642.869) [-642.187] (-639.845) * [-641.015] (-640.179) (-642.921) (-641.424) -- 0:00:37
      383000 -- (-643.630) [-639.990] (-642.010) (-642.293) * [-639.038] (-639.740) (-643.406) (-646.473) -- 0:00:37
      383500 -- (-640.320) (-641.109) [-639.335] (-645.645) * [-644.301] (-639.097) (-641.787) (-642.168) -- 0:00:36
      384000 -- (-639.886) (-642.574) (-639.948) [-641.409] * (-638.911) [-639.783] (-639.626) (-641.418) -- 0:00:36
      384500 -- (-641.139) (-641.709) (-641.488) [-640.561] * [-641.529] (-639.773) (-641.231) (-639.846) -- 0:00:36
      385000 -- (-641.926) (-639.151) [-640.168] (-640.791) * (-642.323) (-641.801) (-641.838) [-640.855] -- 0:00:36

      Average standard deviation of split frequencies: 0.017529

      385500 -- (-641.179) (-640.217) [-643.128] (-641.421) * (-641.548) (-640.914) (-642.824) [-639.763] -- 0:00:38
      386000 -- (-641.005) [-640.359] (-641.140) (-638.882) * [-640.033] (-641.193) (-639.666) (-639.626) -- 0:00:38
      386500 -- (-643.027) (-642.994) [-640.846] (-641.537) * (-640.296) (-639.191) [-641.246] (-640.590) -- 0:00:38
      387000 -- (-642.505) [-640.101] (-643.090) (-639.658) * (-640.154) (-639.127) (-641.842) [-640.602] -- 0:00:38
      387500 -- (-643.381) [-643.019] (-642.111) (-641.823) * (-641.751) [-640.572] (-641.575) (-640.716) -- 0:00:37
      388000 -- [-639.409] (-640.834) (-644.261) (-640.201) * (-641.761) [-640.613] (-640.241) (-640.293) -- 0:00:37
      388500 -- (-639.079) (-641.592) [-641.714] (-641.980) * (-641.116) (-646.608) [-640.273] (-639.979) -- 0:00:37
      389000 -- (-641.585) (-641.044) (-639.923) [-642.391] * (-639.881) (-645.497) [-639.823] (-640.977) -- 0:00:37
      389500 -- [-639.275] (-640.537) (-641.581) (-641.944) * (-640.131) [-644.985] (-641.476) (-641.659) -- 0:00:37
      390000 -- [-639.339] (-640.868) (-642.170) (-639.848) * [-639.030] (-641.804) (-642.253) (-639.115) -- 0:00:37

      Average standard deviation of split frequencies: 0.017319

      390500 -- [-641.145] (-641.384) (-645.179) (-641.374) * (-643.103) (-640.639) (-643.401) [-640.505] -- 0:00:37
      391000 -- (-640.871) (-639.624) (-639.582) [-642.152] * (-639.878) (-639.147) [-643.240] (-639.297) -- 0:00:37
      391500 -- [-642.295] (-639.742) (-642.929) (-650.630) * [-638.983] (-640.865) (-644.239) (-641.289) -- 0:00:37
      392000 -- (-642.306) (-642.906) (-640.640) [-640.818] * (-643.656) [-640.046] (-645.897) (-641.381) -- 0:00:37
      392500 -- (-639.243) [-640.121] (-640.750) (-639.190) * (-640.745) [-640.634] (-647.967) (-640.862) -- 0:00:37
      393000 -- [-640.633] (-639.732) (-643.595) (-644.275) * (-643.252) (-641.579) (-645.187) [-639.243] -- 0:00:37
      393500 -- (-642.429) (-641.216) (-642.976) [-641.834] * (-640.060) [-640.882] (-640.639) (-641.603) -- 0:00:36
      394000 -- (-641.713) (-639.331) (-643.188) [-639.891] * (-641.526) [-640.144] (-641.825) (-647.980) -- 0:00:36
      394500 -- [-642.576] (-639.544) (-639.454) (-640.883) * (-642.000) (-640.664) [-641.966] (-641.054) -- 0:00:36
      395000 -- (-639.394) (-640.674) [-641.486] (-639.721) * (-638.921) (-646.020) [-639.522] (-641.257) -- 0:00:36

      Average standard deviation of split frequencies: 0.017786

      395500 -- (-641.442) (-643.007) [-639.961] (-642.779) * (-644.270) (-640.951) [-640.451] (-639.618) -- 0:00:36
      396000 -- [-643.811] (-642.550) (-642.621) (-642.577) * (-641.856) (-643.737) (-640.347) [-642.199] -- 0:00:36
      396500 -- (-639.916) (-644.047) (-640.090) [-644.123] * [-640.515] (-642.289) (-639.848) (-643.147) -- 0:00:36
      397000 -- (-643.300) [-639.496] (-641.314) (-642.584) * (-639.157) (-639.639) [-639.642] (-641.364) -- 0:00:36
      397500 -- (-639.619) [-639.737] (-639.660) (-641.983) * (-641.590) (-641.099) (-640.434) [-641.115] -- 0:00:36
      398000 -- [-642.555] (-642.318) (-641.523) (-640.283) * [-645.895] (-641.960) (-639.530) (-641.069) -- 0:00:36
      398500 -- (-640.455) [-639.436] (-643.375) (-645.675) * (-641.372) (-643.754) [-642.189] (-642.802) -- 0:00:36
      399000 -- [-641.728] (-641.908) (-639.263) (-643.679) * [-639.632] (-643.448) (-641.644) (-640.636) -- 0:00:36
      399500 -- [-639.799] (-643.716) (-641.581) (-646.747) * (-641.266) (-641.548) (-640.159) [-639.694] -- 0:00:36
      400000 -- (-641.870) [-640.268] (-642.266) (-644.706) * (-639.367) (-642.322) (-647.897) [-639.140] -- 0:00:36

      Average standard deviation of split frequencies: 0.017583

      400500 -- [-641.507] (-642.864) (-639.857) (-649.564) * (-644.830) [-639.938] (-649.249) (-641.949) -- 0:00:35
      401000 -- (-641.302) (-640.941) (-644.262) [-643.016] * [-642.029] (-639.455) (-646.437) (-641.131) -- 0:00:35
      401500 -- (-640.549) [-639.367] (-643.419) (-643.190) * [-642.413] (-642.091) (-641.064) (-639.776) -- 0:00:35
      402000 -- (-640.847) [-640.277] (-642.404) (-649.851) * (-640.149) [-643.401] (-644.982) (-640.775) -- 0:00:37
      402500 -- (-639.460) (-642.975) (-640.254) [-641.259] * (-639.404) (-642.056) (-642.972) [-639.112] -- 0:00:37
      403000 -- (-639.611) [-640.533] (-643.731) (-641.796) * (-639.443) (-641.152) (-642.102) [-639.727] -- 0:00:37
      403500 -- (-640.352) (-639.328) [-644.461] (-642.834) * [-640.739] (-641.437) (-643.189) (-644.470) -- 0:00:36
      404000 -- (-640.733) (-641.978) [-643.077] (-642.062) * [-640.797] (-643.036) (-645.326) (-640.944) -- 0:00:36
      404500 -- [-640.369] (-645.079) (-642.906) (-640.424) * [-644.753] (-641.235) (-639.854) (-644.332) -- 0:00:36
      405000 -- (-640.813) (-642.346) [-641.143] (-641.515) * (-645.167) [-640.067] (-643.900) (-642.118) -- 0:00:36

      Average standard deviation of split frequencies: 0.017997

      405500 -- (-644.581) (-641.795) (-642.675) [-640.973] * (-647.397) [-647.211] (-640.878) (-640.170) -- 0:00:36
      406000 -- (-641.501) [-642.047] (-640.691) (-640.431) * (-645.741) [-644.067] (-640.003) (-642.192) -- 0:00:36
      406500 -- (-643.114) [-641.010] (-639.819) (-639.593) * [-639.549] (-644.434) (-640.002) (-647.098) -- 0:00:36
      407000 -- [-642.771] (-644.509) (-646.010) (-640.895) * (-640.259) (-641.655) (-641.357) [-640.302] -- 0:00:36
      407500 -- [-640.098] (-640.330) (-640.622) (-641.053) * (-641.271) [-645.819] (-639.700) (-640.084) -- 0:00:36
      408000 -- [-641.915] (-645.779) (-643.899) (-646.098) * [-641.418] (-640.762) (-642.372) (-647.057) -- 0:00:36
      408500 -- (-649.556) (-639.736) (-640.730) [-641.167] * (-640.304) (-640.061) (-640.619) [-642.168] -- 0:00:36
      409000 -- (-639.658) (-641.167) [-639.845] (-645.076) * (-639.736) [-638.811] (-640.891) (-642.007) -- 0:00:36
      409500 -- (-643.382) (-644.734) [-641.382] (-642.480) * (-641.576) (-640.267) (-641.883) [-639.630] -- 0:00:36
      410000 -- (-642.226) (-641.632) (-639.792) [-642.811] * (-643.166) (-641.063) (-641.371) [-643.387] -- 0:00:35

      Average standard deviation of split frequencies: 0.018430

      410500 -- (-640.772) [-642.138] (-640.025) (-640.453) * [-640.823] (-643.248) (-640.318) (-640.110) -- 0:00:35
      411000 -- [-643.085] (-641.879) (-641.901) (-640.729) * (-640.193) [-641.472] (-640.376) (-643.427) -- 0:00:35
      411500 -- (-641.120) (-645.337) [-640.334] (-642.847) * (-641.475) (-639.091) [-641.348] (-643.309) -- 0:00:35
      412000 -- (-644.846) (-644.838) [-639.555] (-643.602) * (-642.467) [-641.133] (-642.532) (-643.204) -- 0:00:35
      412500 -- (-641.520) [-641.528] (-639.290) (-645.757) * (-640.022) (-642.123) (-640.218) [-641.188] -- 0:00:35
      413000 -- (-641.592) (-640.751) (-640.201) [-643.016] * (-640.501) [-640.093] (-640.943) (-639.586) -- 0:00:35
      413500 -- (-640.739) (-640.275) [-640.498] (-640.266) * (-640.254) (-643.212) (-644.911) [-641.015] -- 0:00:35
      414000 -- (-640.702) (-639.825) (-640.492) [-640.784] * [-642.128] (-644.731) (-643.570) (-641.504) -- 0:00:35
      414500 -- [-641.737] (-642.529) (-640.355) (-642.410) * [-639.682] (-639.589) (-645.576) (-641.401) -- 0:00:35
      415000 -- [-648.801] (-641.435) (-641.878) (-640.603) * [-640.953] (-644.260) (-640.759) (-644.100) -- 0:00:35

      Average standard deviation of split frequencies: 0.017664

      415500 -- (-643.518) (-641.102) (-643.183) [-639.970] * (-641.901) [-639.761] (-643.237) (-642.167) -- 0:00:35
      416000 -- (-642.749) (-641.952) (-641.183) [-642.834] * (-640.840) (-642.636) [-640.629] (-641.480) -- 0:00:35
      416500 -- (-642.366) (-645.852) [-642.107] (-640.462) * (-642.530) [-642.419] (-642.328) (-641.187) -- 0:00:35
      417000 -- (-640.010) (-640.434) [-639.810] (-640.893) * (-642.505) [-641.001] (-643.529) (-640.780) -- 0:00:34
      417500 -- [-639.630] (-639.591) (-642.431) (-644.009) * (-642.135) (-640.681) [-639.097] (-642.493) -- 0:00:36
      418000 -- (-641.384) (-641.396) (-642.506) [-641.458] * (-643.633) (-640.034) (-639.172) [-639.210] -- 0:00:36
      418500 -- [-641.170] (-639.992) (-641.622) (-641.830) * (-639.602) (-643.198) (-639.367) [-639.394] -- 0:00:36
      419000 -- (-643.492) (-644.760) (-644.555) [-641.134] * (-640.591) (-644.178) (-643.585) [-639.988] -- 0:00:36
      419500 -- [-639.797] (-642.638) (-642.019) (-643.526) * [-639.654] (-640.403) (-642.413) (-642.456) -- 0:00:35
      420000 -- [-642.762] (-641.024) (-641.234) (-644.205) * (-639.566) [-643.283] (-647.540) (-644.668) -- 0:00:35

      Average standard deviation of split frequencies: 0.018523

      420500 -- [-641.265] (-641.717) (-640.494) (-644.618) * (-640.810) (-643.463) (-639.059) [-642.955] -- 0:00:35
      421000 -- (-641.309) (-640.495) [-640.141] (-639.471) * (-641.450) (-644.776) [-640.364] (-646.817) -- 0:00:35
      421500 -- [-640.506] (-645.770) (-640.721) (-640.934) * [-640.152] (-639.747) (-641.002) (-641.960) -- 0:00:35
      422000 -- (-641.068) (-640.316) [-640.714] (-639.277) * (-641.562) [-639.395] (-641.194) (-642.106) -- 0:00:35
      422500 -- (-641.128) [-640.793] (-640.968) (-639.667) * [-639.186] (-640.077) (-640.316) (-639.819) -- 0:00:35
      423000 -- (-647.055) (-645.339) [-640.155] (-647.769) * (-639.273) (-640.356) [-639.265] (-642.062) -- 0:00:35
      423500 -- (-642.056) (-641.405) [-644.891] (-641.647) * (-642.284) (-641.237) [-641.187] (-640.879) -- 0:00:35
      424000 -- [-639.598] (-642.342) (-640.871) (-639.661) * (-647.925) [-644.350] (-643.665) (-641.334) -- 0:00:35
      424500 -- [-639.497] (-640.682) (-639.757) (-641.933) * [-639.637] (-643.274) (-641.487) (-641.564) -- 0:00:35
      425000 -- (-645.857) (-641.639) [-639.745] (-641.741) * (-640.110) (-640.795) (-642.984) [-641.854] -- 0:00:35

      Average standard deviation of split frequencies: 0.019202

      425500 -- (-639.310) (-640.764) (-639.900) [-640.274] * (-640.205) (-642.980) [-641.250] (-641.036) -- 0:00:35
      426000 -- (-639.603) (-640.729) [-640.046] (-640.912) * (-642.098) [-640.594] (-643.314) (-642.013) -- 0:00:35
      426500 -- (-641.581) (-640.327) [-641.347] (-642.108) * [-640.273] (-639.551) (-642.132) (-648.795) -- 0:00:34
      427000 -- [-640.205] (-642.140) (-643.937) (-639.723) * (-641.173) (-640.538) (-638.942) [-646.390] -- 0:00:34
      427500 -- (-641.984) (-639.305) (-642.522) [-639.964] * [-641.709] (-643.048) (-644.261) (-644.648) -- 0:00:34
      428000 -- [-641.061] (-641.593) (-641.445) (-640.967) * [-642.489] (-644.140) (-641.413) (-641.548) -- 0:00:34
      428500 -- (-641.207) [-639.944] (-640.581) (-643.535) * (-643.030) (-641.374) (-640.610) [-640.439] -- 0:00:34
      429000 -- (-642.640) (-640.555) (-641.930) [-641.283] * [-642.161] (-639.420) (-645.496) (-640.171) -- 0:00:34
      429500 -- (-639.643) (-641.606) [-640.408] (-641.942) * (-643.376) (-641.089) (-641.142) [-640.132] -- 0:00:34
      430000 -- (-641.238) [-643.648] (-640.282) (-642.011) * (-641.514) [-640.658] (-642.231) (-643.519) -- 0:00:34

      Average standard deviation of split frequencies: 0.018866

      430500 -- [-641.455] (-643.069) (-640.438) (-640.169) * (-641.399) (-644.077) [-639.181] (-640.859) -- 0:00:34
      431000 -- [-641.010] (-643.969) (-639.856) (-641.626) * [-641.357] (-642.832) (-641.329) (-640.154) -- 0:00:34
      431500 -- (-639.760) (-643.377) [-639.650] (-649.071) * [-642.981] (-645.739) (-642.667) (-642.652) -- 0:00:34
      432000 -- (-640.553) [-640.988] (-641.060) (-645.184) * [-640.026] (-644.128) (-640.701) (-644.189) -- 0:00:34
      432500 -- (-639.780) (-640.006) [-642.994] (-647.868) * (-639.966) (-641.317) [-640.305] (-642.270) -- 0:00:34
      433000 -- [-640.934] (-644.905) (-646.198) (-645.964) * (-641.757) (-642.125) [-639.757] (-641.861) -- 0:00:34
      433500 -- (-649.211) (-639.905) [-641.106] (-643.868) * (-641.489) (-640.145) [-638.965] (-644.079) -- 0:00:33
      434000 -- [-642.942] (-642.351) (-639.394) (-643.470) * [-639.401] (-641.305) (-639.865) (-643.610) -- 0:00:35
      434500 -- (-641.963) [-643.817] (-639.295) (-644.656) * (-641.457) [-638.977] (-642.221) (-642.997) -- 0:00:35
      435000 -- (-640.035) (-641.503) [-644.203] (-642.894) * (-642.330) (-639.548) (-641.024) [-642.246] -- 0:00:35

      Average standard deviation of split frequencies: 0.017999

      435500 -- [-640.527] (-641.673) (-640.522) (-647.921) * (-642.235) [-639.576] (-639.397) (-640.263) -- 0:00:34
      436000 -- (-640.892) (-641.599) [-641.187] (-643.902) * (-641.537) (-639.851) (-641.365) [-640.894] -- 0:00:34
      436500 -- (-641.344) (-639.992) (-639.608) [-641.249] * [-640.295] (-639.831) (-643.595) (-640.403) -- 0:00:34
      437000 -- [-639.906] (-644.926) (-639.478) (-641.397) * (-642.033) [-642.768] (-643.702) (-642.014) -- 0:00:34
      437500 -- (-641.487) (-640.693) [-639.103] (-643.565) * [-639.283] (-642.640) (-640.540) (-640.375) -- 0:00:34
      438000 -- [-642.785] (-641.054) (-640.530) (-640.735) * (-639.048) [-640.491] (-639.687) (-640.704) -- 0:00:34
      438500 -- (-643.223) (-640.888) [-640.090] (-639.812) * [-639.143] (-639.650) (-639.662) (-642.670) -- 0:00:34
      439000 -- [-641.074] (-639.634) (-640.748) (-642.597) * [-639.214] (-642.477) (-645.944) (-641.885) -- 0:00:34
      439500 -- (-639.766) (-639.905) (-639.394) [-640.442] * (-651.299) [-642.781] (-641.944) (-639.501) -- 0:00:34
      440000 -- [-639.612] (-640.425) (-639.424) (-643.756) * (-644.015) (-642.639) [-640.403] (-640.664) -- 0:00:34

      Average standard deviation of split frequencies: 0.017305

      440500 -- (-640.635) (-641.393) [-641.359] (-641.623) * (-642.279) (-642.417) [-641.122] (-640.432) -- 0:00:34
      441000 -- (-640.669) [-640.649] (-646.506) (-641.182) * [-641.338] (-643.291) (-641.721) (-640.851) -- 0:00:34
      441500 -- (-641.913) [-640.808] (-640.027) (-641.192) * (-641.102) [-640.946] (-640.760) (-640.162) -- 0:00:34
      442000 -- [-641.130] (-639.110) (-641.381) (-640.802) * [-641.362] (-639.809) (-646.442) (-651.715) -- 0:00:34
      442500 -- (-640.948) (-639.301) [-641.245] (-648.694) * (-642.211) (-646.975) (-645.809) [-643.215] -- 0:00:34
      443000 -- [-640.274] (-640.591) (-641.713) (-645.638) * [-640.157] (-644.765) (-645.168) (-638.891) -- 0:00:33
      443500 -- (-640.814) (-640.895) [-640.154] (-644.676) * (-642.056) [-640.710] (-645.239) (-641.628) -- 0:00:33
      444000 -- (-640.977) (-642.232) [-642.344] (-641.140) * [-641.951] (-639.972) (-640.355) (-639.714) -- 0:00:33
      444500 -- (-641.587) (-645.504) (-643.688) [-639.357] * (-638.884) (-640.512) [-640.709] (-642.381) -- 0:00:33
      445000 -- (-642.574) (-641.072) [-643.258] (-640.196) * (-640.697) (-641.141) [-642.795] (-642.020) -- 0:00:33

      Average standard deviation of split frequencies: 0.017036

      445500 -- (-642.590) (-642.151) (-641.238) [-642.555] * (-642.248) (-640.034) [-639.792] (-639.726) -- 0:00:33
      446000 -- (-639.870) [-644.597] (-644.597) (-645.476) * [-642.765] (-639.718) (-643.973) (-643.842) -- 0:00:33
      446500 -- (-644.324) (-644.886) (-641.611) [-641.300] * [-641.808] (-640.435) (-640.595) (-642.790) -- 0:00:33
      447000 -- (-642.560) (-641.668) [-639.694] (-640.730) * [-642.277] (-640.219) (-640.301) (-640.029) -- 0:00:33
      447500 -- (-641.215) (-642.428) (-641.489) [-641.073] * [-642.319] (-640.288) (-639.360) (-639.173) -- 0:00:33
      448000 -- (-639.053) (-640.916) [-640.868] (-641.713) * (-640.569) (-640.910) (-640.317) [-641.525] -- 0:00:33
      448500 -- (-638.980) (-643.152) [-639.953] (-641.426) * (-643.254) (-641.604) [-641.111] (-641.088) -- 0:00:33
      449000 -- (-641.991) [-642.563] (-643.597) (-640.956) * (-641.957) (-639.763) (-641.302) [-640.999] -- 0:00:33
      449500 -- (-641.166) (-640.960) (-642.852) [-640.139] * (-639.719) (-642.389) (-639.372) [-640.990] -- 0:00:33
      450000 -- (-645.056) [-639.393] (-641.651) (-639.632) * [-640.698] (-641.506) (-642.283) (-640.032) -- 0:00:33

      Average standard deviation of split frequencies: 0.017167

      450500 -- (-641.282) (-640.240) (-642.412) [-643.074] * (-641.870) (-639.543) [-640.189] (-640.523) -- 0:00:34
      451000 -- [-641.275] (-639.511) (-643.611) (-640.368) * (-640.779) (-640.727) (-640.531) [-639.778] -- 0:00:34
      451500 -- [-641.175] (-642.992) (-641.183) (-640.832) * [-639.318] (-639.926) (-641.529) (-640.280) -- 0:00:34
      452000 -- (-641.012) [-641.781] (-644.714) (-640.959) * (-640.392) (-641.776) [-642.153] (-642.153) -- 0:00:33
      452500 -- [-641.511] (-640.739) (-640.383) (-640.492) * (-640.461) [-643.264] (-641.972) (-641.766) -- 0:00:33
      453000 -- (-641.397) (-642.364) (-640.912) [-643.686] * (-641.351) (-644.448) (-639.393) [-639.996] -- 0:00:33
      453500 -- [-640.307] (-641.220) (-642.982) (-641.241) * (-641.540) (-642.104) (-639.714) [-642.595] -- 0:00:33
      454000 -- (-641.447) (-644.321) (-641.770) [-639.992] * (-641.702) [-640.639] (-640.209) (-642.684) -- 0:00:33
      454500 -- (-641.983) [-644.587] (-639.291) (-641.303) * (-641.564) [-641.320] (-640.757) (-641.169) -- 0:00:33
      455000 -- (-641.246) (-644.663) [-645.670] (-648.431) * [-642.481] (-640.997) (-642.343) (-642.659) -- 0:00:33

      Average standard deviation of split frequencies: 0.017878

      455500 -- [-640.871] (-641.174) (-645.356) (-639.435) * (-643.082) (-641.083) (-645.129) [-642.526] -- 0:00:33
      456000 -- (-641.679) (-646.403) (-644.012) [-640.124] * [-641.428] (-640.542) (-645.310) (-641.586) -- 0:00:33
      456500 -- (-640.107) [-639.130] (-642.175) (-642.639) * (-639.553) [-640.685] (-642.388) (-642.228) -- 0:00:33
      457000 -- (-642.769) (-642.314) (-640.818) [-642.760] * (-640.451) (-643.291) (-639.769) [-639.183] -- 0:00:33
      457500 -- (-642.764) (-639.796) (-639.451) [-640.485] * (-643.366) (-642.931) [-640.313] (-640.650) -- 0:00:33
      458000 -- (-643.896) [-639.786] (-641.662) (-640.385) * (-641.586) (-642.115) [-643.804] (-639.340) -- 0:00:33
      458500 -- [-641.330] (-640.646) (-639.557) (-640.253) * (-640.815) [-641.792] (-644.596) (-641.289) -- 0:00:33
      459000 -- (-640.272) [-642.440] (-639.482) (-640.047) * (-641.778) [-640.922] (-644.305) (-643.424) -- 0:00:33
      459500 -- (-640.243) (-643.974) [-641.410] (-640.747) * (-639.686) [-639.775] (-644.080) (-640.909) -- 0:00:32
      460000 -- (-642.048) (-641.544) [-642.436] (-641.144) * (-644.938) (-642.535) (-642.249) [-640.006] -- 0:00:32

      Average standard deviation of split frequencies: 0.017216

      460500 -- (-641.820) (-640.750) (-642.674) [-640.576] * (-646.447) [-640.123] (-642.207) (-639.728) -- 0:00:32
      461000 -- (-641.799) [-642.560] (-649.320) (-642.732) * (-641.511) [-639.812] (-639.946) (-642.279) -- 0:00:32
      461500 -- [-643.109] (-644.465) (-644.478) (-640.960) * (-642.756) [-639.684] (-641.387) (-641.179) -- 0:00:32
      462000 -- (-642.784) [-639.660] (-642.673) (-644.656) * (-641.143) [-642.988] (-641.693) (-641.149) -- 0:00:32
      462500 -- (-649.080) (-639.818) (-641.859) [-641.519] * (-650.933) (-641.040) [-644.752] (-640.633) -- 0:00:32
      463000 -- (-647.784) [-641.348] (-641.302) (-644.864) * (-646.633) (-640.600) (-641.892) [-641.059] -- 0:00:32
      463500 -- (-648.228) (-640.990) [-639.765] (-642.155) * (-643.845) (-639.860) (-640.066) [-639.696] -- 0:00:32
      464000 -- (-642.917) (-641.380) (-641.682) [-643.260] * (-644.096) [-639.875] (-640.074) (-644.837) -- 0:00:32
      464500 -- (-640.830) (-642.261) [-644.573] (-641.730) * (-641.951) (-640.170) (-643.175) [-640.750] -- 0:00:32
      465000 -- [-645.916] (-641.498) (-642.661) (-641.175) * (-643.767) (-642.903) (-641.097) [-641.068] -- 0:00:32

      Average standard deviation of split frequencies: 0.016305

      465500 -- (-645.114) [-640.733] (-641.082) (-641.038) * (-641.169) (-642.761) [-640.881] (-640.804) -- 0:00:32
      466000 -- [-639.388] (-640.665) (-642.259) (-639.327) * (-641.064) [-641.823] (-645.178) (-646.374) -- 0:00:32
      466500 -- (-643.089) (-638.873) (-642.850) [-643.368] * (-640.960) (-641.711) (-641.544) [-641.955] -- 0:00:32
      467000 -- [-640.029] (-639.253) (-641.049) (-638.935) * [-640.342] (-643.314) (-640.275) (-640.716) -- 0:00:31
      467500 -- (-639.324) (-639.669) [-643.645] (-640.109) * (-642.099) (-639.745) [-641.914] (-643.761) -- 0:00:33
      468000 -- (-642.419) (-640.879) [-640.347] (-641.415) * (-639.193) (-640.192) [-640.421] (-646.926) -- 0:00:32
      468500 -- (-645.597) [-640.668] (-642.344) (-640.980) * (-639.950) [-640.606] (-641.911) (-640.489) -- 0:00:32
      469000 -- (-640.787) (-641.819) (-645.080) [-641.722] * [-639.551] (-639.914) (-640.319) (-640.791) -- 0:00:32
      469500 -- (-639.987) (-645.381) (-641.432) [-639.436] * [-642.881] (-642.938) (-643.615) (-643.839) -- 0:00:32
      470000 -- (-640.125) (-640.542) (-642.494) [-639.957] * (-643.502) (-639.578) (-641.450) [-641.615] -- 0:00:32

      Average standard deviation of split frequencies: 0.015613

      470500 -- (-641.567) [-642.316] (-641.307) (-642.485) * (-640.261) (-641.580) (-640.324) [-642.237] -- 0:00:32
      471000 -- [-641.559] (-640.165) (-639.911) (-641.074) * (-641.209) (-641.792) [-639.483] (-643.021) -- 0:00:32
      471500 -- [-640.212] (-640.448) (-640.179) (-642.406) * (-644.149) (-639.804) [-640.804] (-643.201) -- 0:00:32
      472000 -- (-641.812) [-642.136] (-640.675) (-643.096) * (-643.025) (-641.085) [-640.234] (-652.813) -- 0:00:32
      472500 -- [-640.520] (-640.594) (-641.726) (-640.212) * (-644.303) [-642.097] (-642.681) (-643.217) -- 0:00:32
      473000 -- (-641.033) (-640.354) (-640.229) [-641.785] * [-641.784] (-642.689) (-644.798) (-643.537) -- 0:00:32
      473500 -- (-640.164) (-644.326) [-639.624] (-639.066) * (-643.913) (-642.292) [-640.795] (-639.771) -- 0:00:32
      474000 -- (-639.879) (-642.893) [-640.695] (-643.337) * (-642.146) (-643.012) [-639.921] (-639.901) -- 0:00:32
      474500 -- [-639.776] (-640.724) (-641.326) (-647.021) * (-639.503) (-641.842) (-640.412) [-641.552] -- 0:00:32
      475000 -- (-640.691) (-640.737) [-639.800] (-643.708) * [-638.771] (-644.772) (-641.396) (-640.782) -- 0:00:32

      Average standard deviation of split frequencies: 0.015350

      475500 -- [-642.516] (-641.669) (-640.494) (-643.176) * [-645.109] (-641.697) (-642.508) (-644.146) -- 0:00:31
      476000 -- (-640.031) [-641.853] (-640.004) (-640.908) * (-646.832) [-642.090] (-642.358) (-640.629) -- 0:00:31
      476500 -- (-641.653) [-639.923] (-642.426) (-640.326) * (-648.852) (-642.196) [-640.934] (-642.152) -- 0:00:31
      477000 -- (-640.216) (-640.549) [-652.011] (-643.425) * (-644.764) (-642.918) [-641.944] (-639.378) -- 0:00:31
      477500 -- (-639.635) (-642.597) [-642.063] (-640.481) * [-643.518] (-639.483) (-642.064) (-641.581) -- 0:00:31
      478000 -- (-641.829) [-641.919] (-642.139) (-643.243) * [-639.928] (-642.260) (-640.425) (-644.020) -- 0:00:31
      478500 -- (-641.994) (-642.485) [-639.817] (-643.796) * [-639.902] (-641.795) (-640.477) (-643.817) -- 0:00:31
      479000 -- (-640.339) (-643.795) [-645.801] (-641.728) * (-640.286) [-642.349] (-640.056) (-641.891) -- 0:00:31
      479500 -- [-639.428] (-642.506) (-641.563) (-642.331) * [-644.896] (-640.848) (-639.715) (-647.654) -- 0:00:31
      480000 -- (-641.641) (-642.354) (-640.365) [-640.047] * [-641.928] (-644.335) (-640.925) (-640.513) -- 0:00:31

      Average standard deviation of split frequencies: 0.015310

      480500 -- (-639.132) (-641.401) (-639.642) [-639.770] * (-640.461) [-641.806] (-640.768) (-640.513) -- 0:00:31
      481000 -- (-639.750) (-640.011) (-641.394) [-643.186] * [-641.626] (-640.703) (-640.629) (-640.181) -- 0:00:31
      481500 -- [-639.836] (-639.278) (-641.597) (-641.192) * (-640.173) (-641.730) [-642.769] (-640.433) -- 0:00:31
      482000 -- (-642.672) (-639.505) (-640.244) [-640.773] * (-640.422) (-639.302) [-641.715] (-640.396) -- 0:00:31
      482500 -- [-639.686] (-640.382) (-644.429) (-639.988) * (-640.941) (-640.838) [-642.004] (-643.302) -- 0:00:31
      483000 -- (-639.149) (-639.673) [-641.748] (-642.289) * [-642.952] (-640.160) (-640.140) (-640.060) -- 0:00:31
      483500 -- (-642.097) (-640.455) (-640.121) [-640.562] * (-639.341) (-645.784) [-639.405] (-639.885) -- 0:00:30
      484000 -- (-646.774) (-644.488) [-639.799] (-639.657) * (-640.907) (-645.529) (-642.622) [-640.110] -- 0:00:31
      484500 -- (-642.647) [-642.377] (-646.188) (-643.148) * [-641.186] (-644.959) (-643.055) (-644.393) -- 0:00:31
      485000 -- (-639.544) [-639.825] (-639.861) (-641.593) * [-640.732] (-641.821) (-643.536) (-640.081) -- 0:00:31

      Average standard deviation of split frequencies: 0.015573

      485500 -- (-643.698) (-641.952) [-641.874] (-640.755) * (-641.252) [-640.658] (-642.926) (-644.577) -- 0:00:31
      486000 -- [-644.683] (-643.415) (-641.149) (-644.296) * [-640.796] (-640.618) (-639.790) (-642.331) -- 0:00:31
      486500 -- [-641.150] (-647.812) (-641.282) (-639.871) * (-642.040) (-643.018) [-639.016] (-640.484) -- 0:00:31
      487000 -- (-639.479) (-639.201) [-638.772] (-640.350) * (-640.559) (-643.032) (-643.955) [-640.408] -- 0:00:31
      487500 -- (-642.867) (-640.744) [-640.947] (-641.330) * [-640.060] (-642.289) (-641.605) (-642.022) -- 0:00:31
      488000 -- (-643.207) (-639.770) (-644.769) [-640.374] * (-640.522) (-642.722) (-641.584) [-643.359] -- 0:00:31
      488500 -- (-644.080) [-642.683] (-641.480) (-641.192) * (-641.192) (-641.563) [-642.004] (-640.699) -- 0:00:31
      489000 -- (-642.219) (-639.771) (-642.074) [-640.334] * (-641.093) [-640.162] (-644.137) (-640.294) -- 0:00:31
      489500 -- (-640.214) [-639.412] (-644.551) (-642.913) * (-642.235) (-640.093) [-642.866] (-640.273) -- 0:00:31
      490000 -- (-641.032) (-641.734) [-639.202] (-644.844) * (-640.565) (-640.438) (-641.913) [-642.164] -- 0:00:31

      Average standard deviation of split frequencies: 0.016012

      490500 -- [-640.493] (-645.130) (-640.102) (-643.899) * (-646.002) [-639.270] (-642.662) (-643.148) -- 0:00:31
      491000 -- (-641.437) (-640.487) (-639.327) [-640.940] * (-640.655) (-640.539) [-641.391] (-641.268) -- 0:00:31
      491500 -- [-640.421] (-640.620) (-647.445) (-640.615) * (-644.634) (-640.459) (-641.605) [-642.924] -- 0:00:31
      492000 -- (-640.924) (-640.024) (-639.502) [-639.923] * (-642.297) [-641.059] (-640.659) (-641.519) -- 0:00:30
      492500 -- [-642.331] (-641.034) (-639.875) (-639.018) * (-644.288) [-642.351] (-640.566) (-642.182) -- 0:00:30
      493000 -- (-641.884) (-642.881) (-640.736) [-640.888] * (-645.179) (-640.055) (-640.768) [-642.806] -- 0:00:30
      493500 -- (-645.162) (-639.827) (-640.393) [-641.435] * [-640.249] (-641.125) (-642.532) (-641.916) -- 0:00:30
      494000 -- (-645.923) (-641.096) (-641.247) [-640.482] * [-640.576] (-641.135) (-643.489) (-644.578) -- 0:00:30
      494500 -- (-640.064) [-640.535] (-640.088) (-641.673) * (-639.474) (-643.475) [-641.048] (-639.884) -- 0:00:30
      495000 -- (-639.365) (-640.860) (-640.242) [-641.153] * [-640.248] (-640.370) (-639.701) (-639.997) -- 0:00:30

      Average standard deviation of split frequencies: 0.015787

      495500 -- [-640.664] (-643.072) (-639.632) (-647.879) * (-640.216) (-642.532) [-642.134] (-640.019) -- 0:00:30
      496000 -- (-641.389) [-639.750] (-640.055) (-639.685) * (-640.280) (-640.022) [-639.490] (-640.261) -- 0:00:30
      496500 -- (-639.741) (-644.234) [-640.329] (-639.587) * (-648.641) (-642.923) [-639.575] (-640.211) -- 0:00:30
      497000 -- (-643.058) (-641.885) (-645.167) [-639.659] * (-641.223) [-640.739] (-643.621) (-640.159) -- 0:00:30
      497500 -- (-643.819) (-640.841) (-643.505) [-640.214] * (-641.737) (-639.637) (-640.415) [-640.438] -- 0:00:30
      498000 -- [-638.986] (-640.528) (-641.585) (-640.358) * (-641.319) [-640.062] (-641.589) (-640.670) -- 0:00:30
      498500 -- [-640.917] (-640.688) (-641.235) (-640.856) * (-642.349) (-642.773) (-639.543) [-641.350] -- 0:00:30
      499000 -- (-640.714) [-640.111] (-640.178) (-639.665) * (-649.014) [-641.826] (-641.077) (-640.761) -- 0:00:30
      499500 -- (-641.278) (-639.596) (-642.356) [-639.960] * (-646.164) (-643.760) (-639.073) [-642.306] -- 0:00:30
      500000 -- [-639.312] (-639.384) (-639.800) (-647.641) * (-638.741) (-643.816) [-639.384] (-641.445) -- 0:00:30

      Average standard deviation of split frequencies: 0.016062

      500500 -- (-640.502) (-640.239) [-639.586] (-640.456) * (-639.715) [-645.394] (-640.167) (-645.387) -- 0:00:30
      501000 -- (-640.933) [-641.157] (-643.785) (-641.836) * [-639.563] (-639.289) (-644.540) (-650.220) -- 0:00:30
      501500 -- [-641.152] (-639.397) (-643.244) (-642.821) * [-643.215] (-641.098) (-643.494) (-640.680) -- 0:00:30
      502000 -- (-644.211) (-639.608) [-644.328] (-640.078) * [-645.198] (-641.223) (-642.669) (-641.099) -- 0:00:30
      502500 -- [-642.937] (-641.933) (-641.156) (-640.636) * (-639.243) [-641.887] (-644.051) (-639.609) -- 0:00:30
      503000 -- (-640.788) (-641.521) [-639.295] (-645.046) * (-641.099) (-642.758) [-645.937] (-641.760) -- 0:00:30
      503500 -- [-640.843] (-644.263) (-643.761) (-643.339) * (-640.242) (-640.676) (-646.550) [-642.420] -- 0:00:30
      504000 -- (-640.588) [-639.560] (-640.989) (-642.426) * [-639.998] (-641.993) (-639.889) (-641.656) -- 0:00:30
      504500 -- (-639.718) [-639.035] (-644.557) (-642.392) * (-646.635) (-643.721) (-642.256) [-640.833] -- 0:00:30
      505000 -- [-640.965] (-642.387) (-640.941) (-641.726) * (-641.551) (-641.343) (-641.361) [-643.792] -- 0:00:30

      Average standard deviation of split frequencies: 0.014961

      505500 -- (-642.086) (-643.810) (-641.039) [-643.102] * (-643.333) (-641.993) (-644.700) [-642.870] -- 0:00:30
      506000 -- (-645.817) (-641.741) (-643.013) [-644.147] * (-644.009) (-639.368) [-642.372] (-643.108) -- 0:00:30
      506500 -- (-644.305) (-643.219) (-640.011) [-639.939] * (-642.448) [-641.984] (-640.270) (-642.213) -- 0:00:30
      507000 -- (-640.991) [-642.649] (-639.654) (-639.498) * [-641.458] (-642.941) (-641.323) (-638.963) -- 0:00:30
      507500 -- [-641.202] (-642.292) (-640.110) (-639.637) * (-640.067) [-642.205] (-640.518) (-640.657) -- 0:00:30
      508000 -- (-640.092) (-641.064) [-639.183] (-640.450) * (-640.542) (-640.449) (-641.744) [-640.615] -- 0:00:30
      508500 -- (-640.571) (-641.941) (-641.200) [-639.637] * (-639.908) (-641.126) (-640.092) [-640.208] -- 0:00:29
      509000 -- (-639.475) [-639.817] (-641.697) (-641.650) * (-645.162) [-642.729] (-640.532) (-642.207) -- 0:00:29
      509500 -- (-639.684) (-642.164) (-641.484) [-640.763] * [-642.457] (-641.144) (-642.182) (-641.575) -- 0:00:29
      510000 -- [-641.037] (-645.150) (-640.441) (-639.644) * [-640.929] (-640.425) (-639.204) (-640.777) -- 0:00:29

      Average standard deviation of split frequencies: 0.015204

      510500 -- (-640.070) (-642.352) [-640.965] (-641.803) * [-645.430] (-639.912) (-641.569) (-640.862) -- 0:00:29
      511000 -- [-640.823] (-647.125) (-640.405) (-639.444) * (-642.205) (-640.677) [-642.232] (-644.843) -- 0:00:29
      511500 -- (-639.625) (-640.368) (-641.148) [-647.911] * (-641.398) (-647.017) [-643.364] (-641.595) -- 0:00:29
      512000 -- (-639.687) [-645.863] (-640.211) (-642.947) * [-642.633] (-639.870) (-640.200) (-640.671) -- 0:00:29
      512500 -- [-639.368] (-642.658) (-640.906) (-640.284) * (-640.216) (-644.525) (-641.595) [-639.682] -- 0:00:29
      513000 -- (-640.034) (-642.967) (-642.326) [-639.847] * (-643.737) [-643.048] (-645.626) (-639.679) -- 0:00:29
      513500 -- (-640.817) (-640.126) [-642.099] (-639.981) * (-639.043) (-641.281) (-640.789) [-640.140] -- 0:00:29
      514000 -- (-639.943) (-639.994) (-641.915) [-643.980] * (-643.705) [-640.659] (-644.128) (-640.563) -- 0:00:29
      514500 -- (-640.235) (-641.179) [-640.697] (-640.437) * (-640.723) [-639.999] (-640.843) (-641.578) -- 0:00:29
      515000 -- (-639.854) [-641.361] (-640.039) (-643.495) * (-641.578) (-640.596) [-643.656] (-641.107) -- 0:00:29

      Average standard deviation of split frequencies: 0.015370

      515500 -- (-642.143) (-640.217) [-639.202] (-641.422) * (-642.617) (-640.229) (-640.538) [-645.398] -- 0:00:29
      516000 -- (-640.616) (-639.431) [-641.511] (-642.100) * (-645.096) [-639.364] (-640.231) (-645.689) -- 0:00:29
      516500 -- (-640.217) [-639.601] (-643.092) (-640.623) * (-644.038) (-640.254) (-641.318) [-645.782] -- 0:00:29
      517000 -- [-641.003] (-639.864) (-640.977) (-640.710) * [-642.144] (-640.071) (-643.760) (-642.960) -- 0:00:28
      517500 -- (-645.799) [-640.733] (-639.636) (-640.537) * [-641.882] (-640.085) (-641.793) (-642.954) -- 0:00:29
      518000 -- (-642.927) (-641.395) (-641.719) [-646.652] * (-641.227) [-643.050] (-643.548) (-643.251) -- 0:00:29
      518500 -- [-644.554] (-641.644) (-641.253) (-641.035) * (-642.927) (-642.491) [-643.095] (-641.136) -- 0:00:29
      519000 -- (-640.045) [-641.274] (-641.962) (-639.055) * (-641.202) [-639.195] (-643.230) (-640.582) -- 0:00:29
      519500 -- (-639.080) [-640.338] (-643.852) (-640.106) * (-644.651) [-643.630] (-642.103) (-640.275) -- 0:00:29
      520000 -- [-640.065] (-639.739) (-645.609) (-640.652) * (-643.457) (-640.086) [-639.384] (-639.609) -- 0:00:29

      Average standard deviation of split frequencies: 0.014752

      520500 -- (-640.379) [-641.353] (-643.298) (-640.178) * (-642.802) (-640.184) [-640.994] (-640.704) -- 0:00:29
      521000 -- [-639.804] (-642.006) (-641.620) (-640.915) * (-642.676) (-642.262) [-642.171] (-639.650) -- 0:00:29
      521500 -- (-648.156) (-639.590) (-643.154) [-640.705] * (-645.709) (-643.833) (-642.211) [-640.622] -- 0:00:29
      522000 -- (-643.800) (-640.995) [-641.610] (-640.850) * (-643.665) [-639.887] (-640.697) (-640.058) -- 0:00:29
      522500 -- (-641.190) (-642.606) (-641.360) [-640.138] * (-645.292) [-641.062] (-645.439) (-639.965) -- 0:00:29
      523000 -- [-641.172] (-641.603) (-643.194) (-642.118) * (-641.388) (-639.954) [-642.845] (-644.343) -- 0:00:29
      523500 -- (-640.031) (-639.896) (-640.790) [-641.716] * (-640.054) (-642.148) [-641.409] (-642.678) -- 0:00:29
      524000 -- [-644.303] (-640.206) (-639.731) (-639.797) * (-639.284) [-642.485] (-640.913) (-640.976) -- 0:00:29
      524500 -- (-641.283) (-641.451) [-643.913] (-640.460) * (-639.232) [-639.892] (-640.768) (-640.955) -- 0:00:29
      525000 -- [-642.194] (-642.542) (-642.211) (-638.972) * (-641.123) (-640.141) (-642.815) [-642.618] -- 0:00:28

      Average standard deviation of split frequencies: 0.015130

      525500 -- (-642.166) [-641.741] (-639.981) (-641.405) * (-644.856) [-640.571] (-641.955) (-640.269) -- 0:00:28
      526000 -- (-640.898) (-641.664) [-639.458] (-641.444) * (-641.735) [-642.681] (-640.189) (-641.761) -- 0:00:28
      526500 -- (-645.078) (-642.205) (-639.989) [-641.193] * (-639.956) (-641.315) (-642.014) [-644.896] -- 0:00:28
      527000 -- [-641.036] (-639.966) (-639.819) (-643.639) * (-639.994) (-640.910) [-639.988] (-642.176) -- 0:00:28
      527500 -- (-640.160) [-643.161] (-639.712) (-642.666) * (-639.318) (-643.925) [-639.628] (-642.393) -- 0:00:28
      528000 -- [-641.134] (-640.601) (-642.459) (-641.069) * [-644.898] (-641.793) (-639.653) (-640.748) -- 0:00:28
      528500 -- (-643.476) [-640.416] (-641.256) (-640.896) * (-640.916) [-640.636] (-643.640) (-638.793) -- 0:00:28
      529000 -- (-643.397) [-639.064] (-640.695) (-640.192) * (-642.403) (-640.687) (-640.536) [-639.373] -- 0:00:28
      529500 -- (-640.841) (-638.950) [-640.521] (-644.598) * (-644.755) [-639.884] (-640.835) (-640.277) -- 0:00:28
      530000 -- (-641.974) (-645.066) [-641.897] (-642.985) * (-638.991) (-640.546) (-642.130) [-639.074] -- 0:00:28

      Average standard deviation of split frequencies: 0.014318

      530500 -- (-646.115) (-639.597) (-639.514) [-643.947] * [-640.490] (-642.414) (-644.244) (-639.076) -- 0:00:28
      531000 -- [-639.151] (-641.121) (-640.538) (-640.470) * (-643.273) (-639.303) [-639.929] (-639.882) -- 0:00:28
      531500 -- [-639.153] (-642.436) (-640.495) (-643.422) * (-647.358) (-641.358) [-642.511] (-641.611) -- 0:00:28
      532000 -- [-640.558] (-640.122) (-644.261) (-642.251) * [-643.215] (-639.284) (-643.824) (-640.470) -- 0:00:28
      532500 -- [-642.322] (-641.996) (-640.483) (-642.232) * (-643.978) (-641.759) (-642.237) [-641.018] -- 0:00:28
      533000 -- (-643.572) (-641.149) [-640.274] (-645.538) * (-640.156) (-641.610) [-640.555] (-640.099) -- 0:00:28
      533500 -- (-642.159) (-642.111) [-641.091] (-640.485) * (-640.900) (-639.696) [-642.496] (-642.096) -- 0:00:27
      534000 -- (-641.926) (-642.282) [-640.957] (-642.015) * (-640.086) [-639.900] (-642.170) (-641.775) -- 0:00:28
      534500 -- (-642.003) [-641.016] (-639.524) (-643.139) * (-639.980) (-640.300) [-639.109] (-643.361) -- 0:00:28
      535000 -- (-642.291) (-642.132) (-641.649) [-639.423] * (-642.071) [-642.077] (-640.119) (-640.274) -- 0:00:28

      Average standard deviation of split frequencies: 0.014020

      535500 -- [-640.242] (-638.830) (-642.042) (-646.905) * (-642.060) [-644.281] (-643.433) (-645.366) -- 0:00:28
      536000 -- (-641.040) [-639.455] (-641.536) (-643.104) * (-640.764) (-643.282) (-643.165) [-645.151] -- 0:00:28
      536500 -- [-639.750] (-641.265) (-639.840) (-643.448) * [-640.276] (-641.826) (-643.375) (-641.096) -- 0:00:28
      537000 -- (-642.771) [-641.005] (-640.073) (-648.145) * (-640.564) (-642.522) [-640.336] (-640.501) -- 0:00:28
      537500 -- (-642.096) [-642.755] (-644.573) (-650.002) * (-640.964) (-644.139) (-640.977) [-639.731] -- 0:00:28
      538000 -- (-641.813) [-640.960] (-640.466) (-641.443) * [-640.500] (-641.745) (-639.521) (-638.988) -- 0:00:28
      538500 -- [-645.177] (-639.851) (-644.399) (-641.215) * (-640.697) [-641.128] (-644.768) (-642.217) -- 0:00:28
      539000 -- (-643.893) (-640.512) (-642.071) [-640.612] * (-641.869) (-643.096) [-641.662] (-642.641) -- 0:00:28
      539500 -- (-641.472) [-643.990] (-640.788) (-641.034) * (-640.470) (-643.500) (-641.429) [-641.571] -- 0:00:28
      540000 -- (-641.097) [-644.046] (-645.798) (-645.877) * (-639.845) (-640.054) [-644.737] (-642.168) -- 0:00:28

      Average standard deviation of split frequencies: 0.013437

      540500 -- (-647.632) (-642.200) (-644.042) [-639.569] * [-639.891] (-640.111) (-643.706) (-643.366) -- 0:00:28
      541000 -- (-641.203) (-644.897) [-639.302] (-639.577) * (-644.186) (-644.969) [-641.517] (-640.824) -- 0:00:27
      541500 -- (-641.273) (-644.326) (-640.582) [-640.197] * (-642.222) [-640.463] (-640.374) (-640.567) -- 0:00:27
      542000 -- (-643.086) (-640.321) (-639.979) [-639.934] * [-640.785] (-641.373) (-640.583) (-639.850) -- 0:00:27
      542500 -- [-643.276] (-640.531) (-639.153) (-643.199) * [-641.292] (-639.965) (-641.326) (-641.666) -- 0:00:27
      543000 -- (-643.876) [-644.046] (-640.788) (-639.685) * [-641.096] (-639.309) (-641.286) (-640.803) -- 0:00:27
      543500 -- (-645.559) (-643.561) (-639.636) [-639.929] * (-640.137) [-641.240] (-642.226) (-640.051) -- 0:00:27
      544000 -- (-642.117) (-643.083) [-639.842] (-644.508) * (-640.606) [-641.761] (-639.478) (-640.038) -- 0:00:27
      544500 -- [-642.575] (-638.926) (-640.639) (-648.932) * (-639.550) [-641.051] (-639.322) (-642.506) -- 0:00:27
      545000 -- [-639.279] (-640.199) (-642.237) (-640.233) * (-639.731) (-641.920) (-641.536) [-639.938] -- 0:00:27

      Average standard deviation of split frequencies: 0.013052

      545500 -- (-640.507) [-644.491] (-639.976) (-642.833) * [-640.207] (-647.278) (-640.127) (-643.281) -- 0:00:27
      546000 -- (-640.643) [-640.697] (-639.203) (-640.409) * (-639.898) [-639.616] (-639.573) (-642.396) -- 0:00:27
      546500 -- (-639.543) [-640.674] (-641.869) (-639.408) * (-642.761) (-643.894) (-639.937) [-639.393] -- 0:00:27
      547000 -- [-639.191] (-642.388) (-640.186) (-639.578) * [-639.160] (-642.058) (-643.321) (-639.783) -- 0:00:27
      547500 -- [-639.687] (-643.363) (-640.713) (-640.653) * (-642.524) (-639.925) [-642.293] (-642.617) -- 0:00:27
      548000 -- (-640.620) [-642.364] (-639.762) (-645.124) * [-641.976] (-643.079) (-641.275) (-640.745) -- 0:00:27
      548500 -- (-641.578) (-641.881) (-643.263) [-644.384] * (-641.309) (-641.396) (-640.031) [-639.778] -- 0:00:27
      549000 -- (-640.579) [-639.263] (-645.583) (-641.040) * (-645.984) (-640.496) [-642.036] (-639.497) -- 0:00:27
      549500 -- [-641.535] (-639.355) (-640.782) (-643.408) * (-643.478) (-644.681) (-641.438) [-640.157] -- 0:00:27
      550000 -- (-639.234) (-642.585) (-639.279) [-640.719] * (-640.018) (-642.378) [-639.222] (-638.738) -- 0:00:27

      Average standard deviation of split frequencies: 0.013344

      550500 -- (-640.022) (-644.176) [-643.546] (-641.440) * (-641.313) (-640.975) [-639.196] (-639.170) -- 0:00:27
      551000 -- (-639.034) (-641.981) (-643.341) [-640.324] * (-646.677) (-642.983) (-640.735) [-638.774] -- 0:00:27
      551500 -- (-640.488) (-641.225) [-641.590] (-641.500) * [-640.255] (-643.892) (-640.920) (-639.438) -- 0:00:27
      552000 -- (-640.054) (-641.013) [-641.476] (-639.989) * (-646.672) (-645.562) [-643.200] (-641.122) -- 0:00:27
      552500 -- [-639.540] (-640.847) (-644.399) (-640.100) * (-640.338) (-640.140) [-640.243] (-640.747) -- 0:00:27
      553000 -- (-640.465) (-640.812) [-642.834] (-640.548) * (-640.336) (-640.007) (-641.044) [-640.288] -- 0:00:27
      553500 -- (-640.763) (-640.341) (-643.783) [-640.126] * (-640.969) (-639.717) (-640.422) [-641.210] -- 0:00:27
      554000 -- [-640.222] (-644.389) (-642.680) (-641.953) * (-645.552) (-639.359) [-640.128] (-642.267) -- 0:00:27
      554500 -- (-639.029) (-642.703) (-640.995) [-641.302] * (-640.281) (-642.344) [-640.674] (-641.842) -- 0:00:27
      555000 -- (-639.504) (-646.357) [-639.226] (-639.671) * (-642.104) (-643.186) [-639.338] (-643.259) -- 0:00:27

      Average standard deviation of split frequencies: 0.013366

      555500 -- [-641.960] (-647.182) (-639.342) (-640.814) * [-644.592] (-640.105) (-641.499) (-644.160) -- 0:00:27
      556000 -- (-641.433) (-642.451) [-640.340] (-639.963) * (-640.760) [-640.458] (-642.769) (-640.461) -- 0:00:27
      556500 -- [-642.287] (-649.349) (-643.125) (-639.839) * (-639.464) [-639.641] (-640.242) (-641.957) -- 0:00:27
      557000 -- (-641.719) [-640.155] (-646.048) (-639.811) * [-640.295] (-641.851) (-640.892) (-640.174) -- 0:00:27
      557500 -- (-640.145) (-639.409) (-641.614) [-644.814] * (-640.618) (-640.285) (-645.213) [-640.271] -- 0:00:26
      558000 -- (-641.787) (-640.729) (-640.618) [-640.421] * (-642.077) (-640.692) [-640.164] (-641.799) -- 0:00:26
      558500 -- (-640.427) (-643.990) [-640.167] (-642.915) * (-640.669) [-639.537] (-644.585) (-643.082) -- 0:00:26
      559000 -- (-639.397) [-641.113] (-638.993) (-639.722) * (-641.803) [-640.671] (-645.117) (-640.934) -- 0:00:26
      559500 -- (-640.169) [-640.115] (-642.316) (-645.948) * (-639.749) (-640.504) (-644.639) [-640.185] -- 0:00:26
      560000 -- [-640.721] (-640.648) (-641.853) (-642.728) * (-641.264) (-642.203) (-642.325) [-638.895] -- 0:00:26

      Average standard deviation of split frequencies: 0.013304

      560500 -- (-641.580) [-639.571] (-640.100) (-640.468) * (-641.242) [-641.927] (-639.876) (-641.158) -- 0:00:26
      561000 -- (-642.789) (-639.649) (-640.658) [-639.550] * (-640.266) (-642.362) (-646.862) [-640.105] -- 0:00:26
      561500 -- (-650.892) (-643.589) [-640.646] (-642.407) * (-640.810) (-641.102) (-642.155) [-640.733] -- 0:00:26
      562000 -- (-640.804) (-643.946) [-639.114] (-642.178) * [-642.714] (-643.132) (-639.948) (-640.360) -- 0:00:26
      562500 -- (-642.590) [-641.481] (-639.868) (-638.990) * (-639.411) (-642.140) [-643.466] (-641.879) -- 0:00:26
      563000 -- [-643.037] (-639.704) (-642.118) (-641.552) * (-647.179) (-645.649) (-640.184) [-641.166] -- 0:00:26
      563500 -- (-640.302) (-640.971) (-642.363) [-641.415] * [-639.780] (-642.649) (-643.038) (-640.507) -- 0:00:26
      564000 -- [-639.761] (-643.347) (-640.674) (-643.703) * (-640.872) (-644.893) [-641.087] (-638.766) -- 0:00:26
      564500 -- (-642.342) [-640.479] (-639.591) (-639.787) * (-641.128) (-645.241) (-640.078) [-639.647] -- 0:00:26
      565000 -- (-641.173) (-640.955) [-639.204] (-639.911) * (-646.185) (-642.428) (-645.067) [-640.970] -- 0:00:26

      Average standard deviation of split frequencies: 0.013228

      565500 -- (-639.697) [-641.263] (-641.229) (-639.902) * (-643.984) (-642.289) [-642.852] (-642.369) -- 0:00:26
      566000 -- (-641.088) [-639.450] (-639.933) (-642.241) * (-645.732) [-641.171] (-641.242) (-642.168) -- 0:00:26
      566500 -- (-640.617) [-640.384] (-643.140) (-643.017) * (-644.510) (-641.867) (-640.538) [-639.505] -- 0:00:26
      567000 -- [-643.267] (-642.492) (-640.668) (-639.099) * (-644.525) (-639.900) [-641.230] (-638.985) -- 0:00:25
      567500 -- (-643.539) (-644.722) [-639.910] (-639.821) * (-642.007) (-641.573) [-641.113] (-639.359) -- 0:00:26
      568000 -- (-641.332) (-639.644) (-639.878) [-640.031] * (-642.652) (-639.633) [-640.043] (-640.578) -- 0:00:26
      568500 -- (-644.404) [-641.220] (-643.495) (-639.146) * (-641.563) (-639.430) [-639.577] (-640.305) -- 0:00:26
      569000 -- (-640.244) (-640.368) [-639.217] (-639.722) * [-641.186] (-645.072) (-640.958) (-641.474) -- 0:00:26
      569500 -- (-639.731) (-641.025) [-639.771] (-645.878) * [-640.111] (-640.708) (-642.347) (-640.875) -- 0:00:26
      570000 -- [-640.495] (-643.938) (-641.881) (-640.970) * (-639.365) (-639.335) [-640.967] (-640.367) -- 0:00:26

      Average standard deviation of split frequencies: 0.013460

      570500 -- (-640.269) [-640.587] (-641.668) (-640.558) * (-641.507) (-641.757) (-643.837) [-640.226] -- 0:00:26
      571000 -- (-643.367) (-640.205) (-639.479) [-639.831] * [-638.904] (-640.071) (-640.282) (-639.033) -- 0:00:26
      571500 -- (-643.268) (-638.962) [-640.165] (-639.836) * (-640.729) [-640.375] (-640.240) (-641.517) -- 0:00:26
      572000 -- (-641.691) (-639.755) [-638.809] (-640.820) * (-641.869) [-640.842] (-639.321) (-639.939) -- 0:00:26
      572500 -- [-641.128] (-642.552) (-641.375) (-641.191) * [-640.479] (-639.706) (-641.537) (-645.232) -- 0:00:26
      573000 -- (-639.713) (-641.836) (-643.599) [-642.049] * (-641.904) (-639.205) (-641.694) [-641.667] -- 0:00:26
      573500 -- (-640.450) (-641.249) [-639.379] (-639.183) * (-640.415) (-640.488) (-639.154) [-642.175] -- 0:00:26
      574000 -- (-640.018) (-641.737) [-639.799] (-640.073) * [-641.637] (-644.614) (-642.612) (-642.647) -- 0:00:25
      574500 -- (-640.168) (-640.853) (-642.049) [-639.744] * [-642.105] (-641.885) (-642.813) (-639.976) -- 0:00:25
      575000 -- (-646.057) (-639.724) [-643.359] (-639.535) * [-643.717] (-640.881) (-641.318) (-640.648) -- 0:00:25

      Average standard deviation of split frequencies: 0.014394

      575500 -- [-640.591] (-643.021) (-640.930) (-640.981) * (-640.952) [-642.493] (-642.513) (-641.121) -- 0:00:25
      576000 -- [-642.072] (-641.219) (-644.255) (-640.229) * (-640.765) (-644.103) (-641.865) [-639.260] -- 0:00:25
      576500 -- (-641.908) [-641.424] (-643.043) (-639.869) * (-640.838) (-641.157) [-640.956] (-639.833) -- 0:00:25
      577000 -- (-639.931) (-643.372) (-640.100) [-641.855] * (-642.772) [-644.107] (-640.173) (-643.803) -- 0:00:25
      577500 -- (-640.436) (-643.130) (-641.810) [-641.850] * [-644.302] (-644.021) (-640.441) (-640.341) -- 0:00:25
      578000 -- (-639.194) (-643.648) (-640.574) [-642.203] * (-639.410) (-645.274) [-643.107] (-639.776) -- 0:00:25
      578500 -- (-639.575) [-640.855] (-644.990) (-642.823) * (-642.592) (-645.530) [-640.521] (-640.493) -- 0:00:25
      579000 -- (-640.972) (-640.743) [-639.782] (-647.925) * (-643.381) [-640.680] (-643.419) (-641.303) -- 0:00:25
      579500 -- [-641.263] (-641.821) (-639.895) (-645.463) * (-642.881) [-639.418] (-640.946) (-642.066) -- 0:00:25
      580000 -- (-643.604) (-640.256) (-645.489) [-641.002] * (-640.524) (-640.147) [-643.416] (-643.373) -- 0:00:25

      Average standard deviation of split frequencies: 0.014900

      580500 -- [-641.688] (-639.821) (-640.283) (-642.387) * (-646.850) (-638.954) (-640.774) [-639.193] -- 0:00:25
      581000 -- (-640.204) [-642.117] (-639.211) (-642.233) * [-642.342] (-640.204) (-642.948) (-644.095) -- 0:00:25
      581500 -- (-642.591) [-640.945] (-641.143) (-640.756) * (-650.454) (-641.266) (-642.423) [-641.845] -- 0:00:25
      582000 -- (-640.325) [-639.380] (-641.527) (-640.282) * (-646.816) [-646.261] (-643.138) (-642.329) -- 0:00:25
      582500 -- (-639.201) (-640.401) (-644.669) [-640.158] * (-648.633) (-642.427) (-641.136) [-639.711] -- 0:00:25
      583000 -- [-641.046] (-639.455) (-641.726) (-646.291) * (-643.321) (-643.928) [-642.090] (-639.853) -- 0:00:25
      583500 -- (-640.983) [-645.143] (-641.029) (-647.317) * (-644.290) (-639.964) (-640.228) [-641.554] -- 0:00:25
      584000 -- (-643.129) (-640.835) (-639.867) [-641.904] * (-643.195) (-640.091) (-644.142) [-639.754] -- 0:00:25
      584500 -- (-642.239) (-640.151) (-641.499) [-639.671] * (-642.388) (-640.232) [-641.382] (-641.951) -- 0:00:25
      585000 -- (-644.355) (-641.024) [-640.671] (-641.495) * [-639.824] (-639.657) (-643.619) (-641.378) -- 0:00:25

      Average standard deviation of split frequencies: 0.014257

      585500 -- (-639.557) [-639.612] (-640.472) (-640.670) * (-639.030) [-643.740] (-641.468) (-641.141) -- 0:00:25
      586000 -- (-640.441) (-640.123) [-639.756] (-639.940) * [-639.090] (-642.314) (-640.109) (-641.915) -- 0:00:25
      586500 -- [-639.598] (-643.513) (-640.426) (-639.830) * (-643.047) (-641.567) (-640.288) [-645.666] -- 0:00:25
      587000 -- (-639.660) (-641.181) [-640.477] (-639.930) * [-639.610] (-643.909) (-640.285) (-641.029) -- 0:00:25
      587500 -- (-640.593) (-643.245) (-643.076) [-639.580] * (-640.428) (-643.257) (-641.481) [-642.065] -- 0:00:25
      588000 -- [-642.022] (-641.365) (-642.059) (-641.822) * (-641.437) (-645.542) [-644.300] (-643.521) -- 0:00:25
      588500 -- (-640.580) [-639.951] (-642.187) (-640.606) * (-641.154) (-639.876) [-640.772] (-641.333) -- 0:00:25
      589000 -- (-640.406) (-640.096) [-641.258] (-639.653) * [-641.604] (-644.544) (-644.092) (-641.748) -- 0:00:25
      589500 -- (-639.397) (-639.416) (-640.431) [-640.332] * (-644.945) (-642.057) (-641.039) [-642.135] -- 0:00:25
      590000 -- (-643.408) (-640.165) (-643.009) [-641.063] * (-642.472) (-638.902) (-644.656) [-642.009] -- 0:00:25

      Average standard deviation of split frequencies: 0.014178

      590500 -- (-641.378) (-642.629) (-641.805) [-642.390] * (-641.315) (-641.986) [-644.061] (-643.538) -- 0:00:24
      591000 -- [-642.144] (-640.426) (-641.924) (-641.613) * [-639.629] (-639.737) (-644.328) (-642.095) -- 0:00:24
      591500 -- (-642.889) (-640.110) [-640.149] (-638.916) * (-643.972) [-639.256] (-644.664) (-640.654) -- 0:00:24
      592000 -- (-641.959) (-645.119) [-641.935] (-640.295) * (-639.858) (-639.116) (-639.923) [-639.740] -- 0:00:24
      592500 -- (-639.518) (-645.940) (-639.413) [-640.625] * (-641.733) (-639.567) (-640.011) [-639.692] -- 0:00:24
      593000 -- (-640.812) [-640.525] (-639.185) (-643.519) * (-641.273) [-640.398] (-641.240) (-642.372) -- 0:00:24
      593500 -- [-640.567] (-643.013) (-639.643) (-643.448) * (-640.965) (-642.265) [-640.440] (-639.297) -- 0:00:24
      594000 -- (-641.794) [-643.390] (-641.304) (-639.678) * [-641.389] (-639.736) (-640.431) (-639.090) -- 0:00:24
      594500 -- (-640.306) [-641.155] (-644.943) (-639.144) * (-643.613) [-640.147] (-639.632) (-642.127) -- 0:00:24
      595000 -- (-647.724) (-642.827) (-642.052) [-639.340] * (-641.145) [-640.170] (-641.822) (-647.664) -- 0:00:24

      Average standard deviation of split frequencies: 0.013958

      595500 -- (-639.860) (-639.496) (-640.853) [-642.833] * (-643.159) (-639.827) (-642.919) [-641.997] -- 0:00:24
      596000 -- (-639.080) (-638.968) (-639.754) [-641.841] * (-642.087) [-639.474] (-640.975) (-640.533) -- 0:00:24
      596500 -- (-639.608) [-642.703] (-646.151) (-643.371) * (-643.130) (-640.745) [-641.769] (-641.044) -- 0:00:24
      597000 -- (-642.319) (-640.683) (-639.945) [-641.414] * (-642.789) [-648.818] (-639.803) (-639.910) -- 0:00:24
      597500 -- [-641.840] (-641.178) (-642.569) (-640.177) * (-641.017) (-643.982) [-640.182] (-645.017) -- 0:00:24
      598000 -- (-641.603) [-641.941] (-643.265) (-640.685) * (-642.219) (-639.323) (-640.957) [-643.307] -- 0:00:24
      598500 -- (-641.982) (-640.716) (-641.125) [-639.096] * (-639.545) (-644.308) [-641.778] (-640.388) -- 0:00:24
      599000 -- (-642.078) (-640.829) [-640.443] (-639.211) * [-640.096] (-642.843) (-640.224) (-639.627) -- 0:00:24
      599500 -- (-639.577) (-642.124) (-641.836) [-640.738] * (-641.242) (-640.897) [-639.765] (-642.961) -- 0:00:24
      600000 -- (-646.098) (-641.637) (-640.933) [-639.378] * (-639.501) [-641.116] (-643.751) (-640.398) -- 0:00:24

      Average standard deviation of split frequencies: 0.013619

      600500 -- (-638.903) [-640.390] (-643.280) (-641.231) * [-639.382] (-644.188) (-639.591) (-639.602) -- 0:00:24
      601000 -- [-639.198] (-641.816) (-640.914) (-641.654) * (-639.658) (-641.701) (-638.894) [-639.028] -- 0:00:24
      601500 -- (-640.794) (-644.106) (-640.238) [-639.356] * [-640.676] (-640.380) (-640.523) (-641.078) -- 0:00:24
      602000 -- (-642.150) [-642.115] (-639.306) (-639.292) * (-640.262) (-640.155) [-639.002] (-644.453) -- 0:00:24
      602500 -- [-642.438] (-640.517) (-642.081) (-642.914) * [-641.751] (-644.676) (-639.236) (-642.181) -- 0:00:24
      603000 -- (-642.663) [-639.259] (-644.129) (-640.769) * (-645.944) [-640.138] (-641.156) (-640.081) -- 0:00:24
      603500 -- (-641.502) [-639.662] (-642.023) (-641.295) * (-643.720) (-641.767) [-641.247] (-641.983) -- 0:00:24
      604000 -- (-641.611) (-643.675) (-643.814) [-642.921] * (-642.578) (-643.558) [-639.339] (-639.253) -- 0:00:24
      604500 -- [-641.756] (-641.543) (-640.448) (-639.674) * (-639.720) (-643.106) [-640.335] (-638.827) -- 0:00:24
      605000 -- (-641.081) [-640.795] (-643.807) (-640.079) * (-643.232) (-645.759) (-640.837) [-639.475] -- 0:00:24

      Average standard deviation of split frequencies: 0.013087

      605500 -- (-640.344) (-641.459) (-640.577) [-643.580] * (-641.501) [-641.315] (-641.622) (-638.971) -- 0:00:24
      606000 -- (-642.294) [-640.448] (-639.915) (-640.434) * (-639.849) [-642.844] (-639.626) (-640.885) -- 0:00:24
      606500 -- (-642.022) (-639.959) [-640.848] (-639.385) * (-641.843) [-639.422] (-639.257) (-639.992) -- 0:00:24
      607000 -- (-641.632) [-641.732] (-642.245) (-640.075) * (-642.529) (-639.448) [-639.828] (-640.129) -- 0:00:23
      607500 -- (-639.571) (-641.951) (-641.763) [-640.335] * (-646.158) (-643.376) [-640.996] (-639.226) -- 0:00:23
      608000 -- (-640.763) (-643.515) [-644.157] (-639.502) * (-639.801) (-650.282) (-640.757) [-645.332] -- 0:00:23
      608500 -- (-642.499) (-644.707) (-641.750) [-640.207] * (-639.924) (-640.826) (-639.095) [-639.550] -- 0:00:23
      609000 -- (-640.091) (-643.415) (-640.615) [-640.478] * (-639.912) [-639.769] (-639.865) (-640.569) -- 0:00:23
      609500 -- (-640.292) [-639.565] (-642.952) (-640.068) * (-642.370) [-640.697] (-641.666) (-640.035) -- 0:00:23
      610000 -- (-640.447) [-640.172] (-640.315) (-642.140) * (-640.536) (-642.415) (-644.172) [-639.125] -- 0:00:23

      Average standard deviation of split frequencies: 0.013577

      610500 -- (-639.633) (-640.772) [-639.319] (-641.136) * (-638.870) (-647.204) [-640.754] (-639.437) -- 0:00:23
      611000 -- (-644.289) [-640.585] (-642.179) (-647.316) * (-642.756) (-640.679) [-640.263] (-639.136) -- 0:00:23
      611500 -- (-639.956) [-642.003] (-640.144) (-642.956) * [-642.768] (-641.787) (-639.158) (-640.210) -- 0:00:23
      612000 -- (-640.523) [-640.163] (-640.131) (-640.366) * [-642.947] (-646.217) (-641.408) (-640.129) -- 0:00:23
      612500 -- (-639.402) (-639.425) [-639.986] (-639.602) * [-643.251] (-646.106) (-641.639) (-643.417) -- 0:00:23
      613000 -- [-643.301] (-639.469) (-643.223) (-642.698) * (-643.954) (-641.614) (-640.309) [-641.228] -- 0:00:23
      613500 -- (-641.984) [-641.055] (-640.878) (-639.915) * (-641.677) (-639.978) [-639.883] (-645.604) -- 0:00:23
      614000 -- (-641.730) [-642.583] (-638.795) (-640.080) * (-643.830) (-640.795) (-640.748) [-643.043] -- 0:00:23
      614500 -- (-640.062) [-643.073] (-641.653) (-640.002) * (-642.160) [-640.075] (-640.459) (-645.715) -- 0:00:23
      615000 -- (-641.493) (-640.232) [-640.080] (-641.305) * (-646.335) [-639.378] (-640.204) (-641.699) -- 0:00:23

      Average standard deviation of split frequencies: 0.014225

      615500 -- (-640.375) [-640.285] (-641.414) (-647.095) * (-639.723) (-639.083) (-639.221) [-640.206] -- 0:00:23
      616000 -- (-644.279) (-641.227) [-641.408] (-640.677) * (-644.343) [-639.930] (-643.178) (-639.600) -- 0:00:23
      616500 -- [-640.457] (-642.432) (-639.094) (-642.171) * [-642.312] (-640.865) (-642.126) (-641.775) -- 0:00:23
      617000 -- [-643.435] (-643.019) (-641.158) (-646.776) * (-641.553) [-641.668] (-643.397) (-640.440) -- 0:00:23
      617500 -- (-642.488) (-645.383) (-643.419) [-644.277] * (-641.954) (-641.735) (-653.616) [-639.950] -- 0:00:23
      618000 -- [-641.298] (-640.538) (-641.148) (-642.789) * (-643.532) (-640.703) (-641.353) [-640.469] -- 0:00:23
      618500 -- (-642.894) (-639.743) [-641.155] (-642.499) * [-642.572] (-639.915) (-645.480) (-640.124) -- 0:00:23
      619000 -- (-642.057) (-641.827) (-643.425) [-639.754] * (-642.028) (-641.477) (-641.692) [-640.682] -- 0:00:23
      619500 -- (-643.513) (-643.452) [-641.550] (-640.161) * [-639.728] (-641.191) (-639.255) (-640.444) -- 0:00:23
      620000 -- (-639.533) (-644.636) [-640.333] (-640.041) * (-644.129) [-642.278] (-641.318) (-639.880) -- 0:00:23

      Average standard deviation of split frequencies: 0.013850

      620500 -- [-640.043] (-643.003) (-643.694) (-642.446) * (-640.004) [-641.195] (-639.739) (-640.594) -- 0:00:23
      621000 -- [-642.908] (-639.599) (-640.675) (-641.379) * (-644.171) (-639.877) [-641.997] (-641.222) -- 0:00:23
      621500 -- (-640.478) (-640.364) (-639.107) [-641.127] * (-643.121) (-639.688) (-640.672) [-644.788] -- 0:00:23
      622000 -- (-639.992) (-640.393) (-639.108) [-644.811] * (-648.077) (-639.096) [-640.548] (-640.843) -- 0:00:23
      622500 -- [-641.426] (-640.638) (-641.613) (-644.708) * (-641.011) (-639.337) (-640.751) [-640.379] -- 0:00:23
      623000 -- (-642.582) (-640.214) [-639.026] (-641.296) * (-644.396) [-641.181] (-646.952) (-641.678) -- 0:00:22
      623500 -- (-640.150) (-642.822) [-639.490] (-647.234) * (-642.884) (-641.859) [-641.994] (-641.597) -- 0:00:22
      624000 -- (-639.777) [-641.426] (-640.955) (-639.553) * [-641.017] (-640.850) (-647.135) (-640.565) -- 0:00:22
      624500 -- (-639.442) (-641.225) (-642.241) [-639.899] * (-641.217) [-640.831] (-644.507) (-642.915) -- 0:00:22
      625000 -- (-639.494) (-641.437) [-640.777] (-640.050) * (-645.043) (-643.001) [-642.149] (-641.559) -- 0:00:22

      Average standard deviation of split frequencies: 0.014175

      625500 -- (-639.110) (-639.456) (-643.938) [-642.023] * [-639.014] (-640.309) (-640.795) (-640.680) -- 0:00:22
      626000 -- (-641.059) (-639.089) [-642.226] (-639.840) * (-639.460) (-642.460) [-642.144] (-641.839) -- 0:00:22
      626500 -- (-643.479) (-639.753) (-643.309) [-639.994] * (-640.672) (-640.842) [-640.240] (-643.652) -- 0:00:22
      627000 -- (-648.319) (-641.079) (-640.536) [-639.514] * [-640.168] (-640.050) (-640.576) (-640.044) -- 0:00:22
      627500 -- [-641.741] (-641.360) (-642.390) (-639.815) * (-640.120) (-641.847) [-641.095] (-643.984) -- 0:00:22
      628000 -- [-641.952] (-641.002) (-642.168) (-639.783) * (-642.253) [-641.531] (-640.845) (-644.499) -- 0:00:22
      628500 -- (-642.011) (-643.232) [-640.233] (-640.372) * [-640.276] (-640.909) (-640.726) (-643.608) -- 0:00:22
      629000 -- (-641.546) (-640.471) [-639.446] (-642.218) * (-641.447) [-641.508] (-641.380) (-643.247) -- 0:00:22
      629500 -- (-642.472) [-642.917] (-643.126) (-640.419) * (-640.599) (-640.028) (-639.358) [-642.723] -- 0:00:22
      630000 -- [-640.748] (-642.483) (-644.756) (-639.312) * (-641.755) (-641.580) [-640.186] (-639.574) -- 0:00:22

      Average standard deviation of split frequencies: 0.014290

      630500 -- (-642.462) [-639.882] (-640.300) (-641.207) * [-640.382] (-642.067) (-640.352) (-646.287) -- 0:00:22
      631000 -- [-640.111] (-640.510) (-641.048) (-641.283) * [-640.514] (-641.634) (-639.443) (-641.447) -- 0:00:22
      631500 -- (-639.216) [-640.958] (-642.442) (-640.868) * (-643.070) (-640.199) (-642.472) [-640.774] -- 0:00:22
      632000 -- (-642.841) (-643.340) (-642.584) [-641.054] * (-641.890) (-640.014) (-644.008) [-640.774] -- 0:00:22
      632500 -- (-641.137) (-647.718) (-645.988) [-640.671] * (-639.281) [-640.435] (-639.568) (-642.025) -- 0:00:22
      633000 -- (-646.010) (-644.359) [-640.816] (-641.005) * [-641.035] (-640.455) (-641.104) (-642.240) -- 0:00:22
      633500 -- (-641.084) [-639.668] (-641.856) (-643.514) * (-642.210) (-643.217) (-640.388) [-640.286] -- 0:00:22
      634000 -- (-641.294) [-639.678] (-643.465) (-642.825) * (-643.206) (-644.040) [-640.290] (-642.018) -- 0:00:22
      634500 -- (-641.892) [-639.160] (-641.121) (-645.619) * (-639.354) (-639.973) [-641.507] (-639.451) -- 0:00:22
      635000 -- (-640.863) (-640.568) [-639.521] (-640.390) * [-639.383] (-640.653) (-639.764) (-639.946) -- 0:00:22

      Average standard deviation of split frequencies: 0.013821

      635500 -- (-640.314) [-643.858] (-643.443) (-645.757) * (-640.795) (-644.410) [-638.981] (-642.602) -- 0:00:22
      636000 -- (-642.991) (-642.971) [-639.551] (-645.298) * (-643.067) (-644.226) [-640.090] (-643.869) -- 0:00:22
      636500 -- [-640.716] (-643.374) (-641.289) (-641.388) * (-640.813) (-638.810) [-640.836] (-641.599) -- 0:00:22
      637000 -- (-642.524) (-644.371) [-641.417] (-639.318) * (-641.102) [-642.559] (-640.450) (-640.166) -- 0:00:22
      637500 -- (-640.969) (-640.276) [-640.856] (-639.262) * [-640.736] (-640.511) (-639.190) (-644.067) -- 0:00:22
      638000 -- [-640.060] (-639.186) (-640.283) (-640.559) * (-640.035) [-639.940] (-639.513) (-641.462) -- 0:00:22
      638500 -- [-640.348] (-640.976) (-641.492) (-648.843) * (-641.750) (-641.562) [-640.418] (-645.177) -- 0:00:22
      639000 -- (-641.455) [-639.567] (-642.497) (-641.920) * [-644.976] (-642.359) (-641.635) (-642.745) -- 0:00:22
      639500 -- (-640.436) [-639.868] (-639.374) (-646.740) * (-646.015) (-642.788) [-643.260] (-640.573) -- 0:00:21
      640000 -- (-643.821) [-643.192] (-640.712) (-639.390) * (-640.538) (-641.502) (-640.674) [-639.612] -- 0:00:21

      Average standard deviation of split frequencies: 0.013937

      640500 -- (-642.187) (-640.338) (-643.425) [-641.366] * [-639.258] (-640.453) (-641.029) (-640.181) -- 0:00:21
      641000 -- (-640.397) [-641.022] (-646.284) (-641.359) * (-639.158) (-639.983) [-639.826] (-639.176) -- 0:00:21
      641500 -- (-640.479) [-639.139] (-642.187) (-641.987) * (-642.590) [-642.836] (-639.736) (-639.878) -- 0:00:21
      642000 -- (-642.210) [-640.222] (-644.422) (-643.201) * [-641.237] (-643.406) (-639.253) (-642.650) -- 0:00:21
      642500 -- (-640.932) [-640.123] (-641.227) (-641.187) * [-641.016] (-641.482) (-644.829) (-639.152) -- 0:00:21
      643000 -- (-638.884) [-639.950] (-641.735) (-640.494) * (-641.294) [-645.010] (-642.165) (-641.196) -- 0:00:21
      643500 -- (-642.805) [-639.313] (-642.845) (-642.073) * (-641.122) [-644.248] (-640.939) (-640.550) -- 0:00:21
      644000 -- (-643.013) (-639.498) [-641.403] (-642.380) * (-641.530) (-642.589) (-642.014) [-642.038] -- 0:00:21
      644500 -- (-642.071) (-640.998) [-642.009] (-643.818) * (-640.645) [-642.006] (-647.541) (-639.854) -- 0:00:21
      645000 -- [-644.771] (-638.985) (-641.518) (-642.078) * (-641.231) (-643.534) [-642.817] (-641.002) -- 0:00:21

      Average standard deviation of split frequencies: 0.013951

      645500 -- [-644.164] (-640.746) (-642.062) (-639.451) * (-640.408) (-641.681) (-642.790) [-642.230] -- 0:00:21
      646000 -- (-643.229) [-641.763] (-642.078) (-645.110) * (-639.237) (-642.255) [-641.879] (-642.711) -- 0:00:21
      646500 -- (-642.258) [-639.920] (-641.080) (-641.028) * (-639.407) [-639.559] (-642.285) (-642.629) -- 0:00:21
      647000 -- (-640.827) [-639.474] (-640.834) (-640.449) * (-640.088) (-641.278) (-641.617) [-639.253] -- 0:00:21
      647500 -- (-641.727) (-642.242) [-640.378] (-642.231) * [-641.065] (-640.844) (-644.272) (-640.881) -- 0:00:21
      648000 -- (-642.336) (-642.378) (-640.029) [-642.155] * [-641.426] (-642.599) (-644.648) (-645.505) -- 0:00:21
      648500 -- (-639.404) [-641.602] (-644.588) (-640.535) * [-644.114] (-647.292) (-640.441) (-643.538) -- 0:00:21
      649000 -- [-642.827] (-639.609) (-644.083) (-643.294) * (-642.032) (-642.834) [-640.933] (-642.912) -- 0:00:21
      649500 -- [-639.573] (-639.584) (-642.083) (-644.134) * (-643.110) [-640.397] (-640.076) (-640.101) -- 0:00:21
      650000 -- (-646.135) (-640.779) [-640.792] (-642.161) * (-649.175) [-643.210] (-639.631) (-640.934) -- 0:00:21

      Average standard deviation of split frequencies: 0.014490

      650500 -- (-643.036) (-642.102) [-640.877] (-642.182) * (-647.889) (-642.917) [-643.441] (-640.799) -- 0:00:21
      651000 -- [-642.466] (-640.374) (-645.296) (-640.329) * (-642.361) (-640.424) (-641.261) [-639.469] -- 0:00:21
      651500 -- (-640.346) [-644.554] (-642.833) (-640.598) * (-643.359) [-638.880] (-645.188) (-639.430) -- 0:00:21
      652000 -- [-639.921] (-645.449) (-643.696) (-640.569) * [-643.837] (-639.165) (-642.292) (-639.972) -- 0:00:21
      652500 -- (-642.274) (-641.643) (-640.782) [-639.160] * (-644.235) [-639.317] (-643.471) (-646.663) -- 0:00:21
      653000 -- [-642.413] (-641.643) (-642.367) (-640.745) * (-642.258) [-639.435] (-643.645) (-647.446) -- 0:00:21
      653500 -- (-640.436) (-640.780) (-639.981) [-640.399] * (-642.149) (-641.351) [-641.912] (-645.744) -- 0:00:21
      654000 -- (-640.428) [-639.363] (-641.669) (-640.834) * (-639.208) (-642.488) (-643.775) [-641.317] -- 0:00:21
      654500 -- (-641.537) [-642.543] (-642.612) (-641.578) * (-639.264) (-643.948) [-643.655] (-640.079) -- 0:00:21
      655000 -- (-643.865) (-641.846) (-640.031) [-639.916] * (-639.611) (-647.815) (-640.145) [-640.177] -- 0:00:21

      Average standard deviation of split frequencies: 0.014457

      655500 -- [-640.595] (-641.618) (-640.072) (-639.848) * (-641.431) [-640.684] (-640.407) (-643.041) -- 0:00:21
      656000 -- [-639.289] (-639.850) (-640.237) (-640.741) * (-646.854) (-643.192) [-641.183] (-642.741) -- 0:00:20
      656500 -- (-639.580) (-640.775) (-639.961) [-639.814] * [-641.832] (-639.383) (-640.967) (-639.478) -- 0:00:20
      657000 -- (-641.587) (-639.554) [-641.967] (-641.672) * [-642.399] (-643.311) (-643.825) (-639.773) -- 0:00:20
      657500 -- (-640.493) (-639.636) [-643.545] (-641.252) * (-640.915) (-640.853) [-642.985] (-643.530) -- 0:00:20
      658000 -- (-641.151) (-641.038) (-639.320) [-640.619] * (-640.825) (-640.991) (-639.723) [-643.315] -- 0:00:20
      658500 -- (-640.731) (-645.329) [-641.591] (-639.749) * [-642.440] (-643.319) (-643.949) (-639.605) -- 0:00:20
      659000 -- (-641.399) (-640.931) (-641.447) [-639.288] * (-640.476) (-644.465) (-641.738) [-639.984] -- 0:00:20
      659500 -- [-640.696] (-642.221) (-641.423) (-639.852) * (-639.611) (-644.282) [-639.749] (-640.219) -- 0:00:20
      660000 -- (-641.330) (-640.128) (-641.451) [-640.468] * (-638.905) (-642.711) (-640.016) [-640.718] -- 0:00:20

      Average standard deviation of split frequencies: 0.014103

      660500 -- (-640.889) (-640.413) [-643.849] (-642.910) * [-641.515] (-639.518) (-646.230) (-645.286) -- 0:00:20
      661000 -- (-640.681) (-640.649) [-645.781] (-639.953) * (-640.028) (-642.789) [-639.769] (-641.999) -- 0:00:20
      661500 -- [-641.624] (-640.449) (-641.032) (-642.293) * (-641.015) (-639.243) [-639.824] (-639.668) -- 0:00:20
      662000 -- (-640.039) (-641.604) (-639.219) [-641.784] * [-640.267] (-643.671) (-643.540) (-639.956) -- 0:00:20
      662500 -- (-640.564) [-642.636] (-641.269) (-639.879) * (-639.719) [-650.291] (-642.239) (-643.210) -- 0:00:20
      663000 -- (-640.272) [-642.989] (-642.726) (-640.761) * (-640.877) [-640.997] (-643.611) (-642.030) -- 0:00:20
      663500 -- (-639.454) (-640.570) (-643.847) [-640.616] * (-647.640) (-640.263) [-640.757] (-639.328) -- 0:00:20
      664000 -- (-643.562) (-644.567) [-641.296] (-644.232) * (-640.771) (-641.015) (-640.028) [-640.492] -- 0:00:20
      664500 -- (-643.972) (-641.800) [-642.408] (-643.364) * (-638.857) (-640.361) [-639.487] (-641.414) -- 0:00:20
      665000 -- (-642.337) (-643.203) (-643.461) [-639.544] * (-643.387) (-641.745) [-639.071] (-643.270) -- 0:00:20

      Average standard deviation of split frequencies: 0.013823

      665500 -- (-642.195) (-646.821) [-640.189] (-646.700) * (-640.579) [-643.293] (-638.945) (-640.620) -- 0:00:20
      666000 -- [-639.770] (-643.100) (-643.577) (-644.935) * (-643.006) (-646.715) [-644.631] (-641.773) -- 0:00:20
      666500 -- (-641.471) [-640.081] (-641.462) (-642.281) * (-645.717) (-643.099) (-640.479) [-643.238] -- 0:00:20
      667000 -- (-639.884) (-642.114) [-640.708] (-643.691) * (-646.302) (-644.077) [-640.137] (-641.830) -- 0:00:20
      667500 -- [-640.306] (-643.951) (-642.104) (-640.992) * (-640.840) (-642.795) [-641.396] (-644.650) -- 0:00:20
      668000 -- (-640.028) (-644.870) (-644.491) [-641.552] * [-639.802] (-643.078) (-645.253) (-640.438) -- 0:00:20
      668500 -- [-641.837] (-639.809) (-641.299) (-640.493) * [-639.548] (-644.151) (-644.707) (-640.400) -- 0:00:20
      669000 -- (-642.835) [-639.986] (-642.499) (-641.260) * (-641.070) (-641.446) [-639.502] (-642.193) -- 0:00:20
      669500 -- (-648.772) (-641.806) (-641.714) [-640.121] * (-640.602) (-639.062) (-639.974) [-646.731] -- 0:00:20
      670000 -- (-644.950) (-640.794) [-641.816] (-641.513) * [-639.526] (-639.515) (-640.496) (-641.002) -- 0:00:20

      Average standard deviation of split frequencies: 0.013024

      670500 -- (-644.259) (-639.270) (-639.909) [-640.473] * (-639.892) [-640.904] (-644.114) (-640.367) -- 0:00:20
      671000 -- [-640.325] (-639.220) (-641.039) (-641.376) * (-641.410) (-644.338) [-641.134] (-642.284) -- 0:00:20
      671500 -- [-642.123] (-641.553) (-639.385) (-639.437) * (-640.880) [-642.434] (-639.420) (-641.557) -- 0:00:20
      672000 -- (-640.047) (-640.249) [-643.922] (-639.439) * (-640.402) (-643.327) (-640.628) [-642.191] -- 0:00:20
      672500 -- (-640.712) [-640.480] (-648.616) (-639.523) * [-641.076] (-639.987) (-640.260) (-641.831) -- 0:00:19
      673000 -- (-643.290) (-640.430) (-641.620) [-639.116] * (-639.925) (-640.543) (-640.662) [-643.666] -- 0:00:19
      673500 -- (-643.230) (-649.627) (-640.586) [-642.086] * (-641.073) (-639.935) [-641.414] (-644.330) -- 0:00:19
      674000 -- (-644.881) (-641.176) [-641.800] (-639.943) * (-640.994) (-642.016) [-640.281] (-642.692) -- 0:00:19
      674500 -- (-640.792) [-643.686] (-642.144) (-640.706) * [-639.789] (-640.350) (-644.674) (-642.028) -- 0:00:19
      675000 -- [-640.163] (-642.016) (-639.061) (-639.816) * [-641.013] (-639.909) (-641.218) (-640.590) -- 0:00:19

      Average standard deviation of split frequencies: 0.012429

      675500 -- (-640.030) (-642.171) [-641.565] (-645.733) * (-639.716) [-641.062] (-640.029) (-645.725) -- 0:00:19
      676000 -- (-641.795) (-642.997) [-639.617] (-642.563) * [-639.406] (-639.522) (-640.390) (-647.189) -- 0:00:19
      676500 -- (-642.946) [-640.356] (-639.725) (-639.966) * (-642.485) (-641.341) [-640.519] (-644.450) -- 0:00:19
      677000 -- (-641.706) [-640.256] (-640.105) (-643.078) * (-646.767) [-641.402] (-639.985) (-640.957) -- 0:00:19
      677500 -- [-639.746] (-640.543) (-641.351) (-639.631) * (-640.839) [-640.419] (-642.111) (-639.451) -- 0:00:19
      678000 -- (-641.339) (-644.523) [-641.907] (-641.493) * (-641.078) [-639.538] (-643.864) (-639.451) -- 0:00:19
      678500 -- (-643.258) (-643.965) (-640.503) [-641.961] * (-640.614) (-639.260) [-640.932] (-639.824) -- 0:00:19
      679000 -- (-640.242) [-640.080] (-642.082) (-640.602) * [-642.052] (-639.260) (-641.839) (-641.584) -- 0:00:19
      679500 -- (-641.417) (-643.824) [-643.966] (-644.060) * (-642.009) (-640.635) [-640.279] (-640.755) -- 0:00:19
      680000 -- [-644.730] (-640.323) (-639.160) (-643.457) * [-639.895] (-642.369) (-639.524) (-641.395) -- 0:00:19

      Average standard deviation of split frequencies: 0.013159

      680500 -- (-640.699) (-639.776) (-641.821) [-643.851] * [-639.596] (-642.453) (-640.329) (-641.240) -- 0:00:19
      681000 -- (-639.695) (-640.962) (-640.028) [-643.593] * (-640.956) (-642.025) [-641.922] (-641.784) -- 0:00:19
      681500 -- (-640.082) [-644.011] (-640.997) (-640.457) * (-641.692) (-640.017) [-642.942] (-639.886) -- 0:00:19
      682000 -- [-641.059] (-642.976) (-640.851) (-639.216) * (-643.962) (-640.203) (-641.250) [-640.035] -- 0:00:19
      682500 -- (-641.414) (-641.881) [-640.482] (-639.169) * [-639.774] (-642.894) (-640.090) (-640.668) -- 0:00:19
      683000 -- (-640.017) (-640.638) (-639.579) [-639.399] * (-639.994) (-639.109) (-642.948) [-639.986] -- 0:00:19
      683500 -- (-640.013) (-639.397) [-640.086] (-639.355) * [-641.560] (-641.264) (-640.706) (-640.870) -- 0:00:19
      684000 -- (-641.190) (-640.057) [-639.878] (-640.989) * [-644.230] (-642.090) (-643.338) (-642.149) -- 0:00:19
      684500 -- (-641.010) (-644.710) (-639.901) [-642.214] * (-640.886) [-640.642] (-641.159) (-642.036) -- 0:00:19
      685000 -- (-643.547) (-640.315) (-643.970) [-641.760] * (-644.600) [-642.570] (-641.329) (-640.193) -- 0:00:19

      Average standard deviation of split frequencies: 0.012612

      685500 -- (-642.115) (-639.731) [-641.385] (-639.353) * (-639.494) (-641.629) [-640.815] (-639.875) -- 0:00:19
      686000 -- [-641.610] (-639.473) (-639.864) (-640.444) * [-639.083] (-641.649) (-640.341) (-644.930) -- 0:00:19
      686500 -- (-646.997) [-639.650] (-639.159) (-640.907) * [-642.014] (-640.958) (-644.960) (-641.464) -- 0:00:19
      687000 -- (-641.525) (-644.715) (-640.047) [-639.798] * (-639.460) [-640.573] (-643.864) (-640.413) -- 0:00:19
      687500 -- (-641.044) (-641.271) (-640.932) [-640.214] * (-640.950) (-641.822) (-640.396) [-641.293] -- 0:00:19
      688000 -- (-640.094) (-640.210) [-639.744] (-640.144) * [-639.567] (-639.896) (-640.404) (-642.829) -- 0:00:19
      688500 -- (-641.801) (-644.413) (-640.951) [-639.931] * (-643.340) (-642.245) (-645.375) [-641.213] -- 0:00:19
      689000 -- (-640.204) [-640.281] (-640.699) (-640.342) * [-645.710] (-643.851) (-640.955) (-639.904) -- 0:00:18
      689500 -- (-640.896) [-640.689] (-642.338) (-641.906) * (-650.908) (-640.013) [-645.111] (-639.226) -- 0:00:18
      690000 -- (-641.402) (-641.062) [-642.626] (-642.237) * [-645.202] (-639.159) (-641.491) (-639.475) -- 0:00:18

      Average standard deviation of split frequencies: 0.012808

      690500 -- (-641.885) [-639.925] (-639.682) (-641.974) * (-640.399) (-640.250) (-639.327) [-642.040] -- 0:00:18
      691000 -- [-641.563] (-639.230) (-640.712) (-642.183) * [-642.461] (-640.556) (-641.295) (-642.277) -- 0:00:18
      691500 -- (-640.182) (-639.844) (-640.088) [-639.826] * [-640.722] (-642.247) (-639.863) (-643.874) -- 0:00:18
      692000 -- (-640.770) (-640.452) (-642.444) [-640.146] * (-639.384) (-644.147) [-642.808] (-642.330) -- 0:00:18
      692500 -- (-639.417) (-646.106) [-639.390] (-639.541) * (-639.109) (-642.287) [-643.314] (-640.197) -- 0:00:18
      693000 -- (-643.364) (-644.235) (-639.888) [-642.164] * (-641.430) (-639.723) (-640.543) [-641.376] -- 0:00:18
      693500 -- (-642.263) (-642.368) (-640.588) [-640.084] * [-640.470] (-639.643) (-639.286) (-640.267) -- 0:00:18
      694000 -- [-644.234] (-639.969) (-641.307) (-640.200) * (-642.618) [-639.062] (-640.731) (-639.518) -- 0:00:18
      694500 -- (-640.062) (-641.538) [-640.246] (-639.443) * (-640.290) [-639.386] (-640.315) (-642.251) -- 0:00:18
      695000 -- [-640.479] (-641.597) (-642.025) (-640.055) * [-639.543] (-640.577) (-639.253) (-640.217) -- 0:00:18

      Average standard deviation of split frequencies: 0.012590

      695500 -- [-639.053] (-646.972) (-642.174) (-641.364) * (-641.145) (-640.526) (-641.788) [-639.764] -- 0:00:18
      696000 -- (-640.471) [-641.296] (-640.151) (-641.945) * (-641.722) (-642.474) [-639.481] (-645.741) -- 0:00:18
      696500 -- (-640.558) (-643.295) [-640.174] (-642.019) * (-639.852) [-641.565] (-640.540) (-640.480) -- 0:00:18
      697000 -- [-639.598] (-641.166) (-642.970) (-639.060) * (-643.689) [-642.755] (-642.141) (-638.866) -- 0:00:18
      697500 -- (-641.414) (-640.363) (-639.949) [-640.943] * (-640.418) (-640.921) [-640.514] (-641.582) -- 0:00:18
      698000 -- (-641.175) (-640.309) (-639.588) [-639.266] * (-640.417) [-644.392] (-643.870) (-642.501) -- 0:00:18
      698500 -- (-642.359) (-642.301) (-639.752) [-639.990] * (-640.597) [-641.235] (-641.455) (-641.495) -- 0:00:18
      699000 -- (-642.924) (-645.574) (-643.001) [-641.315] * (-640.416) [-641.342] (-640.090) (-640.637) -- 0:00:18
      699500 -- (-643.107) (-643.498) (-642.184) [-642.067] * (-642.449) (-645.612) [-640.598] (-640.647) -- 0:00:18
      700000 -- (-646.434) (-639.304) (-645.417) [-640.391] * (-647.196) (-644.431) (-645.051) [-640.846] -- 0:00:18

      Average standard deviation of split frequencies: 0.012269

      700500 -- [-643.207] (-640.132) (-643.664) (-641.157) * (-640.409) (-642.168) (-643.926) [-640.687] -- 0:00:18
      701000 -- (-644.504) [-641.143] (-640.907) (-640.035) * (-643.269) [-639.560] (-642.315) (-640.494) -- 0:00:18
      701500 -- (-640.200) (-640.503) (-642.520) [-640.903] * [-639.358] (-643.369) (-646.129) (-639.536) -- 0:00:18
      702000 -- [-641.385] (-642.796) (-640.235) (-641.473) * [-642.895] (-640.812) (-639.366) (-639.500) -- 0:00:18
      702500 -- (-639.253) [-640.768] (-642.007) (-640.661) * (-642.573) (-643.497) (-640.735) [-640.393] -- 0:00:18
      703000 -- (-639.553) (-644.887) (-641.331) [-642.965] * (-639.870) (-645.072) (-643.215) [-640.978] -- 0:00:18
      703500 -- (-641.208) (-642.469) [-639.977] (-644.248) * (-639.901) [-639.987] (-640.776) (-640.992) -- 0:00:18
      704000 -- [-641.471] (-643.943) (-643.649) (-645.377) * [-639.226] (-640.353) (-644.631) (-640.124) -- 0:00:18
      704500 -- (-640.019) [-643.695] (-644.096) (-642.912) * (-639.485) (-640.523) [-641.528] (-640.074) -- 0:00:18
      705000 -- [-639.222] (-641.197) (-640.293) (-640.481) * (-643.069) (-640.439) (-645.663) [-642.766] -- 0:00:17

      Average standard deviation of split frequencies: 0.011833

      705500 -- (-640.219) (-639.941) (-641.022) [-639.159] * (-641.895) (-643.118) (-639.627) [-641.300] -- 0:00:17
      706000 -- (-644.528) (-641.749) (-641.601) [-639.226] * [-640.055] (-641.409) (-640.978) (-640.167) -- 0:00:17
      706500 -- (-640.760) (-643.798) [-640.056] (-640.344) * (-640.465) [-640.879] (-641.576) (-640.019) -- 0:00:17
      707000 -- (-642.016) [-642.422] (-642.206) (-640.546) * (-640.422) (-639.799) (-641.046) [-639.027] -- 0:00:17
      707500 -- (-642.078) [-639.597] (-640.771) (-639.409) * [-643.360] (-640.303) (-642.475) (-640.678) -- 0:00:17
      708000 -- (-642.995) [-639.049] (-643.318) (-639.549) * [-642.983] (-647.358) (-639.488) (-640.331) -- 0:00:17
      708500 -- (-642.796) [-641.417] (-641.636) (-642.226) * (-641.460) (-644.993) (-640.362) [-639.727] -- 0:00:17
      709000 -- (-643.823) (-643.667) (-639.464) [-640.991] * [-640.927] (-640.393) (-640.608) (-643.501) -- 0:00:17
      709500 -- (-644.534) (-639.643) (-645.554) [-639.288] * [-641.480] (-638.918) (-639.133) (-640.645) -- 0:00:17
      710000 -- (-640.809) (-640.170) [-642.114] (-639.998) * (-645.138) [-638.990] (-639.558) (-642.714) -- 0:00:17

      Average standard deviation of split frequencies: 0.011940

      710500 -- (-640.542) (-640.903) (-640.466) [-641.609] * (-643.236) [-640.902] (-646.102) (-643.384) -- 0:00:17
      711000 -- (-643.073) (-640.953) (-640.121) [-640.315] * [-641.454] (-640.570) (-644.671) (-639.576) -- 0:00:17
      711500 -- (-640.562) [-640.054] (-639.592) (-641.730) * [-639.208] (-643.207) (-640.589) (-640.558) -- 0:00:17
      712000 -- (-639.645) (-641.045) (-639.041) [-641.060] * (-639.630) (-642.313) [-641.326] (-641.363) -- 0:00:17
      712500 -- (-640.487) (-641.866) (-640.676) [-644.117] * (-640.572) (-642.821) (-642.209) [-639.655] -- 0:00:17
      713000 -- [-639.829] (-642.922) (-641.951) (-643.697) * (-641.933) [-642.720] (-639.962) (-644.090) -- 0:00:17
      713500 -- (-640.436) (-641.091) [-642.405] (-639.706) * (-641.084) (-642.807) [-641.176] (-640.600) -- 0:00:17
      714000 -- (-640.783) (-641.885) (-642.847) [-641.064] * (-646.369) (-647.342) (-641.828) [-640.422] -- 0:00:17
      714500 -- (-639.383) [-640.738] (-647.202) (-639.857) * (-640.361) (-642.826) (-642.486) [-639.879] -- 0:00:17
      715000 -- [-641.552] (-640.455) (-641.583) (-639.481) * (-639.882) [-641.526] (-646.479) (-640.336) -- 0:00:17

      Average standard deviation of split frequencies: 0.011851

      715500 -- [-644.708] (-643.084) (-639.856) (-638.875) * (-640.016) (-640.221) (-641.622) [-642.876] -- 0:00:17
      716000 -- (-640.718) (-643.806) [-642.128] (-640.866) * [-640.099] (-640.861) (-640.428) (-645.616) -- 0:00:17
      716500 -- [-642.156] (-642.494) (-641.070) (-640.043) * (-641.246) (-642.858) (-643.893) [-642.719] -- 0:00:17
      717000 -- (-642.415) (-640.954) (-645.148) [-640.776] * (-639.734) (-640.219) (-643.057) [-640.149] -- 0:00:17
      717500 -- [-641.369] (-640.139) (-643.857) (-642.001) * (-639.586) (-643.050) [-642.903] (-645.885) -- 0:00:17
      718000 -- (-641.091) (-638.745) [-641.617] (-640.788) * (-640.130) [-640.605] (-640.829) (-641.020) -- 0:00:17
      718500 -- (-638.957) [-640.294] (-639.437) (-640.668) * (-641.944) (-641.946) [-641.558] (-639.265) -- 0:00:17
      719000 -- (-642.857) (-643.523) [-640.780] (-640.515) * (-641.720) (-639.412) [-640.270] (-641.576) -- 0:00:17
      719500 -- [-639.649] (-639.454) (-641.571) (-639.547) * (-643.186) [-640.818] (-640.391) (-640.470) -- 0:00:17
      720000 -- (-643.327) (-639.483) [-643.681] (-639.495) * (-639.491) [-640.312] (-639.757) (-641.886) -- 0:00:17

      Average standard deviation of split frequencies: 0.011582

      720500 -- (-641.679) (-641.320) (-643.099) [-639.316] * [-640.398] (-642.260) (-639.802) (-641.400) -- 0:00:17
      721000 -- (-643.301) (-640.241) (-642.761) [-640.539] * (-639.913) (-639.884) (-640.676) [-640.666] -- 0:00:17
      721500 -- (-643.609) (-640.299) [-639.564] (-640.865) * (-649.225) (-639.872) (-640.968) [-641.056] -- 0:00:16
      722000 -- (-644.943) (-641.064) [-640.806] (-640.493) * (-643.356) [-639.741] (-640.205) (-640.400) -- 0:00:16
      722500 -- (-639.380) [-642.241] (-640.986) (-641.841) * (-642.386) [-640.360] (-642.451) (-640.014) -- 0:00:16
      723000 -- [-639.913] (-642.983) (-642.627) (-643.987) * (-644.738) (-639.571) [-641.745] (-640.664) -- 0:00:16
      723500 -- [-642.160] (-642.513) (-642.549) (-642.737) * (-641.666) (-639.775) [-644.547] (-640.673) -- 0:00:16
      724000 -- (-639.673) [-641.132] (-644.652) (-649.334) * (-640.242) [-639.951] (-646.858) (-643.125) -- 0:00:16
      724500 -- [-641.809] (-641.724) (-643.811) (-642.484) * (-643.415) (-641.049) [-639.727] (-646.228) -- 0:00:16
      725000 -- [-639.368] (-641.694) (-645.711) (-643.140) * (-642.533) (-639.740) (-641.658) [-641.057] -- 0:00:16

      Average standard deviation of split frequencies: 0.011000

      725500 -- (-640.696) (-641.548) (-639.999) [-642.782] * (-647.870) (-644.243) [-641.252] (-639.747) -- 0:00:16
      726000 -- (-642.428) (-643.402) (-642.276) [-644.219] * (-644.709) (-654.522) [-640.869] (-641.793) -- 0:00:16
      726500 -- (-642.544) (-640.501) [-640.518] (-641.760) * (-645.732) [-641.740] (-639.975) (-640.690) -- 0:00:16
      727000 -- (-643.219) (-642.921) (-641.253) [-639.073] * (-640.939) (-641.254) [-641.658] (-639.898) -- 0:00:16
      727500 -- (-639.408) (-639.703) (-641.930) [-639.886] * (-641.881) (-642.783) (-639.640) [-643.623] -- 0:00:16
      728000 -- (-640.941) (-639.396) (-645.932) [-640.871] * (-641.196) (-639.732) [-639.848] (-639.498) -- 0:00:16
      728500 -- (-640.972) (-642.011) (-640.907) [-641.499] * (-648.358) [-640.439] (-641.294) (-644.291) -- 0:00:16
      729000 -- (-639.846) (-643.359) [-642.824] (-641.066) * (-641.423) [-639.553] (-639.320) (-643.982) -- 0:00:16
      729500 -- (-642.783) (-644.597) [-641.496] (-639.812) * [-640.873] (-641.782) (-641.917) (-639.725) -- 0:00:16
      730000 -- (-642.234) [-641.639] (-642.033) (-644.277) * [-641.818] (-640.948) (-643.147) (-640.209) -- 0:00:16

      Average standard deviation of split frequencies: 0.010968

      730500 -- (-639.610) (-641.844) (-644.751) [-642.817] * (-642.221) (-640.513) (-640.558) [-640.644] -- 0:00:16
      731000 -- (-638.775) [-640.305] (-642.330) (-640.377) * [-640.585] (-641.153) (-641.059) (-647.384) -- 0:00:16
      731500 -- [-638.760] (-643.492) (-640.539) (-644.883) * [-639.567] (-640.665) (-641.448) (-643.851) -- 0:00:16
      732000 -- [-639.548] (-640.267) (-640.227) (-652.743) * (-647.150) (-641.129) [-640.129] (-640.623) -- 0:00:16
      732500 -- (-640.082) [-640.477] (-643.541) (-647.048) * [-641.482] (-646.510) (-640.480) (-639.379) -- 0:00:16
      733000 -- (-639.548) [-642.054] (-649.496) (-643.245) * (-640.810) (-645.821) (-641.863) [-640.166] -- 0:00:16
      733500 -- [-639.632] (-642.325) (-644.408) (-639.122) * (-640.266) (-640.652) (-639.159) [-639.336] -- 0:00:16
      734000 -- [-643.730] (-642.618) (-641.604) (-641.625) * [-639.496] (-639.779) (-639.425) (-639.921) -- 0:00:16
      734500 -- (-641.940) (-640.147) (-640.673) [-640.281] * (-639.428) [-639.373] (-639.311) (-641.678) -- 0:00:16
      735000 -- [-642.620] (-639.875) (-644.390) (-639.450) * [-639.460] (-640.613) (-639.556) (-640.256) -- 0:00:16

      Average standard deviation of split frequencies: 0.010662

      735500 -- (-643.468) [-641.077] (-644.026) (-643.354) * (-642.914) (-644.579) (-640.956) [-640.965] -- 0:00:16
      736000 -- (-639.494) (-639.554) [-640.127] (-641.484) * (-642.211) (-644.769) [-642.490] (-641.618) -- 0:00:16
      736500 -- (-641.561) [-642.232] (-640.209) (-642.632) * (-645.151) (-644.008) [-642.822] (-641.556) -- 0:00:16
      737000 -- (-639.721) (-643.649) (-640.047) [-641.165] * [-642.458] (-647.670) (-644.754) (-641.202) -- 0:00:16
      737500 -- (-640.387) (-640.877) [-639.466] (-640.204) * (-640.945) (-643.767) (-641.253) [-640.903] -- 0:00:16
      738000 -- [-640.279] (-644.224) (-640.604) (-643.915) * (-645.309) (-640.290) (-640.535) [-642.453] -- 0:00:15
      738500 -- (-643.118) (-640.173) (-642.304) [-644.098] * (-640.475) (-640.389) [-642.330] (-640.119) -- 0:00:15
      739000 -- (-639.947) [-639.978] (-641.119) (-640.477) * (-641.246) [-640.587] (-641.803) (-641.903) -- 0:00:15
      739500 -- [-640.172] (-641.133) (-643.184) (-639.505) * (-644.478) (-643.750) [-6