--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:19:21 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsH/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -543.72 -546.44
2 -543.68 -546.53
--------------------------------------
TOTAL -543.70 -546.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891576 0.086246 0.371625 1.487745 0.864515 1348.85 1424.92 1.000
r(A<->C){all} 0.172299 0.020198 0.000039 0.459779 0.135666 238.20 244.94 1.000
r(A<->G){all} 0.158695 0.020256 0.000094 0.455404 0.120018 245.62 260.93 1.000
r(A<->T){all} 0.159804 0.019295 0.000054 0.440958 0.121059 162.81 227.11 1.000
r(C<->G){all} 0.163122 0.018984 0.000046 0.435558 0.127865 182.73 195.09 1.002
r(C<->T){all} 0.168428 0.018457 0.000032 0.445883 0.133072 155.42 161.45 1.000
r(G<->T){all} 0.177652 0.020922 0.000128 0.470564 0.141598 209.05 245.53 1.004
pi(A){all} 0.206847 0.000406 0.167213 0.247585 0.206158 1501.00 1501.00 1.000
pi(C){all} 0.290556 0.000514 0.246875 0.336049 0.289707 1297.02 1366.97 1.000
pi(G){all} 0.302253 0.000517 0.260995 0.348609 0.302098 1068.51 1177.89 1.000
pi(T){all} 0.200344 0.000401 0.162235 0.237918 0.199148 1329.29 1407.88 1.000
alpha{1,2} 0.426439 0.231693 0.000112 1.397201 0.263693 1066.65 1104.08 1.000
alpha{3} 0.464306 0.244376 0.000240 1.471718 0.295432 1140.19 1257.97 1.000
pinvar{all} 0.996028 0.000022 0.986855 0.999996 0.997564 1244.84 1323.26 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -521.33588
Model 2: PositiveSelection -521.335876
Model 0: one-ratio -521.335882
Model 7: beta -521.335903
Model 8: beta&w>1 -521.335876
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 7.999999979801942E-6
Model 8 vs 7 5.400000009103678E-5
>C1
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
>C2
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
>C3
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
>C4
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
>C5
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
>C6
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132
C1 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
C2 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
C3 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
C4 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
C5 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
C6 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
**************************************************
C1 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
C2 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
C3 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
C4 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
C5 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
C6 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
**************************************************
C1 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
C2 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
C3 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
C4 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
C5 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
C6 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3960]--->[3960]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.462 Mb, Max= 30.662 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
C2 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
C3 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
C4 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
C5 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
C6 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
**************************************************
C1 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
C2 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
C3 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
C4 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
C5 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
C6 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
**************************************************
C1 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
C2 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
C3 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
C4 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
C5 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
C6 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
C2 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
C3 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
C4 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
C5 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
C6 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
**************************************************
C1 CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
C2 CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
C3 CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
C4 CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
C5 CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
C6 CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
**************************************************
C1 CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
C2 CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
C3 CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
C4 CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
C5 CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
C6 CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
**************************************************
C1 ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
C2 ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
C3 ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
C4 ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
C5 ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
C6 ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
**************************************************
C1 ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
C2 ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
C3 ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
C4 ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
C5 ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
C6 ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
**************************************************
C1 GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
C2 GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
C3 GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
C4 GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
C5 GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
C6 GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
**************************************************
C1 CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
C2 CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
C3 CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
C4 CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
C5 CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
C6 CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
**************************************************
C1 GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
C2 GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
C3 GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
C4 GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
C5 GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
C6 GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
**********************************************
>C1
ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
>C2
ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
>C3
ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
>C4
ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
>C5
ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
>C6
ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC
CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG
CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT
ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG
ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG
GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT
CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA
GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
>C1
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
>C2
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
>C3
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
>C4
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
>C5
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
>C6
MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 396 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792683
Setting output file names to "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 788516629
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0224444458
Seed = 1320423312
Swapseed = 1579792683
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -886.266934 -- -24.965149
Chain 2 -- -886.266985 -- -24.965149
Chain 3 -- -886.266985 -- -24.965149
Chain 4 -- -886.266934 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -886.266985 -- -24.965149
Chain 2 -- -886.266985 -- -24.965149
Chain 3 -- -886.266985 -- -24.965149
Chain 4 -- -886.266985 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-886.267] (-886.267) (-886.267) (-886.267) * [-886.267] (-886.267) (-886.267) (-886.267)
500 -- (-555.099) [-557.550] (-552.134) (-559.978) * (-552.339) (-555.245) (-558.654) [-551.101] -- 0:00:00
1000 -- [-551.849] (-560.095) (-556.005) (-555.907) * [-548.304] (-548.730) (-556.427) (-551.774) -- 0:00:00
1500 -- (-551.516) (-557.252) (-558.213) [-548.306] * (-553.634) (-551.966) (-555.304) [-553.456] -- 0:00:00
2000 -- (-548.210) [-551.827] (-559.211) (-552.570) * (-553.425) (-552.015) [-552.027] (-553.180) -- 0:00:00
2500 -- (-555.390) [-554.457] (-556.779) (-555.022) * (-553.354) [-554.169] (-556.841) (-553.175) -- 0:00:00
3000 -- (-562.568) [-551.803] (-548.400) (-550.839) * [-552.001] (-558.057) (-554.166) (-545.805) -- 0:00:00
3500 -- (-562.299) (-554.054) [-547.881] (-552.198) * (-561.111) (-553.923) (-551.616) [-552.124] -- 0:00:00
4000 -- (-550.977) (-552.779) [-554.018] (-554.227) * (-542.722) (-553.776) [-551.918] (-551.717) -- 0:00:00
4500 -- (-552.094) [-554.755] (-552.619) (-548.724) * (-542.793) (-560.421) [-554.989] (-549.122) -- 0:00:00
5000 -- (-550.754) (-555.428) [-551.936] (-555.895) * (-543.455) (-555.129) (-556.225) [-553.121] -- 0:00:00
Average standard deviation of split frequencies: 0.061488
5500 -- (-557.234) (-548.602) (-548.318) [-554.442] * [-543.595] (-552.511) (-551.160) (-556.330) -- 0:00:00
6000 -- (-558.274) [-556.524] (-557.613) (-552.277) * (-546.992) [-546.428] (-552.156) (-552.539) -- 0:00:00
6500 -- [-558.614] (-551.338) (-555.310) (-555.244) * (-546.063) [-556.199] (-554.682) (-549.681) -- 0:00:00
7000 -- [-549.957] (-555.030) (-550.264) (-548.855) * (-542.648) [-549.391] (-559.888) (-565.594) -- 0:00:00
7500 -- (-554.584) (-552.398) (-564.306) [-550.747] * (-543.824) (-552.606) [-550.886] (-550.826) -- 0:00:00
8000 -- [-549.695] (-551.536) (-552.275) (-560.909) * (-544.315) (-553.941) [-548.012] (-557.296) -- 0:00:00
8500 -- (-554.645) (-566.947) (-549.685) [-550.686] * (-543.267) (-551.828) [-556.747] (-557.308) -- 0:00:00
9000 -- (-557.388) (-558.009) [-552.381] (-551.731) * (-545.870) [-552.786] (-556.994) (-553.211) -- 0:00:00
9500 -- (-550.647) [-550.653] (-553.765) (-561.491) * (-543.981) (-557.326) [-553.064] (-555.682) -- 0:00:00
10000 -- [-552.212] (-554.572) (-554.619) (-555.477) * (-546.068) (-557.906) [-555.735] (-554.059) -- 0:00:00
Average standard deviation of split frequencies: 0.044194
10500 -- (-559.415) (-556.291) [-553.161] (-550.590) * (-543.798) (-555.818) (-554.377) [-552.297] -- 0:01:34
11000 -- (-557.270) (-555.116) [-548.339] (-557.915) * (-546.002) (-552.594) [-556.928] (-569.797) -- 0:01:29
11500 -- (-547.772) [-552.965] (-550.864) (-553.110) * (-548.710) (-562.873) [-546.489] (-554.597) -- 0:01:25
12000 -- (-553.880) (-553.192) (-551.099) [-552.967] * (-544.645) [-557.959] (-558.425) (-553.538) -- 0:01:22
12500 -- (-558.633) (-558.655) (-552.984) [-552.765] * [-543.165] (-560.411) (-552.246) (-557.663) -- 0:01:19
13000 -- (-556.708) (-558.102) [-550.421] (-555.720) * (-544.951) (-566.531) (-553.894) [-557.307] -- 0:01:15
13500 -- [-549.753] (-555.241) (-557.217) (-558.715) * (-542.882) (-555.202) [-558.758] (-554.254) -- 0:01:13
14000 -- (-553.748) (-549.928) [-557.595] (-555.736) * [-542.860] (-554.019) (-559.384) (-550.525) -- 0:01:10
14500 -- [-551.698] (-557.040) (-554.652) (-554.646) * (-544.022) (-571.482) [-563.705] (-566.047) -- 0:01:07
15000 -- [-558.981] (-552.282) (-558.909) (-554.806) * [-542.910] (-562.946) (-557.757) (-552.548) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-566.904) (-559.906) (-556.024) [-553.317] * (-544.229) [-545.353] (-555.215) (-561.383) -- 0:01:03
16000 -- (-550.396) (-553.857) (-552.910) [-551.253] * (-543.500) (-544.259) (-551.595) [-553.907] -- 0:01:01
16500 -- (-549.566) (-557.677) (-551.835) [-554.232] * (-545.038) (-545.739) [-553.412] (-563.916) -- 0:00:59
17000 -- [-551.345] (-554.337) (-563.841) (-552.348) * (-546.081) (-544.500) [-552.781] (-552.032) -- 0:00:57
17500 -- [-550.251] (-552.515) (-553.644) (-554.692) * (-544.234) [-545.485] (-561.628) (-554.378) -- 0:00:56
18000 -- [-558.419] (-552.127) (-551.416) (-557.403) * (-544.811) (-544.128) (-572.434) [-552.741] -- 0:00:54
18500 -- (-556.120) [-553.616] (-556.783) (-551.772) * [-546.245] (-543.739) (-549.508) (-562.239) -- 0:00:53
19000 -- (-557.811) (-551.509) [-554.298] (-554.505) * (-544.378) [-544.676] (-542.924) (-542.803) -- 0:00:51
19500 -- (-553.056) (-560.472) [-558.909] (-551.159) * (-545.313) [-544.405] (-544.396) (-548.335) -- 0:00:50
20000 -- (-558.751) (-560.352) [-553.061] (-551.431) * (-544.510) (-543.311) (-546.211) [-548.997] -- 0:00:49
Average standard deviation of split frequencies: 0.045620
20500 -- [-551.327] (-551.862) (-548.478) (-557.342) * [-543.835] (-543.553) (-545.451) (-542.602) -- 0:00:47
21000 -- (-556.752) (-552.045) (-558.118) [-553.252] * [-546.069] (-545.280) (-545.258) (-545.205) -- 0:00:46
21500 -- (-562.350) (-550.855) (-549.026) [-553.209] * (-545.585) (-544.595) [-543.557] (-543.615) -- 0:00:45
22000 -- (-553.116) (-558.894) [-557.663] (-559.777) * (-546.660) (-544.714) (-544.591) [-544.927] -- 0:00:44
22500 -- [-553.565] (-549.961) (-557.779) (-565.425) * (-545.601) [-546.360] (-543.788) (-544.092) -- 0:00:43
23000 -- [-550.592] (-552.702) (-557.745) (-569.197) * (-545.326) (-548.291) (-544.415) [-548.633] -- 0:00:42
23500 -- (-563.369) (-556.870) [-553.714] (-542.622) * (-543.615) [-544.869] (-543.622) (-544.545) -- 0:00:41
24000 -- (-557.845) (-566.996) [-546.901] (-544.204) * (-543.831) [-544.566] (-543.107) (-544.591) -- 0:00:40
24500 -- [-549.101] (-551.738) (-557.302) (-542.967) * (-543.608) (-547.635) [-543.832] (-544.147) -- 0:00:39
25000 -- (-553.265) (-550.357) [-554.315] (-543.553) * (-543.264) (-543.191) (-545.305) [-542.712] -- 0:00:39
Average standard deviation of split frequencies: 0.032965
25500 -- (-554.155) (-551.403) (-558.815) [-542.671] * [-544.025] (-546.131) (-545.236) (-546.147) -- 0:00:38
26000 -- (-559.068) (-549.225) (-555.145) [-545.182] * (-544.987) [-545.569] (-544.477) (-545.722) -- 0:00:37
26500 -- [-549.308] (-550.795) (-561.100) (-544.067) * (-545.515) (-543.276) (-544.832) [-543.014] -- 0:00:36
27000 -- (-551.239) (-553.923) (-562.778) [-544.237] * (-546.825) (-545.084) (-544.598) [-542.600] -- 0:01:12
27500 -- (-551.261) (-550.962) (-552.266) [-544.712] * (-544.289) [-544.447] (-545.720) (-543.391) -- 0:01:10
28000 -- [-550.796] (-551.215) (-552.590) (-543.933) * [-546.593] (-545.398) (-543.215) (-545.034) -- 0:01:09
28500 -- (-560.175) (-546.388) (-558.969) [-542.495] * (-544.043) (-543.214) (-543.915) [-546.883] -- 0:01:08
29000 -- (-550.018) (-550.905) (-556.708) [-542.765] * (-542.293) (-544.054) (-544.998) [-542.173] -- 0:01:06
29500 -- (-551.804) [-547.329] (-553.411) (-549.486) * (-543.026) (-543.165) [-544.188] (-544.034) -- 0:01:05
30000 -- (-556.513) [-554.390] (-551.257) (-543.723) * (-542.926) (-543.243) [-543.297] (-548.689) -- 0:01:04
Average standard deviation of split frequencies: 0.034789
30500 -- [-550.171] (-550.840) (-551.243) (-546.237) * (-543.552) (-543.829) [-543.348] (-545.114) -- 0:01:03
31000 -- (-550.912) [-550.809] (-548.752) (-546.839) * (-544.136) (-542.751) [-543.386] (-542.965) -- 0:01:02
31500 -- (-562.435) [-553.446] (-552.501) (-547.007) * [-544.820] (-547.668) (-546.431) (-543.905) -- 0:01:01
32000 -- [-552.944] (-551.088) (-553.725) (-545.109) * (-542.626) (-546.812) (-543.454) [-543.578] -- 0:01:00
32500 -- (-549.757) (-554.026) [-552.181] (-545.642) * [-542.856] (-548.176) (-545.963) (-542.973) -- 0:00:59
33000 -- [-554.584] (-557.175) (-549.816) (-543.557) * (-544.213) [-548.909] (-549.277) (-542.761) -- 0:00:58
33500 -- [-553.934] (-548.325) (-552.892) (-543.649) * (-543.959) (-544.483) [-545.891] (-545.029) -- 0:00:57
34000 -- (-553.037) [-552.947] (-550.065) (-546.261) * (-544.479) [-545.700] (-550.401) (-543.784) -- 0:00:56
34500 -- (-553.187) [-557.622] (-554.508) (-547.662) * [-545.311] (-544.294) (-546.651) (-545.507) -- 0:00:55
35000 -- [-548.914] (-553.453) (-554.548) (-544.319) * (-545.144) [-542.679] (-544.482) (-543.582) -- 0:00:55
Average standard deviation of split frequencies: 0.039284
35500 -- (-560.634) (-551.601) [-547.671] (-547.055) * [-545.150] (-545.874) (-544.847) (-546.355) -- 0:00:54
36000 -- (-553.770) [-554.035] (-553.956) (-548.963) * [-546.388] (-544.435) (-544.380) (-545.728) -- 0:00:53
36500 -- (-555.532) [-547.951] (-552.389) (-550.699) * (-545.326) (-544.640) (-543.955) [-543.233] -- 0:00:52
37000 -- (-558.452) (-548.926) (-556.105) [-545.458] * (-546.275) (-545.147) (-543.633) [-544.070] -- 0:00:52
37500 -- (-552.732) (-556.878) [-557.943] (-547.978) * (-544.135) (-546.510) [-544.524] (-542.268) -- 0:00:51
38000 -- [-549.488] (-554.593) (-558.011) (-544.675) * (-544.359) (-547.665) (-544.965) [-542.935] -- 0:00:50
38500 -- (-557.118) [-552.300] (-553.774) (-543.278) * (-543.271) (-545.435) (-547.562) [-545.109] -- 0:00:49
39000 -- (-550.960) (-552.497) (-546.869) [-544.387] * [-543.143] (-543.647) (-548.212) (-544.143) -- 0:00:49
39500 -- (-552.983) (-560.152) [-543.745] (-544.793) * [-543.323] (-543.528) (-546.703) (-542.975) -- 0:00:48
40000 -- [-553.845] (-559.886) (-544.707) (-546.659) * (-544.556) (-546.534) [-543.310] (-545.952) -- 0:00:48
Average standard deviation of split frequencies: 0.039046
40500 -- (-552.782) (-553.757) [-545.361] (-544.136) * (-544.263) (-543.266) [-543.286] (-544.787) -- 0:00:47
41000 -- (-554.208) [-553.274] (-545.449) (-548.337) * (-544.768) (-542.900) [-545.297] (-548.453) -- 0:00:46
41500 -- (-563.942) [-546.607] (-545.613) (-543.091) * (-542.777) (-544.687) [-546.002] (-549.543) -- 0:00:46
42000 -- [-555.024] (-554.014) (-549.422) (-543.985) * (-542.561) [-546.230] (-542.643) (-544.461) -- 0:00:45
42500 -- (-563.317) (-559.388) [-544.017] (-549.360) * (-546.557) (-544.291) (-544.056) [-546.779] -- 0:00:45
43000 -- (-556.437) (-556.747) [-543.965] (-546.213) * (-546.081) (-545.273) (-544.346) [-544.569] -- 0:00:44
43500 -- (-555.964) (-557.268) (-544.419) [-547.600] * [-545.697] (-543.847) (-546.423) (-542.820) -- 0:01:05
44000 -- (-551.841) [-547.438] (-544.031) (-548.259) * (-544.048) (-544.045) (-552.402) [-543.622] -- 0:01:05
44500 -- (-556.282) [-555.410] (-544.197) (-545.155) * (-545.640) (-544.603) (-546.207) [-543.275] -- 0:01:04
45000 -- [-550.905] (-551.499) (-542.963) (-545.378) * (-546.342) (-547.030) (-542.430) [-543.532] -- 0:01:03
Average standard deviation of split frequencies: 0.034587
45500 -- (-548.540) (-558.078) (-545.454) [-542.845] * (-544.806) [-544.045] (-545.401) (-543.959) -- 0:01:02
46000 -- (-549.871) (-560.210) [-545.004] (-544.727) * (-543.481) (-543.086) [-548.991] (-545.396) -- 0:01:02
46500 -- [-552.570] (-562.234) (-546.662) (-544.138) * (-542.397) [-543.897] (-543.670) (-543.974) -- 0:01:01
47000 -- (-557.421) (-554.299) [-544.098] (-548.328) * (-542.522) (-543.585) (-544.253) [-544.951] -- 0:01:00
47500 -- (-561.134) (-547.491) (-543.939) [-545.551] * (-544.146) [-544.551] (-545.435) (-544.728) -- 0:01:00
48000 -- (-561.564) [-547.805] (-545.747) (-544.944) * (-544.729) [-543.387] (-542.930) (-544.483) -- 0:00:59
48500 -- (-560.300) (-545.985) [-544.263] (-543.036) * (-547.404) (-543.488) (-543.748) [-544.282] -- 0:00:58
49000 -- (-559.986) (-545.798) (-549.336) [-547.975] * [-545.379] (-543.940) (-543.424) (-545.606) -- 0:00:58
49500 -- (-554.231) (-546.505) (-550.792) [-542.814] * [-548.495] (-542.902) (-544.916) (-544.254) -- 0:00:57
50000 -- (-560.426) [-542.498] (-548.999) (-544.988) * [-543.869] (-545.018) (-544.455) (-543.056) -- 0:00:57
Average standard deviation of split frequencies: 0.043137
50500 -- [-552.381] (-545.980) (-544.730) (-543.048) * (-542.885) [-544.607] (-544.744) (-544.695) -- 0:00:56
51000 -- (-552.567) (-543.500) (-546.596) [-543.628] * (-544.903) (-543.823) [-542.703] (-545.724) -- 0:00:55
51500 -- (-552.006) [-544.944] (-544.228) (-544.715) * (-542.227) (-543.716) [-543.261] (-548.364) -- 0:00:55
52000 -- (-550.942) (-544.520) (-544.743) [-545.174] * (-542.401) (-543.323) [-544.608] (-544.638) -- 0:00:54
52500 -- (-555.548) (-543.802) (-545.571) [-542.770] * [-543.707] (-543.627) (-542.616) (-544.970) -- 0:00:54
53000 -- [-559.733] (-546.537) (-544.162) (-544.138) * [-546.985] (-543.075) (-542.673) (-546.717) -- 0:00:53
53500 -- (-551.889) (-545.302) [-542.753] (-543.759) * [-544.003] (-544.381) (-545.358) (-544.175) -- 0:00:53
54000 -- [-551.563] (-544.667) (-542.689) (-547.661) * (-549.362) [-543.226] (-544.875) (-543.414) -- 0:00:52
54500 -- (-551.170) [-546.159] (-543.403) (-549.328) * (-545.600) (-548.881) (-544.422) [-542.291] -- 0:00:52
55000 -- (-556.085) (-544.516) [-543.185] (-547.886) * (-545.340) [-545.042] (-545.120) (-545.277) -- 0:00:51
Average standard deviation of split frequencies: 0.038081
55500 -- (-558.185) [-545.035] (-545.486) (-545.705) * (-544.533) [-546.822] (-546.919) (-544.674) -- 0:00:51
56000 -- (-560.465) [-542.386] (-544.041) (-545.140) * (-543.690) (-546.760) [-543.805] (-544.674) -- 0:00:50
56500 -- (-556.836) (-551.080) (-543.206) [-544.256] * (-542.739) (-543.031) [-545.728] (-544.424) -- 0:00:50
57000 -- (-551.503) (-542.289) [-544.932] (-543.406) * (-544.085) (-544.754) (-550.689) [-543.548] -- 0:00:49
57500 -- (-552.783) (-547.057) (-547.033) [-543.385] * (-543.614) (-546.074) (-545.495) [-544.531] -- 0:00:49
58000 -- (-548.455) (-546.200) (-542.496) [-547.398] * (-545.562) (-543.903) [-544.453] (-543.064) -- 0:00:48
58500 -- (-555.239) (-547.321) [-543.801] (-546.567) * [-543.505] (-546.505) (-546.059) (-545.743) -- 0:00:48
59000 -- (-554.254) [-544.419] (-544.939) (-549.476) * (-548.299) (-542.305) [-545.496] (-549.775) -- 0:00:47
59500 -- (-557.575) (-544.248) (-543.196) [-544.828] * (-547.007) (-542.900) [-543.820] (-544.402) -- 0:00:47
60000 -- (-572.796) (-543.154) [-543.213] (-546.499) * (-548.041) [-543.766] (-545.440) (-544.333) -- 0:00:47
Average standard deviation of split frequencies: 0.037686
60500 -- [-545.293] (-542.928) (-544.072) (-543.515) * [-548.032] (-543.853) (-548.715) (-546.423) -- 0:01:02
61000 -- [-545.706] (-543.014) (-547.695) (-543.770) * (-546.982) (-543.587) (-546.067) [-544.723] -- 0:01:01
61500 -- (-546.218) (-542.876) (-543.466) [-543.503] * [-550.340] (-545.843) (-546.905) (-550.590) -- 0:01:01
62000 -- (-544.355) (-544.136) [-544.213] (-544.694) * (-546.025) [-544.522] (-546.105) (-545.936) -- 0:01:00
62500 -- (-542.105) (-543.194) (-547.114) [-545.318] * [-544.627] (-544.198) (-545.423) (-548.343) -- 0:01:00
63000 -- (-543.513) (-544.240) [-544.131] (-549.310) * (-543.041) (-544.439) [-543.290] (-547.531) -- 0:00:59
63500 -- (-543.924) [-544.798] (-546.096) (-544.983) * (-545.271) (-544.395) [-542.883] (-549.048) -- 0:00:58
64000 -- (-547.223) (-545.185) (-545.890) [-543.422] * (-544.194) (-545.808) (-545.433) [-543.053] -- 0:00:58
64500 -- [-544.017] (-543.953) (-544.563) (-543.657) * (-543.273) (-546.757) (-547.616) [-542.665] -- 0:00:58
65000 -- (-542.791) [-544.030] (-546.240) (-547.490) * (-543.153) (-545.355) (-547.236) [-542.955] -- 0:00:57
Average standard deviation of split frequencies: 0.033115
65500 -- (-543.944) (-544.200) [-544.241] (-546.502) * (-545.289) (-545.839) (-545.854) [-542.636] -- 0:00:57
66000 -- (-544.338) [-543.268] (-553.324) (-544.556) * (-542.529) (-544.453) [-542.735] (-542.953) -- 0:00:56
66500 -- [-545.741] (-547.081) (-544.927) (-545.997) * (-542.529) [-544.117] (-543.378) (-543.233) -- 0:00:56
67000 -- [-545.235] (-544.909) (-544.232) (-543.704) * (-547.290) [-544.413] (-542.769) (-543.560) -- 0:00:55
67500 -- (-544.585) (-545.147) (-544.790) [-543.515] * (-546.840) [-546.047] (-543.407) (-543.431) -- 0:00:55
68000 -- [-543.183] (-546.691) (-542.939) (-542.551) * [-543.427] (-545.857) (-543.194) (-543.432) -- 0:00:54
68500 -- (-543.290) (-545.391) [-544.826] (-543.268) * [-542.763] (-545.283) (-542.985) (-542.991) -- 0:00:54
69000 -- (-543.600) (-545.234) (-544.319) [-544.596] * [-542.830] (-544.665) (-543.021) (-545.798) -- 0:00:53
69500 -- [-542.907] (-543.151) (-542.389) (-544.912) * (-543.720) (-545.953) (-545.217) [-544.601] -- 0:00:53
70000 -- (-546.455) (-544.091) (-543.350) [-544.655] * (-544.156) (-546.630) (-545.629) [-544.484] -- 0:00:53
Average standard deviation of split frequencies: 0.035022
70500 -- (-545.175) (-542.561) (-545.850) [-543.758] * (-544.349) [-542.910] (-542.919) (-542.972) -- 0:00:52
71000 -- (-547.081) [-542.974] (-542.993) (-546.081) * [-543.544] (-544.152) (-548.354) (-546.270) -- 0:00:52
71500 -- (-543.637) (-543.786) (-544.922) [-543.670] * (-544.195) [-546.072] (-548.734) (-545.031) -- 0:00:51
72000 -- [-542.172] (-542.411) (-544.151) (-543.512) * [-543.677] (-543.950) (-547.592) (-544.036) -- 0:00:51
72500 -- (-543.953) (-545.302) [-543.356] (-543.608) * (-545.188) [-544.994] (-546.931) (-546.253) -- 0:00:51
73000 -- (-547.957) (-549.878) [-542.863] (-546.532) * (-547.895) (-544.186) [-547.886] (-544.883) -- 0:00:50
73500 -- [-545.913] (-546.703) (-544.536) (-545.636) * (-543.604) (-543.476) (-543.886) [-542.604] -- 0:00:50
74000 -- (-548.398) (-544.112) (-545.645) [-544.630] * [-545.384] (-546.956) (-542.656) (-543.812) -- 0:00:50
74500 -- [-543.068] (-545.695) (-545.603) (-543.926) * [-544.034] (-543.577) (-543.325) (-542.795) -- 0:00:49
75000 -- [-544.249] (-548.980) (-549.538) (-542.826) * [-543.796] (-547.350) (-549.687) (-543.560) -- 0:00:49
Average standard deviation of split frequencies: 0.034604
75500 -- (-545.334) [-544.691] (-549.879) (-542.966) * (-543.561) (-546.747) (-542.453) [-543.882] -- 0:00:48
76000 -- (-542.915) [-545.215] (-545.701) (-543.656) * (-545.003) (-544.816) (-545.981) [-543.424] -- 0:00:48
76500 -- (-546.132) [-545.816] (-549.237) (-545.839) * (-544.538) (-543.730) [-545.148] (-548.978) -- 0:00:48
77000 -- [-544.629] (-544.366) (-547.203) (-545.280) * (-544.020) [-542.554] (-550.888) (-555.226) -- 0:00:59
77500 -- (-543.541) (-542.670) (-544.039) [-544.529] * (-544.548) (-542.558) [-543.998] (-549.020) -- 0:00:59
78000 -- (-547.383) (-543.513) (-544.070) [-545.561] * (-544.522) (-544.126) [-542.785] (-544.706) -- 0:00:59
78500 -- (-542.926) (-542.521) (-544.582) [-544.275] * (-543.541) (-542.669) [-543.904] (-544.447) -- 0:00:58
79000 -- (-545.944) (-545.604) (-543.420) [-546.864] * (-545.809) (-544.094) (-542.530) [-542.325] -- 0:00:58
79500 -- [-546.551] (-545.852) (-546.529) (-542.650) * (-543.858) (-544.777) [-546.225] (-546.514) -- 0:00:57
80000 -- (-543.902) (-544.904) (-544.957) [-543.522] * (-542.950) [-546.306] (-548.575) (-545.457) -- 0:00:57
Average standard deviation of split frequencies: 0.030594
80500 -- (-542.340) (-544.927) [-544.424] (-546.563) * (-544.666) (-544.971) (-544.192) [-546.218] -- 0:00:57
81000 -- (-545.092) (-546.041) (-545.231) [-543.037] * (-544.708) (-544.920) (-544.790) [-542.336] -- 0:00:56
81500 -- (-543.158) (-543.360) [-547.503] (-543.438) * [-544.724] (-544.369) (-542.949) (-542.437) -- 0:00:56
82000 -- (-548.899) (-542.273) [-545.652] (-547.355) * (-544.978) (-543.608) [-543.491] (-542.865) -- 0:00:55
82500 -- [-546.285] (-544.370) (-547.624) (-550.792) * (-544.254) [-542.647] (-543.079) (-544.464) -- 0:00:55
83000 -- [-543.609] (-544.514) (-542.949) (-543.882) * (-543.820) [-550.213] (-549.898) (-542.452) -- 0:00:55
83500 -- [-544.955] (-544.364) (-544.878) (-544.371) * (-544.195) (-547.175) (-544.910) [-545.273] -- 0:00:54
84000 -- (-543.194) (-545.006) [-547.863] (-545.049) * [-544.966] (-543.388) (-546.870) (-544.656) -- 0:00:54
84500 -- (-544.705) (-544.137) [-545.108] (-543.531) * (-544.461) [-544.495] (-548.291) (-544.089) -- 0:00:54
85000 -- (-546.270) (-544.571) [-543.126] (-542.781) * [-545.084] (-544.444) (-547.654) (-543.592) -- 0:00:53
Average standard deviation of split frequencies: 0.030869
85500 -- [-545.687] (-546.388) (-543.124) (-547.675) * (-544.961) [-543.253] (-547.052) (-544.058) -- 0:00:53
86000 -- [-542.443] (-544.402) (-543.338) (-544.598) * (-545.031) (-544.833) [-547.491] (-544.921) -- 0:00:53
86500 -- (-542.542) (-547.113) [-545.294] (-544.038) * (-543.040) (-544.043) (-542.298) [-543.477] -- 0:00:52
87000 -- (-543.791) (-548.654) [-542.873] (-545.849) * (-542.657) (-543.500) (-544.776) [-544.741] -- 0:00:52
87500 -- (-543.127) [-544.851] (-544.397) (-543.866) * (-548.244) (-544.682) [-542.920] (-544.980) -- 0:00:52
88000 -- [-542.330] (-543.429) (-542.626) (-544.693) * (-543.429) (-544.305) [-544.254] (-542.838) -- 0:00:51
88500 -- (-544.167) (-544.025) [-543.991] (-543.497) * [-542.361] (-544.500) (-544.954) (-542.546) -- 0:00:51
89000 -- (-542.761) [-546.517] (-551.845) (-542.848) * (-542.584) (-543.594) (-544.500) [-542.358] -- 0:00:51
89500 -- (-542.546) (-543.353) (-544.300) [-542.925] * (-543.928) (-543.187) [-543.408] (-546.667) -- 0:00:50
90000 -- (-542.776) (-542.534) [-543.881] (-543.160) * (-543.113) (-544.085) [-543.532] (-545.794) -- 0:00:50
Average standard deviation of split frequencies: 0.031470
90500 -- [-542.847] (-545.977) (-544.923) (-544.464) * (-547.683) (-543.389) (-544.992) [-544.238] -- 0:00:50
91000 -- [-543.642] (-543.671) (-545.445) (-545.007) * (-543.965) [-543.401] (-545.155) (-544.889) -- 0:00:49
91500 -- [-544.405] (-544.857) (-544.181) (-544.794) * (-542.167) (-544.406) (-546.395) [-544.457] -- 0:00:49
92000 -- [-543.123] (-545.400) (-543.860) (-544.993) * (-543.161) (-543.061) (-543.855) [-544.706] -- 0:00:49
92500 -- (-544.247) [-542.688] (-544.478) (-543.630) * [-543.934] (-544.045) (-544.345) (-542.638) -- 0:00:49
93000 -- (-548.220) [-542.416] (-543.474) (-542.313) * (-544.137) (-545.802) (-542.206) [-543.892] -- 0:00:48
93500 -- (-543.067) (-543.846) (-543.057) [-543.616] * (-545.018) [-544.025] (-545.948) (-543.951) -- 0:00:48
94000 -- (-544.058) (-546.964) [-544.183] (-547.966) * (-544.494) (-546.131) (-544.283) [-543.771] -- 0:00:57
94500 -- (-545.826) (-544.426) (-544.645) [-545.849] * (-543.678) (-545.906) [-544.146] (-542.675) -- 0:00:57
95000 -- (-544.239) (-546.303) [-545.080] (-546.938) * [-548.296] (-544.517) (-543.381) (-550.111) -- 0:00:57
Average standard deviation of split frequencies: 0.034373
95500 -- (-542.332) (-548.074) [-545.141] (-547.435) * [-546.075] (-547.036) (-543.517) (-544.508) -- 0:00:56
96000 -- (-547.427) [-542.368] (-543.036) (-543.377) * (-544.651) [-547.945] (-544.811) (-544.859) -- 0:00:56
96500 -- (-544.078) (-544.544) [-542.999] (-545.475) * (-545.234) (-548.127) [-545.827] (-544.341) -- 0:00:56
97000 -- (-542.822) [-543.075] (-542.356) (-544.941) * (-547.134) [-546.307] (-544.162) (-542.967) -- 0:00:55
97500 -- (-543.492) (-542.635) [-546.403] (-543.847) * [-544.688] (-542.633) (-544.531) (-543.792) -- 0:00:55
98000 -- (-543.042) [-545.176] (-545.245) (-544.822) * (-544.018) [-544.814] (-543.812) (-546.592) -- 0:00:55
98500 -- (-545.418) (-543.007) [-544.511] (-543.664) * (-543.695) (-543.840) [-543.533] (-543.731) -- 0:00:54
99000 -- (-542.105) (-546.225) (-543.665) [-543.524] * (-542.779) [-543.130] (-543.028) (-542.854) -- 0:00:54
99500 -- (-542.615) (-550.077) [-543.125] (-543.487) * (-544.546) (-544.966) (-543.497) [-543.494] -- 0:00:54
100000 -- (-543.144) [-546.890] (-547.597) (-544.312) * (-544.401) [-542.960] (-543.513) (-543.022) -- 0:00:54
Average standard deviation of split frequencies: 0.035121
100500 -- (-544.141) (-543.815) (-543.900) [-543.124] * (-544.837) (-542.609) (-547.827) [-546.076] -- 0:00:53
101000 -- (-546.286) (-544.137) [-545.764] (-543.409) * [-545.698] (-542.670) (-544.118) (-545.104) -- 0:00:53
101500 -- (-542.296) (-544.376) [-543.064] (-543.879) * (-545.270) (-542.400) (-547.852) [-544.112] -- 0:00:53
102000 -- (-543.218) (-548.944) (-543.102) [-544.011] * (-546.246) (-544.919) (-543.503) [-543.802] -- 0:00:52
102500 -- (-542.994) (-546.551) (-547.459) [-546.509] * [-545.867] (-543.437) (-544.784) (-542.356) -- 0:00:52
103000 -- (-547.308) (-543.223) (-545.415) [-544.600] * (-545.624) (-542.842) (-548.074) [-543.237] -- 0:00:52
103500 -- (-547.631) [-545.031] (-546.079) (-544.755) * (-545.871) (-544.211) [-543.195] (-543.841) -- 0:00:51
104000 -- (-547.976) (-542.585) [-544.719] (-544.753) * (-542.721) (-548.186) (-542.440) [-542.543] -- 0:00:51
104500 -- (-547.349) (-544.321) (-544.439) [-545.905] * (-545.532) (-542.880) [-544.123] (-545.480) -- 0:00:51
105000 -- (-544.292) (-545.089) [-544.113] (-545.049) * [-544.502] (-544.810) (-543.240) (-546.200) -- 0:00:51
Average standard deviation of split frequencies: 0.031130
105500 -- (-544.978) [-542.390] (-544.686) (-543.966) * (-545.014) [-545.596] (-545.812) (-546.716) -- 0:00:50
106000 -- (-545.116) (-542.452) [-544.680] (-546.532) * (-544.417) [-544.757] (-547.774) (-544.712) -- 0:00:50
106500 -- [-548.142] (-543.285) (-544.452) (-547.585) * (-546.987) (-545.448) [-543.770] (-546.248) -- 0:00:50
107000 -- (-544.136) (-543.451) [-544.785] (-544.141) * (-545.032) [-545.791] (-542.978) (-547.961) -- 0:00:50
107500 -- (-542.756) (-544.529) [-546.149] (-544.212) * (-542.290) (-547.032) [-547.579] (-545.869) -- 0:00:49
108000 -- (-543.478) (-544.745) (-545.761) [-547.869] * (-545.480) (-544.393) (-546.994) [-549.292] -- 0:00:49
108500 -- [-543.787] (-542.585) (-545.676) (-544.854) * (-546.864) (-547.574) (-543.834) [-549.933] -- 0:00:49
109000 -- (-545.737) [-543.349] (-550.327) (-544.500) * (-544.756) (-546.093) [-543.365] (-544.024) -- 0:00:49
109500 -- (-544.288) (-543.282) (-545.166) [-543.714] * (-545.624) [-543.481] (-543.640) (-544.857) -- 0:00:48
110000 -- (-544.375) (-542.866) [-546.728] (-549.080) * (-544.650) (-545.937) [-543.789] (-543.478) -- 0:00:48
Average standard deviation of split frequencies: 0.029344
110500 -- (-549.392) [-545.544] (-544.936) (-544.272) * [-542.891] (-543.731) (-545.830) (-546.521) -- 0:00:56
111000 -- (-548.333) (-547.722) (-545.085) [-545.411] * [-545.386] (-545.190) (-543.162) (-545.905) -- 0:00:56
111500 -- (-546.280) (-543.976) (-545.583) [-544.473] * (-545.607) (-542.746) [-544.953] (-542.525) -- 0:00:55
112000 -- (-543.989) (-551.838) [-544.414] (-544.873) * (-544.872) (-544.251) [-543.455] (-542.810) -- 0:00:55
112500 -- (-544.860) [-543.504] (-542.707) (-544.825) * [-543.726] (-548.604) (-542.875) (-544.350) -- 0:00:55
113000 -- (-547.266) (-542.751) [-545.753] (-543.675) * [-545.132] (-548.353) (-543.010) (-544.301) -- 0:00:54
113500 -- (-548.809) [-544.183] (-543.478) (-544.201) * [-545.950] (-544.844) (-543.143) (-546.267) -- 0:00:54
114000 -- (-545.485) [-543.702] (-542.446) (-543.273) * (-545.072) (-548.244) [-542.566] (-547.139) -- 0:00:54
114500 -- [-547.707] (-543.680) (-543.456) (-546.393) * (-543.698) (-550.152) [-548.285] (-542.457) -- 0:00:54
115000 -- (-543.988) [-543.978] (-544.442) (-542.825) * (-542.778) (-546.947) (-545.071) [-544.082] -- 0:00:53
Average standard deviation of split frequencies: 0.031554
115500 -- (-548.805) [-544.295] (-543.196) (-543.170) * (-542.277) (-543.976) (-545.665) [-542.774] -- 0:00:53
116000 -- (-551.059) [-544.044] (-543.787) (-545.292) * (-544.076) (-544.996) (-549.628) [-542.746] -- 0:00:53
116500 -- [-546.929] (-547.412) (-542.349) (-543.150) * [-543.386] (-546.163) (-545.412) (-543.369) -- 0:00:53
117000 -- (-545.059) (-547.252) (-542.713) [-543.022] * [-543.394] (-543.049) (-544.962) (-543.750) -- 0:00:52
117500 -- [-546.044] (-546.534) (-545.158) (-544.410) * (-542.773) (-543.668) (-544.089) [-545.341] -- 0:00:52
118000 -- (-545.974) [-547.756] (-548.203) (-544.359) * (-543.563) [-546.449] (-544.573) (-542.401) -- 0:00:52
118500 -- [-542.906] (-545.942) (-548.409) (-545.266) * (-544.435) (-546.069) (-543.337) [-545.324] -- 0:00:52
119000 -- (-545.904) (-544.422) (-542.889) [-542.765] * (-544.908) [-543.810] (-542.325) (-546.088) -- 0:00:51
119500 -- (-546.169) (-546.324) (-543.805) [-543.053] * (-546.989) [-543.666] (-544.941) (-547.178) -- 0:00:51
120000 -- (-545.076) (-544.740) (-548.503) [-544.072] * (-549.285) [-544.162] (-543.074) (-547.977) -- 0:00:51
Average standard deviation of split frequencies: 0.031253
120500 -- (-544.586) (-543.137) [-545.667] (-547.505) * (-545.255) (-545.270) [-543.717] (-545.319) -- 0:00:51
121000 -- (-544.917) (-542.979) [-542.553] (-543.485) * (-546.499) (-546.928) [-543.843] (-544.159) -- 0:00:50
121500 -- [-543.781] (-546.373) (-546.871) (-544.218) * (-543.914) (-543.357) (-543.462) [-543.474] -- 0:00:50
122000 -- (-543.288) [-545.370] (-542.940) (-542.348) * [-543.592] (-542.918) (-547.543) (-544.798) -- 0:00:50
122500 -- (-545.637) (-546.417) (-544.148) [-543.542] * (-546.098) [-545.307] (-547.973) (-543.825) -- 0:00:50
123000 -- (-542.933) [-543.125] (-542.874) (-544.617) * (-543.661) (-544.988) (-544.129) [-542.459] -- 0:00:49
123500 -- (-542.141) (-544.532) [-543.725] (-544.319) * (-543.502) (-543.432) (-544.741) [-544.124] -- 0:00:49
124000 -- (-547.571) [-542.784] (-544.897) (-543.035) * (-550.453) (-543.777) [-545.353] (-543.407) -- 0:00:49
124500 -- (-546.370) (-543.394) (-543.115) [-545.196] * (-547.092) (-543.288) (-551.560) [-550.670] -- 0:00:49
125000 -- [-542.528] (-545.517) (-547.589) (-544.653) * (-542.989) [-543.295] (-544.873) (-544.880) -- 0:00:49
Average standard deviation of split frequencies: 0.029710
125500 -- (-544.573) (-544.643) (-546.010) [-546.253] * (-544.647) (-542.577) [-542.305] (-544.233) -- 0:00:48
126000 -- (-546.578) [-544.793] (-547.148) (-546.514) * (-542.634) (-542.221) [-545.947] (-546.683) -- 0:00:48
126500 -- (-544.326) (-543.824) (-544.987) [-544.238] * [-542.620] (-542.954) (-543.709) (-546.843) -- 0:00:48
127000 -- (-544.456) (-542.308) [-543.080] (-544.746) * (-544.386) (-542.207) (-542.525) [-544.824] -- 0:00:48
127500 -- (-546.716) (-549.382) [-544.946] (-545.928) * (-544.491) (-548.729) (-542.178) [-544.246] -- 0:00:54
128000 -- (-556.452) (-549.040) (-543.890) [-546.331] * (-545.550) [-549.045] (-543.007) (-545.060) -- 0:00:54
128500 -- (-542.584) (-545.004) (-545.321) [-544.144] * (-544.497) (-543.081) [-544.123] (-543.487) -- 0:00:54
129000 -- (-543.048) (-546.618) (-545.619) [-544.196] * (-542.804) (-543.956) (-549.353) [-543.368] -- 0:00:54
129500 -- (-544.238) (-543.469) (-547.418) [-543.923] * (-542.787) [-543.947] (-545.195) (-548.621) -- 0:00:53
130000 -- (-544.591) [-544.691] (-546.020) (-544.615) * (-547.562) (-543.211) (-544.579) [-545.584] -- 0:00:53
Average standard deviation of split frequencies: 0.029286
130500 -- (-547.556) [-548.923] (-547.559) (-543.763) * [-544.979] (-546.365) (-543.731) (-544.954) -- 0:00:53
131000 -- (-546.353) (-544.535) (-548.595) [-544.576] * [-542.959] (-543.643) (-543.467) (-543.108) -- 0:00:53
131500 -- (-545.070) (-543.419) (-545.078) [-545.171] * (-545.839) (-544.921) (-546.551) [-543.108] -- 0:00:52
132000 -- (-547.195) (-544.886) [-544.684] (-549.692) * (-546.489) (-546.353) [-543.013] (-545.249) -- 0:00:52
132500 -- (-546.375) (-549.104) (-545.154) [-547.422] * (-544.792) (-548.044) [-543.702] (-548.140) -- 0:00:52
133000 -- (-545.442) (-545.434) [-544.401] (-542.952) * (-543.801) [-543.780] (-542.935) (-543.111) -- 0:00:52
133500 -- (-544.454) (-542.794) (-544.891) [-543.147] * [-544.635] (-546.992) (-543.683) (-551.003) -- 0:00:51
134000 -- (-543.705) [-542.771] (-543.157) (-544.628) * (-548.491) (-542.991) (-546.710) [-547.559] -- 0:00:51
134500 -- (-543.953) (-545.193) [-543.817] (-546.283) * (-546.251) (-544.628) [-544.318] (-544.714) -- 0:00:51
135000 -- [-542.165] (-545.217) (-544.772) (-542.461) * (-543.705) (-545.357) [-542.249] (-546.107) -- 0:00:51
Average standard deviation of split frequencies: 0.026213
135500 -- [-544.127] (-542.627) (-544.082) (-543.930) * (-543.892) (-543.127) (-546.797) [-543.604] -- 0:00:51
136000 -- (-545.167) (-543.360) (-544.007) [-542.743] * (-542.312) [-543.757] (-544.905) (-544.395) -- 0:00:50
136500 -- (-544.051) (-542.828) [-542.826] (-545.198) * [-543.737] (-544.202) (-545.462) (-545.743) -- 0:00:50
137000 -- (-545.081) [-545.213] (-544.327) (-544.461) * (-543.192) (-545.945) [-544.017] (-544.289) -- 0:00:50
137500 -- (-543.805) (-545.983) [-545.842] (-544.055) * (-541.982) (-549.738) [-544.049] (-545.540) -- 0:00:50
138000 -- (-544.985) [-546.404] (-544.695) (-544.350) * (-544.814) [-546.414] (-547.986) (-546.984) -- 0:00:49
138500 -- [-544.069] (-548.161) (-543.529) (-543.332) * (-546.125) (-544.547) (-544.605) [-544.069] -- 0:00:49
139000 -- (-543.772) (-544.626) (-547.145) [-547.928] * (-543.083) [-547.914] (-545.712) (-543.764) -- 0:00:49
139500 -- (-543.223) [-548.480] (-554.150) (-542.981) * [-542.797] (-544.601) (-545.415) (-544.415) -- 0:00:49
140000 -- (-543.978) (-543.480) [-543.432] (-542.461) * (-542.999) [-546.402] (-543.063) (-545.333) -- 0:00:49
Average standard deviation of split frequencies: 0.026415
140500 -- [-542.627] (-542.999) (-544.975) (-545.089) * [-542.847] (-543.667) (-542.525) (-545.031) -- 0:00:48
141000 -- (-543.971) (-546.518) (-544.174) [-544.428] * (-547.308) (-542.533) [-542.415] (-545.150) -- 0:00:48
141500 -- (-543.289) (-548.088) (-545.580) [-543.184] * (-544.963) (-543.903) (-543.373) [-542.611] -- 0:00:48
142000 -- [-544.081] (-547.681) (-546.031) (-544.593) * (-544.481) (-543.091) [-542.626] (-542.630) -- 0:00:48
142500 -- (-545.127) [-544.547] (-547.190) (-549.028) * (-543.826) (-543.691) (-544.849) [-542.231] -- 0:00:48
143000 -- (-543.215) [-542.328] (-547.896) (-543.122) * (-542.857) (-543.515) (-543.720) [-544.552] -- 0:00:47
143500 -- [-546.140] (-543.596) (-546.736) (-542.542) * (-543.539) (-544.863) (-546.246) [-544.992] -- 0:00:47
144000 -- (-544.085) (-543.755) [-545.268] (-543.552) * (-542.293) (-545.462) [-544.009] (-545.516) -- 0:00:47
144500 -- (-548.996) (-545.759) [-543.643] (-544.133) * (-544.622) (-542.657) [-543.508] (-543.950) -- 0:00:53
145000 -- (-545.670) (-543.684) [-543.124] (-542.474) * (-546.235) [-543.295] (-545.159) (-544.411) -- 0:00:53
Average standard deviation of split frequencies: 0.024121
145500 -- (-555.925) (-553.231) (-544.746) [-542.123] * (-544.493) (-543.131) [-543.661] (-543.129) -- 0:00:52
146000 -- (-543.864) (-551.552) (-544.005) [-543.863] * [-544.690] (-546.425) (-544.991) (-542.904) -- 0:00:52
146500 -- [-542.766] (-543.321) (-543.599) (-544.292) * (-545.354) [-545.821] (-543.185) (-543.375) -- 0:00:52
147000 -- (-542.807) [-544.943] (-544.438) (-544.452) * [-545.073] (-544.880) (-547.975) (-543.971) -- 0:00:52
147500 -- (-545.435) [-542.478] (-544.545) (-543.577) * (-546.977) (-542.954) (-545.040) [-544.000] -- 0:00:52
148000 -- (-544.305) (-542.928) (-544.863) [-548.531] * (-550.769) (-542.871) [-543.448] (-546.183) -- 0:00:51
148500 -- (-545.421) (-544.166) [-544.108] (-546.434) * [-542.883] (-542.688) (-547.744) (-545.038) -- 0:00:51
149000 -- (-546.651) [-544.065] (-546.026) (-546.454) * (-545.809) (-542.897) [-542.535] (-546.517) -- 0:00:51
149500 -- (-542.690) (-544.017) [-545.953] (-544.757) * (-544.052) [-546.933] (-542.409) (-549.058) -- 0:00:51
150000 -- [-544.744] (-545.219) (-543.504) (-544.207) * [-544.447] (-545.491) (-543.531) (-549.347) -- 0:00:51
Average standard deviation of split frequencies: 0.023548
150500 -- [-543.682] (-546.178) (-543.071) (-542.372) * (-547.253) (-550.345) [-544.094] (-545.489) -- 0:00:50
151000 -- (-543.909) (-544.182) (-544.787) [-544.415] * (-544.168) [-544.751] (-545.691) (-548.460) -- 0:00:50
151500 -- (-543.067) (-547.144) (-542.920) [-543.286] * (-544.181) [-542.874] (-545.787) (-541.973) -- 0:00:50
152000 -- (-543.316) (-545.430) (-544.250) [-543.992] * (-543.969) [-544.978] (-542.960) (-543.052) -- 0:00:50
152500 -- (-543.769) (-545.721) [-543.608] (-546.482) * (-547.181) (-544.088) (-546.780) [-542.510] -- 0:00:50
153000 -- (-543.517) [-542.821] (-548.587) (-544.369) * [-545.291] (-542.856) (-546.571) (-543.586) -- 0:00:49
153500 -- [-545.139] (-542.520) (-545.720) (-544.064) * (-543.641) (-544.649) [-545.332] (-547.030) -- 0:00:49
154000 -- (-543.034) [-543.109] (-547.064) (-544.754) * (-544.158) (-548.137) (-545.143) [-543.431] -- 0:00:49
154500 -- (-543.677) (-542.485) [-547.145] (-544.621) * [-544.623] (-545.699) (-543.425) (-542.908) -- 0:00:49
155000 -- (-545.242) (-547.391) (-547.944) [-542.031] * [-544.599] (-546.782) (-543.460) (-545.248) -- 0:00:49
Average standard deviation of split frequencies: 0.023697
155500 -- (-546.107) (-542.480) (-545.774) [-542.790] * [-544.117] (-545.085) (-544.877) (-542.958) -- 0:00:48
156000 -- (-542.894) (-543.015) (-546.197) [-544.039] * (-547.110) (-543.327) [-543.218] (-543.153) -- 0:00:48
156500 -- (-544.240) (-543.596) (-542.448) [-544.026] * (-544.352) (-542.832) [-543.838] (-542.998) -- 0:00:48
157000 -- [-544.051] (-546.094) (-547.923) (-544.849) * (-543.400) (-544.387) (-543.591) [-543.799] -- 0:00:48
157500 -- (-545.218) [-544.150] (-543.238) (-544.851) * (-545.576) (-544.972) (-544.318) [-543.312] -- 0:00:48
158000 -- (-547.845) [-544.107] (-545.439) (-542.856) * (-546.033) (-542.722) [-543.803] (-542.688) -- 0:00:47
158500 -- (-545.460) (-545.853) (-545.780) [-543.665] * (-545.906) [-544.176] (-545.757) (-543.380) -- 0:00:47
159000 -- [-543.674] (-546.037) (-545.394) (-544.053) * (-544.232) [-544.706] (-543.055) (-545.536) -- 0:00:47
159500 -- (-543.779) [-546.747] (-546.016) (-545.073) * (-547.075) (-545.166) (-543.891) [-543.669] -- 0:00:47
160000 -- (-544.536) (-542.217) (-543.458) [-543.757] * [-545.404] (-546.173) (-545.739) (-543.154) -- 0:00:47
Average standard deviation of split frequencies: 0.023146
160500 -- (-542.340) (-543.643) [-545.455] (-545.877) * (-546.187) (-547.006) [-543.605] (-542.467) -- 0:00:47
161000 -- (-542.870) [-545.198] (-544.866) (-548.196) * [-547.351] (-546.628) (-545.066) (-543.076) -- 0:00:52
161500 -- (-544.524) [-544.774] (-552.752) (-543.253) * [-543.971] (-543.610) (-546.341) (-543.289) -- 0:00:51
162000 -- (-544.138) (-545.266) [-544.932] (-546.223) * (-542.980) (-543.028) (-543.703) [-543.158] -- 0:00:51
162500 -- [-543.777] (-546.219) (-547.037) (-543.116) * [-544.787] (-543.864) (-544.813) (-542.489) -- 0:00:51
163000 -- [-544.373] (-543.721) (-545.078) (-543.673) * [-543.408] (-543.495) (-547.829) (-544.230) -- 0:00:51
163500 -- (-544.469) (-542.906) [-545.334] (-544.789) * (-544.342) [-545.031] (-543.106) (-543.575) -- 0:00:51
164000 -- (-545.992) [-543.737] (-545.924) (-546.480) * [-547.908] (-543.389) (-544.294) (-542.380) -- 0:00:50
164500 -- (-545.914) (-543.977) (-546.695) [-546.029] * [-543.715] (-543.748) (-544.229) (-546.495) -- 0:00:50
165000 -- (-544.537) (-545.252) (-546.649) [-543.422] * (-545.815) [-548.016] (-542.922) (-544.365) -- 0:00:50
Average standard deviation of split frequencies: 0.023316
165500 -- [-544.519] (-547.971) (-545.259) (-542.294) * [-542.339] (-543.406) (-543.666) (-543.240) -- 0:00:50
166000 -- (-543.083) (-543.271) (-543.366) [-542.633] * [-543.173] (-542.669) (-547.162) (-544.446) -- 0:00:50
166500 -- (-542.585) (-542.702) (-542.920) [-545.111] * [-547.814] (-547.022) (-547.112) (-542.295) -- 0:00:50
167000 -- [-544.981] (-542.704) (-542.183) (-543.082) * (-544.597) [-545.187] (-545.530) (-545.621) -- 0:00:49
167500 -- (-543.983) (-545.286) (-542.105) [-543.510] * (-547.058) [-544.370] (-546.952) (-546.443) -- 0:00:49
168000 -- (-543.868) [-545.441] (-544.072) (-546.093) * (-545.304) [-543.230] (-544.191) (-543.840) -- 0:00:49
168500 -- (-543.360) [-544.348] (-546.066) (-549.007) * (-544.658) (-545.098) [-544.424] (-545.344) -- 0:00:49
169000 -- [-544.677] (-542.795) (-542.329) (-544.966) * (-546.145) (-543.419) [-542.992] (-544.597) -- 0:00:49
169500 -- (-542.610) [-546.387] (-544.172) (-543.780) * (-543.362) (-544.381) [-546.187] (-545.112) -- 0:00:48
170000 -- [-543.504] (-547.474) (-543.608) (-544.468) * (-544.098) [-543.142] (-544.290) (-544.852) -- 0:00:48
Average standard deviation of split frequencies: 0.023987
170500 -- (-546.942) (-545.178) (-544.644) [-545.532] * (-544.958) [-543.534] (-543.271) (-542.805) -- 0:00:48
171000 -- (-544.346) (-544.931) (-541.987) [-546.773] * (-546.657) (-545.560) (-544.758) [-543.227] -- 0:00:48
171500 -- (-545.445) (-547.364) [-542.305] (-546.563) * [-545.654] (-543.211) (-545.795) (-544.161) -- 0:00:48
172000 -- (-544.033) [-543.396] (-543.008) (-543.248) * [-543.329] (-543.809) (-543.231) (-547.360) -- 0:00:48
172500 -- (-547.630) (-546.142) [-544.735] (-543.251) * (-546.054) (-546.878) [-546.102] (-544.176) -- 0:00:47
173000 -- (-543.793) (-544.439) (-543.700) [-543.394] * (-542.826) [-542.995] (-543.795) (-546.406) -- 0:00:47
173500 -- (-543.787) (-544.745) [-543.919] (-544.977) * [-542.882] (-545.824) (-542.989) (-545.773) -- 0:00:47
174000 -- (-544.585) [-545.913] (-548.210) (-545.371) * (-542.871) (-542.999) [-542.931] (-545.702) -- 0:00:47
174500 -- (-547.813) (-545.033) (-547.617) [-546.012] * (-542.296) [-544.048] (-543.804) (-545.095) -- 0:00:47
175000 -- (-543.834) [-543.471] (-548.549) (-547.900) * (-543.558) [-546.438] (-542.607) (-542.713) -- 0:00:47
Average standard deviation of split frequencies: 0.023401
175500 -- (-545.142) (-545.658) (-544.321) [-547.144] * (-544.019) [-545.206] (-546.796) (-543.565) -- 0:00:46
176000 -- [-542.491] (-544.803) (-544.269) (-543.482) * [-547.154] (-547.440) (-545.573) (-545.684) -- 0:00:46
176500 -- (-543.083) (-548.774) [-545.690] (-543.264) * (-547.097) (-543.968) [-543.205] (-543.181) -- 0:00:46
177000 -- (-544.076) (-549.778) [-542.775] (-545.435) * [-547.781] (-547.754) (-543.080) (-546.606) -- 0:00:46
177500 -- (-545.598) (-544.615) [-544.827] (-543.942) * (-544.455) (-546.978) (-544.371) [-544.064] -- 0:00:50
178000 -- (-545.141) [-542.696] (-544.704) (-546.394) * (-543.898) (-544.457) [-546.198] (-546.708) -- 0:00:50
178500 -- (-545.444) (-543.076) [-544.771] (-544.064) * (-543.292) (-547.676) [-542.947] (-549.423) -- 0:00:50
179000 -- (-545.068) (-547.780) [-543.984] (-542.165) * (-544.073) (-546.072) (-542.652) [-544.518] -- 0:00:50
179500 -- (-552.961) (-545.787) [-543.823] (-543.372) * (-543.367) [-543.024] (-545.434) (-543.025) -- 0:00:50
180000 -- (-548.138) [-544.131] (-546.179) (-543.452) * [-543.136] (-545.204) (-543.005) (-545.113) -- 0:00:50
Average standard deviation of split frequencies: 0.023338
180500 -- (-544.930) [-543.504] (-545.993) (-549.152) * (-543.178) [-545.596] (-544.972) (-544.246) -- 0:00:49
181000 -- [-544.038] (-548.886) (-543.242) (-548.259) * [-543.562] (-542.740) (-543.123) (-542.413) -- 0:00:49
181500 -- (-543.910) [-543.685] (-543.009) (-546.346) * (-542.202) (-541.973) [-543.066] (-542.419) -- 0:00:49
182000 -- (-544.416) (-542.382) (-544.179) [-544.406] * (-543.333) [-542.286] (-542.607) (-542.440) -- 0:00:49
182500 -- (-542.158) [-542.257] (-543.989) (-543.406) * (-544.599) (-543.764) (-542.401) [-545.781] -- 0:00:49
183000 -- (-543.197) [-543.399] (-543.869) (-547.874) * (-546.161) (-544.180) (-545.128) [-543.205] -- 0:00:49
183500 -- (-547.153) (-545.342) (-543.330) [-543.597] * (-546.089) [-544.907] (-542.510) (-548.171) -- 0:00:48
184000 -- [-547.935] (-551.510) (-543.446) (-543.525) * (-543.543) (-543.838) [-542.952] (-546.834) -- 0:00:48
184500 -- [-546.916] (-543.924) (-546.714) (-544.028) * [-544.042] (-545.398) (-544.162) (-549.267) -- 0:00:48
185000 -- [-546.703] (-542.856) (-547.587) (-546.998) * [-544.726] (-544.203) (-543.516) (-546.674) -- 0:00:48
Average standard deviation of split frequencies: 0.024500
185500 -- (-543.283) (-544.417) (-549.404) [-544.112] * [-545.835] (-543.491) (-543.659) (-548.123) -- 0:00:48
186000 -- [-547.498] (-544.352) (-545.804) (-544.098) * [-542.266] (-544.515) (-547.166) (-546.980) -- 0:00:48
186500 -- [-546.800] (-545.143) (-544.535) (-546.087) * (-542.851) (-545.945) (-545.546) [-544.712] -- 0:00:47
187000 -- (-546.580) [-544.813] (-543.398) (-544.352) * [-545.064] (-545.141) (-546.628) (-542.743) -- 0:00:47
187500 -- (-544.163) (-545.062) [-546.164] (-543.479) * (-543.521) [-546.474] (-544.830) (-543.115) -- 0:00:47
188000 -- (-543.622) (-546.840) [-547.193] (-545.768) * (-544.507) (-548.653) [-542.482] (-544.284) -- 0:00:47
188500 -- [-546.649] (-544.026) (-547.152) (-543.744) * (-542.811) (-545.561) [-543.232] (-545.797) -- 0:00:47
189000 -- (-545.095) (-545.054) [-544.015] (-542.847) * (-543.419) (-545.175) (-544.086) [-543.337] -- 0:00:47
189500 -- [-543.432] (-544.090) (-543.744) (-546.271) * (-544.128) (-545.038) (-545.247) [-546.770] -- 0:00:47
190000 -- [-543.165] (-544.073) (-544.743) (-543.530) * (-543.918) (-542.890) (-546.574) [-545.628] -- 0:00:46
Average standard deviation of split frequencies: 0.024334
190500 -- [-543.164] (-543.375) (-543.144) (-543.406) * [-543.008] (-543.884) (-549.252) (-546.653) -- 0:00:46
191000 -- (-544.320) (-543.308) [-545.860] (-543.257) * (-544.823) (-544.384) (-548.502) [-543.858] -- 0:00:46
191500 -- (-544.216) (-543.684) [-543.969] (-547.188) * (-545.421) (-545.750) (-543.789) [-543.434] -- 0:00:46
192000 -- (-548.006) [-545.747] (-542.754) (-543.951) * (-542.134) [-543.420] (-546.077) (-546.029) -- 0:00:46
192500 -- (-544.424) (-543.390) (-546.962) [-544.978] * [-543.027] (-549.254) (-544.936) (-546.842) -- 0:00:46
193000 -- (-545.398) [-543.773] (-545.005) (-545.429) * (-542.995) (-545.102) [-545.516] (-554.675) -- 0:00:45
193500 -- (-542.906) (-542.959) [-544.544] (-544.586) * [-543.181] (-545.599) (-545.193) (-546.570) -- 0:00:45
194000 -- [-542.769] (-546.199) (-544.356) (-543.390) * [-543.313] (-543.252) (-549.407) (-544.642) -- 0:00:45
194500 -- (-542.933) (-542.565) (-543.133) [-543.700] * (-547.384) (-545.641) (-543.847) [-543.554] -- 0:00:49
195000 -- (-546.574) (-546.382) [-547.592] (-548.549) * (-543.755) (-546.119) (-550.305) [-542.124] -- 0:00:49
Average standard deviation of split frequencies: 0.023811
195500 -- [-547.380] (-546.391) (-549.576) (-544.324) * [-543.842] (-543.327) (-546.146) (-544.477) -- 0:00:49
196000 -- (-545.524) (-542.953) [-545.698] (-547.210) * [-544.469] (-548.338) (-542.180) (-544.312) -- 0:00:49
196500 -- (-543.903) (-543.644) [-542.870] (-546.051) * (-542.852) [-543.834] (-545.691) (-543.361) -- 0:00:49
197000 -- (-546.453) [-542.731] (-543.479) (-544.596) * (-542.882) (-543.368) [-543.950] (-545.184) -- 0:00:48
197500 -- (-544.212) [-542.332] (-547.879) (-542.951) * (-542.581) [-543.048] (-545.617) (-544.510) -- 0:00:48
198000 -- (-544.938) [-546.495] (-549.187) (-544.242) * (-545.311) (-545.496) (-543.976) [-543.570] -- 0:00:48
198500 -- (-542.951) [-545.440] (-547.312) (-550.350) * [-544.261] (-546.474) (-549.718) (-543.308) -- 0:00:48
199000 -- (-544.242) (-546.928) [-544.612] (-543.529) * [-543.525] (-544.172) (-550.377) (-543.699) -- 0:00:48
199500 -- [-543.811] (-544.689) (-544.273) (-543.248) * [-547.865] (-545.386) (-543.179) (-546.091) -- 0:00:48
200000 -- (-544.503) (-545.403) [-543.660] (-543.498) * (-545.941) (-543.132) [-544.606] (-544.072) -- 0:00:48
Average standard deviation of split frequencies: 0.024079
200500 -- [-543.787] (-544.860) (-543.215) (-543.793) * (-547.322) (-544.356) (-542.817) [-542.503] -- 0:00:47
201000 -- [-546.107] (-543.735) (-545.039) (-543.447) * [-545.971] (-543.111) (-543.777) (-542.795) -- 0:00:47
201500 -- (-545.533) (-543.843) (-544.203) [-546.128] * (-545.235) (-543.701) [-544.886] (-544.576) -- 0:00:47
202000 -- (-545.355) (-544.941) [-544.812] (-544.475) * [-542.486] (-543.050) (-548.968) (-543.874) -- 0:00:47
202500 -- (-546.004) (-544.610) (-544.841) [-542.941] * [-545.790] (-544.287) (-546.347) (-544.543) -- 0:00:47
203000 -- [-544.791] (-545.338) (-544.911) (-543.486) * (-546.355) (-542.729) [-544.710] (-548.433) -- 0:00:47
203500 -- (-545.690) (-544.128) (-544.442) [-544.643] * (-545.413) (-543.602) [-544.140] (-543.911) -- 0:00:46
204000 -- (-546.903) (-548.814) (-543.361) [-542.680] * [-543.844] (-544.960) (-542.937) (-545.679) -- 0:00:46
204500 -- [-545.846] (-555.170) (-545.359) (-543.319) * [-543.385] (-544.439) (-543.061) (-546.123) -- 0:00:46
205000 -- (-547.309) (-546.864) (-546.297) [-545.063] * [-543.109] (-544.518) (-545.522) (-543.519) -- 0:00:46
Average standard deviation of split frequencies: 0.023913
205500 -- [-543.211] (-543.443) (-547.951) (-545.229) * (-546.641) (-544.310) [-545.760] (-543.589) -- 0:00:46
206000 -- (-547.320) [-543.595] (-544.701) (-546.663) * (-545.068) (-548.413) [-546.881] (-542.919) -- 0:00:46
206500 -- [-546.331] (-550.099) (-544.749) (-546.235) * (-543.223) (-549.470) [-544.992] (-543.312) -- 0:00:46
207000 -- [-544.494] (-543.607) (-545.170) (-542.473) * (-542.934) [-543.824] (-544.968) (-545.311) -- 0:00:45
207500 -- (-544.196) (-543.332) [-544.285] (-545.820) * (-543.806) (-543.009) (-546.772) [-543.297] -- 0:00:45
208000 -- [-544.796] (-548.288) (-543.385) (-552.282) * [-543.314] (-548.164) (-543.312) (-546.456) -- 0:00:45
208500 -- (-545.557) (-546.036) [-546.600] (-553.156) * (-544.707) (-546.890) (-543.643) [-543.825] -- 0:00:45
209000 -- (-544.606) [-543.617] (-545.557) (-545.059) * (-543.864) (-543.661) [-542.688] (-543.548) -- 0:00:45
209500 -- [-545.309] (-545.148) (-543.374) (-545.395) * (-545.949) (-543.849) [-542.173] (-544.667) -- 0:00:45
210000 -- [-544.388] (-546.147) (-545.982) (-542.730) * (-544.166) [-542.668] (-546.120) (-543.993) -- 0:00:45
Average standard deviation of split frequencies: 0.024055
210500 -- [-543.656] (-544.474) (-542.790) (-544.433) * (-545.372) (-543.107) (-543.889) [-543.331] -- 0:00:48
211000 -- (-543.864) [-544.165] (-542.300) (-543.694) * (-542.776) [-544.517] (-545.563) (-543.455) -- 0:00:48
211500 -- (-544.835) (-542.786) [-542.274] (-545.828) * (-545.471) (-544.772) (-548.978) [-543.053] -- 0:00:48
212000 -- (-543.556) (-545.733) (-543.532) [-544.347] * [-545.317] (-542.210) (-544.145) (-542.684) -- 0:00:48
212500 -- (-542.785) (-544.874) (-545.804) [-543.794] * (-544.455) (-542.914) [-544.589] (-543.859) -- 0:00:48
213000 -- (-542.548) [-543.857] (-543.702) (-543.128) * (-545.452) (-543.058) (-542.226) [-545.444] -- 0:00:48
213500 -- (-548.094) (-545.538) [-545.612] (-542.676) * (-545.978) (-543.171) (-544.530) [-543.060] -- 0:00:47
214000 -- [-543.773] (-545.744) (-544.363) (-545.629) * (-545.614) (-546.110) (-548.023) [-542.893] -- 0:00:47
214500 -- (-544.973) (-543.812) (-544.324) [-544.234] * (-543.897) (-543.256) [-550.017] (-547.481) -- 0:00:47
215000 -- (-546.396) (-546.265) [-546.333] (-544.473) * [-543.690] (-545.771) (-544.975) (-547.014) -- 0:00:47
Average standard deviation of split frequencies: 0.023898
215500 -- (-544.459) (-544.346) (-545.033) [-543.968] * (-546.078) (-543.829) [-543.338] (-546.454) -- 0:00:47
216000 -- [-543.628] (-543.676) (-543.299) (-545.242) * (-544.895) (-544.420) [-544.302] (-543.650) -- 0:00:47
216500 -- (-545.670) (-543.562) (-543.083) [-542.745] * [-544.231] (-545.583) (-544.586) (-544.534) -- 0:00:47
217000 -- (-544.772) [-545.060] (-543.682) (-544.201) * [-546.387] (-546.373) (-543.145) (-543.075) -- 0:00:46
217500 -- [-543.053] (-543.613) (-543.559) (-549.303) * (-553.067) [-544.165] (-543.131) (-543.904) -- 0:00:46
218000 -- (-544.585) (-544.353) [-542.816] (-549.698) * [-546.424] (-546.671) (-543.578) (-545.606) -- 0:00:46
218500 -- [-545.953] (-543.449) (-542.563) (-547.593) * (-543.910) (-544.796) (-543.795) [-542.764] -- 0:00:46
219000 -- (-544.373) (-547.379) [-542.506] (-545.495) * (-546.130) [-543.338] (-543.728) (-543.497) -- 0:00:46
219500 -- (-543.494) (-546.796) [-546.862] (-544.647) * [-544.445] (-550.381) (-545.151) (-546.917) -- 0:00:46
220000 -- (-543.239) [-546.376] (-544.998) (-545.970) * (-543.818) (-558.651) [-544.008] (-542.611) -- 0:00:46
Average standard deviation of split frequencies: 0.022906
220500 -- (-544.129) (-544.209) (-543.535) [-542.961] * (-542.643) [-546.884] (-544.054) (-544.454) -- 0:00:45
221000 -- [-542.795] (-545.798) (-544.383) (-543.268) * (-544.851) (-544.151) (-545.483) [-544.655] -- 0:00:45
221500 -- (-543.056) [-545.442] (-545.983) (-544.514) * [-543.632] (-544.796) (-547.789) (-545.144) -- 0:00:45
222000 -- (-545.471) (-546.592) [-547.893] (-544.926) * (-545.738) [-544.270] (-546.125) (-544.536) -- 0:00:45
222500 -- [-545.063] (-544.113) (-548.890) (-543.386) * [-544.472] (-542.756) (-543.751) (-542.859) -- 0:00:45
223000 -- (-549.508) [-543.787] (-544.534) (-545.388) * (-544.805) (-543.871) (-548.736) [-543.471] -- 0:00:45
223500 -- (-542.699) (-543.862) (-544.789) [-544.838] * (-542.885) (-543.862) [-544.046] (-546.188) -- 0:00:45
224000 -- (-543.881) [-544.036] (-544.140) (-543.616) * (-543.432) [-545.540] (-547.681) (-546.650) -- 0:00:45
224500 -- (-543.483) (-543.074) [-544.833] (-542.880) * (-544.543) (-543.297) [-543.885] (-543.367) -- 0:00:44
225000 -- [-544.181] (-544.240) (-546.107) (-544.967) * (-544.697) (-551.263) (-544.151) [-543.252] -- 0:00:44
Average standard deviation of split frequencies: 0.022365
225500 -- (-545.216) (-544.092) [-545.741] (-542.420) * (-544.305) [-548.871] (-544.132) (-545.511) -- 0:00:48
226000 -- (-546.050) (-545.080) (-544.838) [-543.127] * (-545.476) (-544.946) [-546.609] (-546.067) -- 0:00:47
226500 -- [-543.961] (-546.060) (-547.699) (-546.213) * (-545.297) (-543.087) (-545.775) [-544.654] -- 0:00:47
227000 -- [-544.013] (-546.513) (-549.953) (-546.719) * (-544.451) (-548.104) (-544.630) [-544.466] -- 0:00:47
227500 -- (-544.312) [-546.905] (-546.204) (-543.013) * [-543.055] (-546.202) (-543.290) (-547.798) -- 0:00:47
228000 -- (-542.415) (-549.128) (-544.103) [-543.460] * [-543.038] (-542.410) (-543.168) (-546.196) -- 0:00:47
228500 -- (-544.301) [-546.923] (-544.023) (-544.834) * [-545.666] (-543.475) (-542.346) (-545.060) -- 0:00:47
229000 -- (-549.576) (-554.212) (-543.720) [-543.472] * (-544.819) [-545.506] (-543.086) (-554.908) -- 0:00:47
229500 -- [-549.418] (-548.243) (-544.590) (-549.353) * (-545.682) [-543.644] (-542.760) (-548.062) -- 0:00:47
230000 -- (-544.000) [-546.238] (-544.263) (-545.709) * [-546.046] (-543.342) (-542.798) (-544.050) -- 0:00:46
Average standard deviation of split frequencies: 0.022050
230500 -- (-544.056) (-546.863) (-543.864) [-542.682] * (-542.449) [-543.321] (-542.779) (-544.170) -- 0:00:46
231000 -- (-545.730) (-545.109) (-546.026) [-542.874] * [-544.082] (-548.351) (-543.872) (-545.234) -- 0:00:46
231500 -- [-544.014] (-542.818) (-545.596) (-543.671) * [-544.034] (-544.024) (-542.370) (-549.576) -- 0:00:46
232000 -- (-544.356) [-544.050] (-545.000) (-542.856) * (-544.281) (-544.033) (-543.992) [-543.740] -- 0:00:46
232500 -- (-544.461) [-546.312] (-545.136) (-543.956) * (-545.968) (-544.055) (-543.534) [-543.349] -- 0:00:46
233000 -- (-544.024) [-542.239] (-543.231) (-546.393) * (-544.480) (-546.404) [-543.580] (-547.573) -- 0:00:46
233500 -- [-543.331] (-551.128) (-547.452) (-544.397) * (-545.009) (-545.393) [-543.346] (-544.039) -- 0:00:45
234000 -- (-543.369) (-546.885) [-548.221] (-542.079) * (-544.018) (-543.888) [-546.620] (-545.769) -- 0:00:45
234500 -- (-543.847) [-542.964] (-547.160) (-543.690) * (-544.007) (-544.068) (-543.531) [-543.607] -- 0:00:45
235000 -- (-543.002) (-544.070) [-543.124] (-544.762) * (-546.649) (-547.689) [-545.097] (-542.909) -- 0:00:45
Average standard deviation of split frequencies: 0.021972
235500 -- (-547.064) [-548.897] (-544.996) (-543.962) * (-551.229) [-544.298] (-544.588) (-542.642) -- 0:00:45
236000 -- (-543.768) [-545.547] (-543.809) (-543.861) * [-551.305] (-545.747) (-546.201) (-547.199) -- 0:00:45
236500 -- (-542.500) (-543.902) [-544.330] (-545.853) * (-550.601) (-542.591) (-547.118) [-544.918] -- 0:00:45
237000 -- (-545.682) [-544.180] (-544.998) (-547.005) * [-545.113] (-544.353) (-547.977) (-542.840) -- 0:00:45
237500 -- (-543.427) [-544.972] (-547.038) (-546.415) * (-545.437) (-543.796) (-543.720) [-542.478] -- 0:00:44
238000 -- (-544.249) (-542.809) [-545.159] (-543.999) * (-543.194) (-543.658) [-544.112] (-542.477) -- 0:00:44
238500 -- (-550.045) [-544.108] (-543.759) (-542.097) * [-543.763] (-542.333) (-549.420) (-542.779) -- 0:00:44
239000 -- (-547.530) (-542.594) [-543.783] (-542.422) * (-545.692) (-547.721) [-547.162] (-542.521) -- 0:00:44
239500 -- (-545.760) (-543.655) [-547.048] (-542.523) * (-543.637) (-546.803) [-544.268] (-546.415) -- 0:00:44
240000 -- (-548.636) (-544.196) (-546.228) [-544.452] * [-543.176] (-545.387) (-544.477) (-545.624) -- 0:00:44
Average standard deviation of split frequencies: 0.022917
240500 -- [-548.125] (-543.303) (-548.440) (-544.550) * (-548.971) (-544.773) (-543.482) [-544.638] -- 0:00:44
241000 -- (-547.066) (-543.861) [-548.946] (-546.387) * (-545.158) [-544.320] (-549.015) (-542.846) -- 0:00:44
241500 -- [-543.391] (-550.827) (-543.758) (-544.578) * [-552.252] (-543.840) (-545.604) (-542.314) -- 0:00:43
242000 -- [-544.957] (-549.308) (-545.716) (-547.062) * (-543.840) (-545.437) (-542.897) [-542.777] -- 0:00:43
242500 -- (-546.497) [-543.087] (-543.259) (-548.596) * (-542.908) [-542.958] (-545.501) (-543.597) -- 0:00:46
243000 -- (-542.939) [-545.179] (-546.940) (-543.569) * [-543.547] (-550.974) (-545.603) (-544.557) -- 0:00:46
243500 -- [-543.105] (-546.031) (-543.582) (-542.897) * (-544.404) [-545.339] (-545.781) (-546.141) -- 0:00:46
244000 -- [-546.223] (-545.103) (-548.245) (-543.897) * (-547.140) (-544.837) (-545.502) [-543.932] -- 0:00:46
244500 -- (-547.613) [-543.911] (-543.391) (-545.706) * [-543.350] (-543.028) (-544.041) (-543.569) -- 0:00:46
245000 -- (-545.767) [-544.297] (-543.001) (-543.742) * (-542.962) (-543.773) (-544.816) [-544.133] -- 0:00:46
Average standard deviation of split frequencies: 0.022229
245500 -- (-545.516) (-549.563) [-548.964] (-544.278) * [-544.456] (-545.666) (-543.795) (-546.743) -- 0:00:46
246000 -- (-546.544) (-545.778) (-545.336) [-545.971] * [-545.711] (-544.340) (-544.780) (-548.622) -- 0:00:45
246500 -- (-542.768) [-545.475] (-545.663) (-543.275) * (-543.321) [-543.504] (-545.489) (-547.926) -- 0:00:45
247000 -- (-547.573) (-543.776) (-547.026) [-544.720] * (-546.466) [-543.061] (-546.254) (-546.693) -- 0:00:45
247500 -- (-546.031) (-544.550) (-543.265) [-544.414] * (-546.990) (-542.411) [-542.922] (-542.333) -- 0:00:45
248000 -- (-543.807) [-544.370] (-543.596) (-543.867) * (-543.021) [-546.762] (-546.917) (-545.432) -- 0:00:45
248500 -- (-542.687) [-545.201] (-544.300) (-543.893) * (-548.909) (-545.650) [-545.215] (-544.882) -- 0:00:45
249000 -- (-543.786) (-543.416) (-543.452) [-543.187] * (-547.026) (-543.808) [-547.006] (-543.478) -- 0:00:45
249500 -- [-548.953] (-543.242) (-545.142) (-544.927) * (-544.017) (-543.150) (-545.876) [-544.017] -- 0:00:45
250000 -- (-545.129) (-544.026) (-544.489) [-544.061] * [-544.219] (-545.354) (-545.083) (-543.784) -- 0:00:45
Average standard deviation of split frequencies: 0.022379
250500 -- [-546.052] (-542.603) (-544.031) (-543.859) * [-542.415] (-543.590) (-546.168) (-545.165) -- 0:00:44
251000 -- [-543.952] (-544.914) (-546.053) (-544.527) * (-542.396) (-547.666) (-545.639) [-544.196] -- 0:00:44
251500 -- (-546.906) [-544.444] (-544.109) (-544.433) * (-543.208) (-543.679) [-548.587] (-546.816) -- 0:00:44
252000 -- (-544.733) [-546.382] (-543.337) (-543.979) * (-546.089) (-542.583) (-544.000) [-546.023] -- 0:00:44
252500 -- (-546.711) (-543.985) (-543.018) [-543.134] * [-545.016] (-545.971) (-543.853) (-542.764) -- 0:00:44
253000 -- (-544.407) (-542.818) [-544.488] (-544.876) * (-545.362) [-543.822] (-544.241) (-542.792) -- 0:00:44
253500 -- [-543.910] (-542.952) (-543.628) (-543.176) * (-547.248) (-546.856) (-545.617) [-543.833] -- 0:00:44
254000 -- (-543.224) [-543.555] (-549.874) (-544.473) * [-542.850] (-543.770) (-543.442) (-546.944) -- 0:00:44
254500 -- (-543.970) (-547.014) (-546.506) [-543.471] * [-544.657] (-544.491) (-545.176) (-543.287) -- 0:00:43
255000 -- (-545.143) [-543.386] (-545.127) (-545.696) * [-542.516] (-545.665) (-543.693) (-548.246) -- 0:00:43
Average standard deviation of split frequencies: 0.022742
255500 -- [-545.021] (-543.286) (-544.833) (-544.917) * [-543.929] (-547.991) (-543.344) (-546.103) -- 0:00:43
256000 -- (-546.626) (-544.633) [-546.324] (-543.947) * (-542.794) (-548.426) [-542.439] (-549.515) -- 0:00:43
256500 -- [-547.618] (-549.545) (-545.030) (-542.765) * [-543.464] (-544.649) (-544.786) (-543.013) -- 0:00:43
257000 -- [-545.352] (-544.152) (-553.480) (-546.615) * (-545.218) (-543.442) [-543.393] (-542.987) -- 0:00:43
257500 -- (-543.445) (-551.041) (-555.405) [-543.122] * (-547.784) [-546.308] (-547.931) (-545.819) -- 0:00:43
258000 -- (-545.395) (-545.458) [-542.687] (-543.985) * (-544.772) (-543.435) [-544.088] (-543.990) -- 0:00:43
258500 -- (-543.123) (-543.865) [-545.326] (-542.975) * [-544.488] (-544.915) (-543.905) (-544.810) -- 0:00:43
259000 -- (-543.627) (-549.684) (-543.842) [-545.659] * (-542.944) (-543.646) (-545.950) [-544.941] -- 0:00:42
259500 -- (-543.390) (-547.036) [-546.609] (-552.089) * (-544.189) (-544.084) [-546.339] (-544.777) -- 0:00:45
260000 -- (-543.644) (-548.716) (-545.697) [-542.919] * [-545.215] (-543.977) (-544.654) (-544.716) -- 0:00:45
Average standard deviation of split frequencies: 0.022154
260500 -- (-544.070) [-547.970] (-543.639) (-543.439) * [-544.595] (-543.419) (-547.190) (-545.202) -- 0:00:45
261000 -- (-545.335) (-543.591) [-542.528] (-543.163) * [-545.444] (-549.036) (-549.687) (-546.824) -- 0:00:45
261500 -- (-543.597) [-543.592] (-547.355) (-543.046) * (-542.321) (-546.168) [-542.407] (-546.699) -- 0:00:45
262000 -- [-544.562] (-542.883) (-544.210) (-545.606) * (-543.087) [-544.418] (-544.060) (-548.513) -- 0:00:45
262500 -- (-543.390) (-544.869) [-543.988] (-544.662) * (-545.501) (-545.517) (-543.578) [-543.319] -- 0:00:44
263000 -- (-542.800) (-549.183) (-543.570) [-542.360] * (-544.314) (-543.818) (-545.002) [-544.182] -- 0:00:44
263500 -- [-545.223] (-548.673) (-543.845) (-542.984) * (-548.438) (-546.897) (-547.592) [-544.540] -- 0:00:44
264000 -- [-544.314] (-548.332) (-543.559) (-542.451) * [-542.946] (-545.679) (-547.744) (-546.246) -- 0:00:44
264500 -- (-542.914) [-550.410] (-543.443) (-543.486) * [-542.946] (-543.115) (-545.288) (-544.355) -- 0:00:44
265000 -- [-542.833] (-544.983) (-545.826) (-544.902) * (-543.828) (-544.460) [-550.367] (-543.295) -- 0:00:44
Average standard deviation of split frequencies: 0.020912
265500 -- (-545.242) (-545.004) (-543.505) [-543.545] * (-544.421) (-544.456) (-546.490) [-542.379] -- 0:00:44
266000 -- (-542.646) (-546.249) (-542.761) [-547.679] * (-544.014) [-544.483] (-543.685) (-542.497) -- 0:00:44
266500 -- (-543.252) (-543.572) (-547.103) [-543.302] * (-546.586) [-546.185] (-549.211) (-542.421) -- 0:00:44
267000 -- (-542.761) [-544.720] (-545.342) (-544.214) * (-542.428) (-546.008) [-545.571] (-544.500) -- 0:00:43
267500 -- [-543.998] (-544.030) (-544.010) (-543.396) * (-543.395) [-544.600] (-547.478) (-544.126) -- 0:00:43
268000 -- [-542.391] (-546.977) (-542.270) (-545.611) * (-542.104) [-546.882] (-543.034) (-543.014) -- 0:00:43
268500 -- (-542.375) (-547.472) [-544.262] (-542.364) * (-553.471) (-542.825) (-543.135) [-544.884] -- 0:00:43
269000 -- (-543.031) (-544.415) (-547.442) [-546.699] * (-544.003) (-543.733) [-543.509] (-542.116) -- 0:00:43
269500 -- (-544.061) [-543.185] (-546.692) (-544.789) * (-543.328) (-543.861) (-545.471) [-542.364] -- 0:00:43
270000 -- (-545.226) (-545.646) [-544.240] (-546.399) * (-544.608) (-543.602) [-543.142] (-543.326) -- 0:00:43
Average standard deviation of split frequencies: 0.021422
270500 -- (-547.938) (-544.827) (-544.471) [-547.149] * (-547.368) (-544.016) (-542.714) [-547.198] -- 0:00:43
271000 -- (-545.290) (-543.514) (-542.680) [-547.434] * (-544.933) (-545.468) [-545.485] (-546.440) -- 0:00:43
271500 -- (-543.805) (-544.047) (-544.503) [-545.175] * [-544.348] (-542.855) (-543.640) (-544.769) -- 0:00:42
272000 -- (-543.868) [-545.011] (-543.947) (-544.312) * [-544.548] (-545.167) (-545.063) (-545.594) -- 0:00:42
272500 -- [-545.790] (-543.862) (-544.604) (-547.381) * (-550.395) (-545.161) (-544.643) [-543.919] -- 0:00:42
273000 -- (-546.180) (-551.730) [-543.922] (-542.724) * (-546.833) [-543.963] (-545.091) (-546.883) -- 0:00:42
273500 -- (-546.802) (-544.260) [-545.007] (-544.481) * (-546.282) (-545.143) (-544.336) [-543.222] -- 0:00:42
274000 -- [-544.820] (-543.657) (-546.134) (-547.154) * (-545.640) [-549.503] (-543.518) (-545.083) -- 0:00:42
274500 -- (-545.985) [-543.296] (-545.017) (-548.376) * [-543.559] (-543.169) (-543.916) (-555.228) -- 0:00:42
275000 -- (-542.785) [-544.547] (-543.988) (-551.924) * [-543.183] (-544.277) (-544.833) (-542.796) -- 0:00:42
Average standard deviation of split frequencies: 0.020586
275500 -- (-545.025) (-547.737) (-543.530) [-543.794] * (-543.038) [-546.317] (-543.444) (-543.420) -- 0:00:42
276000 -- (-543.702) [-545.844] (-543.203) (-543.430) * [-542.505] (-544.921) (-544.486) (-542.530) -- 0:00:41
276500 -- (-544.670) (-544.346) (-544.351) [-543.997] * (-542.975) (-546.948) (-547.675) [-545.310] -- 0:00:44
277000 -- (-547.010) (-545.975) [-543.971] (-544.518) * [-544.690] (-545.012) (-543.899) (-545.974) -- 0:00:44
277500 -- (-550.205) [-543.983] (-543.352) (-546.825) * [-542.459] (-545.945) (-545.945) (-546.595) -- 0:00:44
278000 -- (-545.056) (-542.356) [-544.380] (-545.970) * (-542.959) (-543.066) [-544.278] (-547.236) -- 0:00:44
278500 -- (-546.522) [-543.567] (-543.436) (-544.442) * [-542.712] (-543.290) (-544.491) (-548.022) -- 0:00:44
279000 -- (-542.630) [-544.123] (-546.394) (-543.728) * [-544.448] (-546.250) (-547.890) (-548.926) -- 0:00:43
279500 -- (-546.442) [-545.495] (-544.434) (-543.048) * [-542.968] (-542.506) (-546.631) (-544.300) -- 0:00:43
280000 -- (-543.825) [-544.327] (-545.896) (-545.785) * (-542.628) (-546.494) (-542.873) [-544.211] -- 0:00:43
Average standard deviation of split frequencies: 0.019536
280500 -- (-542.959) (-545.612) [-545.649] (-544.311) * (-543.291) (-545.593) (-544.134) [-544.320] -- 0:00:43
281000 -- (-542.286) (-544.919) (-545.647) [-543.149] * (-544.798) (-542.958) (-545.082) [-544.876] -- 0:00:43
281500 -- [-543.684] (-542.477) (-545.119) (-543.566) * (-545.819) (-544.200) [-546.418] (-544.380) -- 0:00:43
282000 -- [-544.409] (-544.740) (-546.427) (-543.931) * [-544.660] (-544.058) (-546.967) (-545.475) -- 0:00:43
282500 -- (-547.758) (-543.283) (-550.178) [-543.985] * (-544.660) (-546.739) (-542.693) [-542.757] -- 0:00:43
283000 -- (-543.715) (-543.005) (-546.192) [-543.181] * (-543.387) (-544.278) (-543.709) [-542.757] -- 0:00:43
283500 -- (-544.891) [-545.617] (-545.276) (-549.065) * (-544.672) (-547.445) [-542.961] (-545.078) -- 0:00:42
284000 -- (-545.022) (-546.331) [-543.487] (-545.229) * (-542.611) [-545.311] (-543.180) (-543.425) -- 0:00:42
284500 -- (-544.978) (-544.859) [-543.363] (-545.220) * (-542.275) (-545.524) (-543.357) [-544.292] -- 0:00:42
285000 -- (-546.412) (-542.533) [-543.303] (-547.499) * (-548.799) (-544.567) (-544.129) [-542.976] -- 0:00:42
Average standard deviation of split frequencies: 0.019953
285500 -- (-547.926) [-544.432] (-543.478) (-544.646) * (-547.017) [-544.276] (-546.459) (-543.105) -- 0:00:42
286000 -- (-543.621) (-547.840) [-542.756] (-545.653) * (-545.613) [-549.009] (-548.088) (-542.177) -- 0:00:42
286500 -- (-544.929) (-544.781) [-543.463] (-548.901) * [-545.680] (-543.441) (-544.376) (-548.878) -- 0:00:42
287000 -- (-545.808) (-543.233) [-543.792] (-544.956) * [-543.699] (-543.069) (-544.816) (-545.915) -- 0:00:42
287500 -- [-546.511] (-543.950) (-546.232) (-544.740) * [-543.093] (-543.470) (-546.592) (-550.416) -- 0:00:42
288000 -- (-547.536) (-544.380) (-543.996) [-546.135] * (-549.329) [-544.445] (-544.786) (-550.787) -- 0:00:42
288500 -- (-548.238) (-543.620) (-542.976) [-544.076] * (-545.949) (-543.529) (-545.159) [-545.680] -- 0:00:41
289000 -- [-543.136] (-544.626) (-546.590) (-543.328) * [-543.040] (-543.979) (-542.960) (-544.874) -- 0:00:41
289500 -- (-543.248) (-550.301) [-542.310] (-543.633) * (-542.949) [-547.705] (-542.645) (-546.345) -- 0:00:41
290000 -- (-545.733) (-544.590) (-548.828) [-542.379] * (-543.640) [-547.427] (-544.089) (-543.602) -- 0:00:41
Average standard deviation of split frequencies: 0.019974
290500 -- (-544.214) (-543.603) [-543.367] (-543.887) * (-546.334) [-544.522] (-542.363) (-546.014) -- 0:00:41
291000 -- (-544.410) [-545.149] (-545.254) (-544.647) * [-543.101] (-545.350) (-542.409) (-545.025) -- 0:00:41
291500 -- (-542.536) (-543.556) [-542.970] (-543.716) * [-544.122] (-547.741) (-542.528) (-548.117) -- 0:00:41
292000 -- (-543.121) [-542.851] (-545.616) (-543.948) * (-548.956) (-546.285) [-544.984] (-545.717) -- 0:00:43
292500 -- (-542.692) [-545.363] (-543.249) (-544.908) * (-545.756) (-545.282) [-544.942] (-544.342) -- 0:00:43
293000 -- [-544.812] (-544.599) (-544.197) (-542.378) * (-545.785) [-542.950] (-545.622) (-542.799) -- 0:00:43
293500 -- (-542.812) [-544.492] (-548.352) (-545.764) * (-547.296) (-545.681) [-544.313] (-544.248) -- 0:00:43
294000 -- [-544.190] (-542.595) (-545.329) (-546.075) * (-543.123) (-544.206) (-549.180) [-546.239] -- 0:00:43
294500 -- (-544.397) (-546.698) [-545.125] (-547.940) * [-543.666] (-543.799) (-545.548) (-545.368) -- 0:00:43
295000 -- [-546.318] (-544.493) (-543.536) (-542.435) * [-543.101] (-544.872) (-544.349) (-551.208) -- 0:00:43
Average standard deviation of split frequencies: 0.018934
295500 -- (-545.962) (-544.382) [-545.572] (-543.626) * (-542.533) [-545.139] (-549.770) (-547.964) -- 0:00:42
296000 -- (-545.710) (-542.706) [-544.971] (-543.530) * (-544.035) (-542.351) [-543.840] (-545.345) -- 0:00:42
296500 -- (-543.062) [-544.643] (-545.456) (-545.203) * [-542.729] (-543.843) (-550.818) (-546.303) -- 0:00:42
297000 -- [-543.861] (-542.688) (-543.615) (-544.588) * (-542.777) [-542.522] (-548.493) (-542.400) -- 0:00:42
297500 -- (-547.684) (-548.536) (-543.362) [-544.087] * (-545.817) (-544.147) [-547.108] (-544.787) -- 0:00:42
298000 -- (-544.568) (-542.192) [-542.886] (-546.012) * (-544.053) [-543.553] (-544.547) (-543.422) -- 0:00:42
298500 -- (-543.919) (-544.191) [-543.281] (-546.283) * (-543.618) [-547.810] (-543.671) (-545.781) -- 0:00:42
299000 -- (-545.145) (-547.229) [-542.969] (-542.727) * [-542.753] (-543.876) (-543.676) (-545.291) -- 0:00:42
299500 -- (-544.164) (-545.736) (-542.434) [-543.808] * (-545.150) (-549.210) (-543.144) [-543.035] -- 0:00:42
300000 -- (-545.019) [-545.402] (-543.484) (-543.532) * [-543.059] (-544.345) (-543.685) (-547.470) -- 0:00:42
Average standard deviation of split frequencies: 0.019424
300500 -- (-547.278) (-544.669) [-543.122] (-545.197) * [-543.569] (-543.984) (-543.414) (-545.113) -- 0:00:41
301000 -- (-545.532) [-543.648] (-542.369) (-544.297) * [-543.019] (-548.082) (-542.345) (-544.847) -- 0:00:41
301500 -- (-546.262) [-542.925] (-543.583) (-544.206) * (-543.286) (-544.733) (-542.915) [-542.348] -- 0:00:41
302000 -- (-546.045) [-546.773] (-542.818) (-547.700) * (-543.961) (-545.177) (-543.894) [-542.317] -- 0:00:41
302500 -- (-542.973) [-542.915] (-547.104) (-545.083) * [-546.324] (-545.410) (-547.204) (-542.938) -- 0:00:41
303000 -- (-544.457) [-543.812] (-542.412) (-542.712) * (-542.926) [-542.275] (-549.643) (-547.242) -- 0:00:41
303500 -- (-546.735) (-548.715) (-546.975) [-543.134] * (-545.437) (-543.471) [-543.640] (-546.148) -- 0:00:41
304000 -- (-546.785) [-543.548] (-545.617) (-544.947) * [-543.068] (-543.695) (-542.748) (-544.233) -- 0:00:41
304500 -- (-545.388) [-545.233] (-546.241) (-542.735) * (-544.822) [-545.206] (-543.971) (-544.654) -- 0:00:41
305000 -- (-545.055) (-543.983) [-543.578] (-542.735) * [-544.311] (-546.467) (-542.774) (-543.307) -- 0:00:41
Average standard deviation of split frequencies: 0.020027
305500 -- (-544.548) [-542.108] (-544.136) (-543.720) * (-544.093) (-544.264) (-545.771) [-542.941] -- 0:00:43
306000 -- [-544.044] (-546.163) (-544.664) (-543.949) * [-543.797] (-546.895) (-545.555) (-544.912) -- 0:00:43
306500 -- (-543.031) (-544.856) [-544.267] (-543.463) * (-544.839) (-544.056) (-549.323) [-542.868] -- 0:00:42
307000 -- (-542.707) [-542.925] (-543.979) (-542.371) * (-544.793) (-545.344) [-544.052] (-543.918) -- 0:00:42
307500 -- (-544.530) [-544.362] (-542.920) (-542.557) * (-544.479) [-546.035] (-547.435) (-546.010) -- 0:00:42
308000 -- (-544.032) [-545.330] (-543.180) (-542.446) * (-544.220) [-543.349] (-549.499) (-542.897) -- 0:00:42
308500 -- [-544.878] (-543.653) (-543.295) (-547.579) * [-545.478] (-543.993) (-542.663) (-544.004) -- 0:00:42
309000 -- (-546.032) [-545.081] (-544.165) (-544.044) * (-551.645) (-545.947) (-545.956) [-544.304] -- 0:00:42
309500 -- (-547.451) (-543.703) (-546.245) [-547.146] * (-545.958) (-543.547) [-545.210] (-543.321) -- 0:00:42
310000 -- (-543.603) (-544.866) (-546.160) [-542.851] * (-544.799) (-545.348) [-547.873] (-546.339) -- 0:00:42
Average standard deviation of split frequencies: 0.021918
310500 -- (-542.860) [-546.259] (-546.820) (-543.417) * [-546.424] (-544.225) (-544.506) (-543.849) -- 0:00:42
311000 -- (-547.215) [-545.769] (-545.310) (-543.795) * (-549.021) (-548.822) (-543.488) [-542.729] -- 0:00:42
311500 -- [-544.683] (-543.573) (-542.278) (-545.653) * (-546.816) (-544.989) [-544.544] (-543.499) -- 0:00:41
312000 -- (-544.560) [-545.844] (-545.109) (-548.967) * [-548.656] (-546.596) (-546.427) (-548.038) -- 0:00:41
312500 -- [-542.411] (-543.056) (-546.041) (-544.428) * (-549.463) (-543.492) [-543.196] (-542.266) -- 0:00:41
313000 -- (-545.394) [-545.953] (-542.915) (-543.347) * (-547.248) (-546.087) [-544.258] (-549.286) -- 0:00:41
313500 -- (-545.075) (-544.122) [-543.094] (-544.079) * (-545.459) (-549.371) [-544.182] (-546.694) -- 0:00:41
314000 -- [-543.518] (-544.151) (-543.301) (-548.476) * (-545.890) (-545.037) [-546.589] (-543.917) -- 0:00:41
314500 -- (-545.446) (-546.951) (-542.733) [-545.326] * (-546.866) [-544.347] (-554.497) (-543.992) -- 0:00:41
315000 -- [-544.862] (-546.220) (-542.581) (-544.018) * (-544.599) (-543.484) (-549.661) [-543.868] -- 0:00:41
Average standard deviation of split frequencies: 0.022045
315500 -- (-543.389) (-543.883) [-543.842] (-544.814) * (-543.336) (-542.813) [-543.446] (-545.226) -- 0:00:41
316000 -- [-545.767] (-543.942) (-543.715) (-544.312) * (-549.084) (-544.473) (-543.307) [-543.256] -- 0:00:41
316500 -- (-543.783) [-546.088] (-543.744) (-543.587) * (-542.878) (-544.764) (-543.329) [-545.139] -- 0:00:41
317000 -- (-544.421) (-547.636) [-544.481] (-544.626) * [-544.110] (-544.138) (-542.857) (-546.098) -- 0:00:40
317500 -- (-544.315) [-543.191] (-543.980) (-544.127) * (-543.293) (-546.390) (-544.893) [-543.011] -- 0:00:40
318000 -- (-542.787) (-542.781) [-548.538] (-542.813) * (-544.029) (-547.510) [-544.122] (-543.938) -- 0:00:40
318500 -- [-543.992] (-543.339) (-545.013) (-545.137) * [-543.327] (-546.139) (-544.941) (-546.298) -- 0:00:40
319000 -- [-543.333] (-544.223) (-544.893) (-545.032) * [-543.013] (-543.601) (-547.236) (-544.980) -- 0:00:40
319500 -- (-543.518) (-545.564) (-544.192) [-544.880] * [-547.632] (-542.509) (-545.347) (-542.718) -- 0:00:40
320000 -- [-543.134] (-552.801) (-543.288) (-544.266) * (-545.819) (-543.644) [-543.096] (-545.664) -- 0:00:42
Average standard deviation of split frequencies: 0.022460
320500 -- (-544.091) [-543.415] (-543.160) (-542.854) * (-543.258) [-548.338] (-543.344) (-543.183) -- 0:00:42
321000 -- (-546.186) (-546.013) (-543.137) [-547.849] * [-543.160] (-547.698) (-546.685) (-543.640) -- 0:00:42
321500 -- (-542.195) [-542.191] (-542.993) (-546.676) * [-543.678] (-547.749) (-543.744) (-545.237) -- 0:00:42
322000 -- (-545.574) (-543.659) [-542.340] (-548.480) * [-542.207] (-546.019) (-542.665) (-545.350) -- 0:00:42
322500 -- (-546.118) [-544.522] (-544.800) (-543.318) * [-542.585] (-545.261) (-544.920) (-544.216) -- 0:00:42
323000 -- [-543.671] (-544.049) (-544.416) (-545.846) * (-543.933) (-546.277) [-544.510] (-544.542) -- 0:00:41
323500 -- (-543.116) (-545.179) (-545.980) [-543.741] * (-544.485) [-551.342] (-542.960) (-543.671) -- 0:00:41
324000 -- (-544.285) (-545.749) (-543.834) [-543.646] * (-543.090) [-545.307] (-543.767) (-544.227) -- 0:00:41
324500 -- (-544.802) (-544.774) (-546.064) [-543.616] * (-551.324) (-548.329) (-545.954) [-542.911] -- 0:00:41
325000 -- (-543.202) (-544.982) [-543.539] (-545.940) * [-545.840] (-544.270) (-545.340) (-542.859) -- 0:00:41
Average standard deviation of split frequencies: 0.021462
325500 -- (-545.354) (-546.514) [-544.390] (-542.997) * (-545.212) [-544.495] (-543.667) (-544.489) -- 0:00:41
326000 -- [-545.943] (-549.381) (-543.379) (-543.050) * [-543.278] (-546.285) (-543.696) (-545.347) -- 0:00:41
326500 -- [-547.242] (-545.791) (-542.445) (-547.431) * (-545.221) [-543.238] (-543.845) (-544.538) -- 0:00:41
327000 -- (-543.042) (-550.730) (-544.421) [-544.384] * [-545.146] (-543.625) (-549.035) (-542.507) -- 0:00:41
327500 -- [-545.464] (-542.826) (-543.621) (-545.006) * (-546.125) [-542.891] (-542.855) (-544.426) -- 0:00:41
328000 -- (-544.025) [-543.719] (-545.977) (-545.653) * (-543.604) [-544.556] (-543.626) (-544.315) -- 0:00:40
328500 -- (-554.362) [-543.609] (-544.718) (-543.818) * [-542.710] (-544.720) (-545.063) (-544.033) -- 0:00:40
329000 -- (-553.582) (-544.840) (-546.254) [-545.336] * (-543.192) [-544.833] (-545.667) (-545.292) -- 0:00:40
329500 -- (-544.043) (-544.876) (-545.065) [-543.663] * (-543.460) (-543.438) (-544.216) [-545.257] -- 0:00:40
330000 -- (-544.392) (-544.558) (-549.113) [-544.396] * (-548.203) [-545.705] (-548.918) (-544.649) -- 0:00:40
Average standard deviation of split frequencies: 0.021684
330500 -- (-544.514) (-544.897) [-545.485] (-542.486) * [-547.645] (-547.146) (-547.031) (-544.978) -- 0:00:40
331000 -- (-545.660) [-543.958] (-543.584) (-547.926) * (-544.648) (-543.792) [-542.919] (-542.967) -- 0:00:40
331500 -- [-542.797] (-543.658) (-548.245) (-545.382) * [-547.836] (-543.691) (-545.399) (-544.139) -- 0:00:40
332000 -- (-545.225) [-544.056] (-546.534) (-545.491) * (-548.625) (-547.125) (-543.187) [-543.162] -- 0:00:40
332500 -- [-545.546] (-545.502) (-545.159) (-545.040) * [-546.486] (-546.842) (-542.576) (-545.058) -- 0:00:40
333000 -- (-546.071) (-544.246) [-543.674] (-546.314) * [-545.386] (-548.790) (-547.179) (-548.777) -- 0:00:40
333500 -- [-547.913] (-543.653) (-542.435) (-547.690) * (-546.694) (-542.331) [-543.530] (-548.226) -- 0:00:39
334000 -- (-545.889) [-543.747] (-543.326) (-545.587) * (-545.250) (-542.676) [-547.477] (-545.304) -- 0:00:39
334500 -- [-544.446] (-545.101) (-543.440) (-545.898) * (-544.252) (-545.537) (-544.702) [-545.091] -- 0:00:39
335000 -- (-544.860) (-544.162) (-542.767) [-547.351] * [-545.135] (-542.851) (-544.182) (-545.348) -- 0:00:39
Average standard deviation of split frequencies: 0.021414
335500 -- (-543.345) (-547.797) (-542.353) [-543.486] * (-544.480) (-543.380) (-543.714) [-543.715] -- 0:00:39
336000 -- (-543.679) (-545.279) (-544.274) [-544.793] * (-543.674) [-543.588] (-543.847) (-542.814) -- 0:00:41
336500 -- (-544.595) (-545.382) [-543.697] (-543.481) * [-543.012] (-544.203) (-545.178) (-542.967) -- 0:00:41
337000 -- (-545.324) (-546.174) (-547.068) [-544.876] * [-542.966] (-546.374) (-543.841) (-545.203) -- 0:00:41
337500 -- (-544.359) (-544.512) (-546.292) [-542.664] * [-544.665] (-543.551) (-542.816) (-544.333) -- 0:00:41
338000 -- (-547.033) (-547.030) [-545.443] (-542.866) * [-544.974] (-543.543) (-542.409) (-542.800) -- 0:00:41
338500 -- (-543.812) (-551.407) (-544.490) [-543.543] * [-543.880] (-544.864) (-550.228) (-544.796) -- 0:00:41
339000 -- (-545.906) (-546.589) (-543.251) [-545.138] * (-545.532) [-548.387] (-551.090) (-544.731) -- 0:00:40
339500 -- [-544.966] (-544.316) (-546.178) (-544.962) * [-549.264] (-543.951) (-545.021) (-544.512) -- 0:00:40
340000 -- (-545.499) [-542.676] (-545.977) (-547.156) * (-543.729) [-547.214] (-545.005) (-543.487) -- 0:00:40
Average standard deviation of split frequencies: 0.019955
340500 -- (-545.740) [-545.756] (-546.969) (-545.643) * (-546.609) (-549.078) [-545.020] (-542.847) -- 0:00:40
341000 -- [-545.048] (-546.372) (-546.581) (-545.073) * (-543.391) (-544.792) [-544.205] (-543.461) -- 0:00:40
341500 -- (-543.453) (-542.722) (-546.043) [-544.425] * (-542.826) [-544.648] (-546.576) (-543.036) -- 0:00:40
342000 -- (-543.421) [-546.379] (-545.016) (-545.173) * (-546.825) (-543.420) [-543.328] (-547.483) -- 0:00:40
342500 -- (-546.824) (-545.655) (-543.226) [-544.685] * (-543.822) [-546.206] (-542.875) (-544.345) -- 0:00:40
343000 -- [-547.494] (-545.605) (-542.737) (-542.817) * (-549.294) [-545.584] (-545.373) (-543.418) -- 0:00:40
343500 -- (-543.964) [-544.730] (-547.975) (-545.758) * (-544.339) (-545.502) [-542.237] (-542.847) -- 0:00:40
344000 -- (-543.321) [-545.380] (-543.890) (-545.538) * (-546.050) (-544.448) (-547.072) [-545.433] -- 0:00:40
344500 -- (-543.984) (-548.356) (-544.379) [-544.952] * (-542.165) (-547.144) [-545.436] (-547.866) -- 0:00:39
345000 -- (-546.215) (-542.365) [-543.682] (-544.730) * (-544.057) (-547.039) [-544.865] (-542.647) -- 0:00:39
Average standard deviation of split frequencies: 0.019002
345500 -- (-545.006) [-542.966] (-545.285) (-544.922) * (-543.312) [-545.622] (-544.272) (-543.987) -- 0:00:39
346000 -- [-545.785] (-546.830) (-543.356) (-545.570) * (-543.068) [-545.103] (-542.205) (-542.836) -- 0:00:39
346500 -- (-542.697) [-546.128] (-547.034) (-545.261) * (-544.807) (-543.073) [-543.795] (-543.342) -- 0:00:39
347000 -- (-543.587) (-545.425) (-544.894) [-548.009] * (-546.642) [-543.470] (-543.980) (-542.675) -- 0:00:39
347500 -- (-544.369) [-543.359] (-545.868) (-546.635) * (-550.829) (-543.146) [-542.441] (-542.856) -- 0:00:39
348000 -- (-543.440) (-543.561) [-544.091] (-546.344) * (-544.885) [-542.695] (-544.448) (-545.861) -- 0:00:39
348500 -- [-543.400] (-543.829) (-547.992) (-544.534) * (-543.498) (-543.914) (-546.659) [-544.906] -- 0:00:39
349000 -- (-546.665) (-544.549) [-543.093] (-547.686) * (-543.870) [-544.273] (-543.790) (-543.855) -- 0:00:39
349500 -- (-547.892) (-544.994) [-544.423] (-547.664) * (-543.717) [-543.347] (-544.244) (-546.391) -- 0:00:39
350000 -- (-545.048) (-546.337) (-546.039) [-543.994] * (-544.504) (-547.780) [-546.215] (-543.777) -- 0:00:39
Average standard deviation of split frequencies: 0.019599
350500 -- (-547.515) [-545.129] (-546.058) (-547.083) * (-547.847) [-544.274] (-549.551) (-544.404) -- 0:00:38
351000 -- (-546.798) (-542.556) [-545.085] (-544.042) * [-543.444] (-543.814) (-546.489) (-543.507) -- 0:00:38
351500 -- (-542.236) (-542.889) [-543.498] (-544.032) * (-544.785) [-546.058] (-543.712) (-543.358) -- 0:00:38
352000 -- (-542.976) (-542.700) (-542.796) [-543.530] * (-542.472) (-544.136) [-543.371] (-543.044) -- 0:00:38
352500 -- (-545.666) (-543.516) [-543.480] (-543.499) * (-542.842) [-542.415] (-544.368) (-544.251) -- 0:00:40
353000 -- [-543.593] (-542.504) (-543.350) (-543.172) * (-545.753) [-544.938] (-543.361) (-542.285) -- 0:00:40
353500 -- [-543.558] (-543.945) (-545.056) (-547.852) * (-545.076) [-542.607] (-545.054) (-542.079) -- 0:00:40
354000 -- (-543.632) (-543.113) [-544.160] (-546.424) * [-544.858] (-543.437) (-545.775) (-544.281) -- 0:00:40
354500 -- (-546.379) (-546.750) [-545.183] (-550.070) * (-544.180) (-544.122) (-547.466) [-543.829] -- 0:00:40
355000 -- (-542.906) (-544.806) [-544.233] (-542.810) * (-543.621) [-545.706] (-546.858) (-545.385) -- 0:00:39
Average standard deviation of split frequencies: 0.020072
355500 -- (-542.777) (-543.614) [-544.017] (-542.629) * [-542.776] (-543.219) (-549.699) (-544.702) -- 0:00:39
356000 -- (-546.193) (-544.765) [-543.377] (-544.792) * (-543.782) [-548.088] (-544.663) (-546.307) -- 0:00:39
356500 -- (-545.517) (-544.852) (-543.924) [-544.100] * (-544.016) (-545.924) [-543.943] (-545.470) -- 0:00:39
357000 -- (-544.618) (-543.187) (-547.289) [-542.941] * (-545.395) (-545.450) (-550.327) [-544.250] -- 0:00:39
357500 -- (-543.275) (-545.855) (-546.709) [-542.758] * (-547.877) [-542.357] (-543.423) (-546.408) -- 0:00:39
358000 -- (-544.224) (-547.329) [-547.861] (-545.655) * (-544.872) (-544.440) [-543.294] (-544.133) -- 0:00:39
358500 -- (-543.254) (-544.295) [-544.244] (-547.048) * [-542.836] (-542.321) (-550.828) (-547.107) -- 0:00:39
359000 -- (-545.362) [-544.338] (-543.972) (-542.097) * (-542.944) (-544.904) (-545.466) [-544.261] -- 0:00:39
359500 -- (-543.423) [-543.005] (-546.726) (-543.597) * (-546.343) (-544.716) [-544.653] (-545.517) -- 0:00:39
360000 -- (-544.210) [-543.998] (-548.621) (-543.623) * (-545.603) [-543.886] (-545.989) (-547.354) -- 0:00:39
Average standard deviation of split frequencies: 0.020374
360500 -- (-544.516) [-542.198] (-543.669) (-545.635) * (-542.082) [-546.079] (-545.640) (-546.480) -- 0:00:39
361000 -- (-544.152) [-544.980] (-544.309) (-543.907) * (-546.334) [-545.505] (-544.867) (-544.505) -- 0:00:38
361500 -- (-546.857) (-545.234) [-543.257] (-545.231) * (-545.494) (-545.314) [-543.383] (-548.408) -- 0:00:38
362000 -- (-545.593) (-543.292) [-547.313] (-547.651) * (-542.299) (-543.798) [-546.093] (-548.951) -- 0:00:38
362500 -- (-542.433) (-546.153) [-548.139] (-543.770) * (-543.260) [-544.544] (-545.272) (-547.423) -- 0:00:38
363000 -- (-542.571) [-545.690] (-545.151) (-545.028) * (-542.981) [-542.794] (-542.701) (-544.239) -- 0:00:38
363500 -- (-543.914) [-544.657] (-545.527) (-547.381) * [-545.583] (-544.281) (-545.704) (-544.076) -- 0:00:38
364000 -- [-545.058] (-544.988) (-543.609) (-544.673) * (-542.086) (-545.191) (-542.542) [-542.816] -- 0:00:38
364500 -- (-546.429) (-547.281) (-544.201) [-542.535] * (-546.256) (-543.118) [-544.654] (-542.489) -- 0:00:38
365000 -- [-547.002] (-551.417) (-543.868) (-545.113) * (-548.537) (-543.023) [-544.242] (-543.936) -- 0:00:38
Average standard deviation of split frequencies: 0.019248
365500 -- (-543.537) (-546.410) [-544.282] (-544.669) * (-545.621) [-542.215] (-543.330) (-545.884) -- 0:00:38
366000 -- [-543.809] (-545.686) (-542.476) (-545.893) * (-543.445) (-546.751) [-542.799] (-542.991) -- 0:00:38
366500 -- (-544.482) (-544.499) (-545.536) [-543.005] * (-544.857) [-542.124] (-542.884) (-543.905) -- 0:00:38
367000 -- [-544.063] (-544.329) (-542.907) (-543.205) * (-543.566) [-544.320] (-546.717) (-546.693) -- 0:00:37
367500 -- [-544.675] (-549.328) (-549.527) (-544.215) * (-546.757) [-545.160] (-543.132) (-545.080) -- 0:00:37
368000 -- (-545.896) (-546.027) [-543.789] (-548.488) * (-544.717) (-543.609) (-544.786) [-543.289] -- 0:00:37
368500 -- (-546.789) (-545.579) [-545.561] (-545.783) * (-542.442) (-544.440) [-544.034] (-545.011) -- 0:00:37
369000 -- [-545.940] (-543.074) (-542.750) (-545.661) * (-544.664) [-543.910] (-545.251) (-543.760) -- 0:00:37
369500 -- (-543.447) (-543.017) (-542.974) [-543.558] * (-545.035) (-546.085) [-545.336] (-543.750) -- 0:00:39
370000 -- (-542.757) (-544.845) [-543.005] (-546.022) * (-544.080) (-544.828) (-542.950) [-543.551] -- 0:00:39
Average standard deviation of split frequencies: 0.019226
370500 -- (-546.340) (-546.389) [-543.839] (-543.993) * (-545.160) [-544.274] (-544.810) (-542.322) -- 0:00:39
371000 -- [-543.477] (-548.429) (-542.879) (-542.998) * (-545.149) (-542.841) (-544.795) [-545.417] -- 0:00:38
371500 -- (-542.373) (-543.017) [-546.355] (-545.459) * [-544.318] (-544.900) (-542.515) (-544.912) -- 0:00:38
372000 -- (-545.642) (-545.680) (-546.316) [-545.743] * (-542.928) (-544.178) (-544.423) [-543.510] -- 0:00:38
372500 -- (-544.876) (-543.496) [-542.091] (-545.516) * (-544.025) [-544.199] (-543.467) (-543.565) -- 0:00:38
373000 -- (-545.539) [-544.160] (-545.351) (-546.918) * (-544.579) [-542.937] (-544.290) (-548.191) -- 0:00:38
373500 -- (-545.552) (-544.417) (-542.939) [-543.257] * [-545.036] (-543.859) (-549.349) (-544.824) -- 0:00:38
374000 -- (-546.130) (-546.168) (-543.313) [-544.658] * (-545.526) (-545.403) (-546.494) [-542.734] -- 0:00:38
374500 -- [-545.055] (-548.263) (-543.357) (-546.276) * [-543.396] (-546.629) (-545.891) (-545.608) -- 0:00:38
375000 -- [-547.877] (-544.221) (-543.472) (-544.013) * (-547.839) (-549.574) (-548.200) [-545.287] -- 0:00:38
Average standard deviation of split frequencies: 0.018527
375500 -- (-544.278) (-545.049) [-542.393] (-544.502) * (-553.487) (-545.273) [-546.489] (-544.184) -- 0:00:38
376000 -- (-543.541) (-544.413) [-543.798] (-545.910) * (-547.916) (-543.404) (-545.683) [-544.273] -- 0:00:38
376500 -- (-545.046) (-545.054) [-542.441] (-546.117) * (-544.192) [-542.990] (-546.070) (-544.964) -- 0:00:38
377000 -- (-545.419) [-543.352] (-544.299) (-543.420) * (-544.404) (-543.245) (-542.385) [-543.772] -- 0:00:38
377500 -- (-543.953) (-543.615) (-543.245) [-543.375] * (-543.084) (-543.889) (-544.518) [-543.690] -- 0:00:37
378000 -- (-544.347) (-543.633) (-542.722) [-542.586] * (-543.845) (-549.226) (-544.729) [-543.409] -- 0:00:37
378500 -- (-544.893) (-543.230) [-542.862] (-546.266) * (-545.294) [-542.358] (-544.093) (-544.579) -- 0:00:37
379000 -- (-543.661) [-545.795] (-544.985) (-545.606) * (-548.503) (-545.080) (-544.426) [-545.078] -- 0:00:37
379500 -- (-545.275) (-544.529) (-545.126) [-542.344] * (-542.569) [-546.492] (-543.938) (-549.300) -- 0:00:37
380000 -- [-542.697] (-543.924) (-552.336) (-544.214) * (-544.933) (-546.827) [-543.255] (-542.743) -- 0:00:37
Average standard deviation of split frequencies: 0.018284
380500 -- (-544.206) (-546.662) [-547.903] (-542.103) * (-544.247) [-544.431] (-544.307) (-542.606) -- 0:00:37
381000 -- [-545.016] (-545.175) (-547.209) (-542.557) * [-544.110] (-546.143) (-545.586) (-543.366) -- 0:00:37
381500 -- [-543.496] (-544.640) (-543.502) (-542.560) * (-542.857) (-546.826) [-545.255] (-546.044) -- 0:00:37
382000 -- (-543.865) [-545.154] (-543.395) (-545.145) * (-543.860) (-543.551) [-545.354] (-546.526) -- 0:00:37
382500 -- (-544.364) (-547.370) (-547.543) [-542.649] * (-542.450) [-544.727] (-547.916) (-543.397) -- 0:00:37
383000 -- (-543.465) [-543.953] (-545.267) (-545.693) * (-544.679) (-543.878) [-543.486] (-542.841) -- 0:00:37
383500 -- [-546.150] (-544.240) (-544.477) (-543.702) * (-543.461) (-544.077) (-546.058) [-542.692] -- 0:00:36
384000 -- (-545.060) (-545.561) (-543.402) [-543.302] * (-545.565) [-543.403] (-543.951) (-542.659) -- 0:00:36
384500 -- (-543.543) [-543.628] (-542.975) (-545.233) * (-546.631) [-544.527] (-543.788) (-543.183) -- 0:00:36
385000 -- [-545.510] (-543.525) (-546.493) (-543.764) * (-545.655) [-545.392] (-544.102) (-543.237) -- 0:00:36
Average standard deviation of split frequencies: 0.017708
385500 -- (-542.429) (-545.125) (-544.333) [-543.743] * (-547.239) (-544.570) [-544.651] (-546.844) -- 0:00:36
386000 -- (-542.476) (-544.486) (-544.605) [-543.241] * (-544.462) [-545.176] (-548.666) (-544.251) -- 0:00:36
386500 -- (-544.478) (-543.525) [-545.427] (-543.399) * (-549.249) (-543.831) [-545.022] (-548.771) -- 0:00:38
387000 -- (-547.715) (-542.888) [-542.725] (-544.025) * (-549.825) (-545.404) (-543.707) [-545.783] -- 0:00:38
387500 -- (-546.699) (-542.924) (-543.340) [-549.769] * [-544.451] (-545.076) (-546.539) (-543.457) -- 0:00:37
388000 -- (-541.978) [-543.054] (-544.448) (-550.828) * (-544.397) (-544.284) [-542.891] (-544.307) -- 0:00:37
388500 -- (-542.784) (-545.793) [-545.418] (-547.030) * (-545.765) (-546.623) (-544.615) [-546.573] -- 0:00:37
389000 -- (-542.667) [-544.948] (-544.600) (-544.655) * (-544.597) [-544.173] (-543.684) (-547.129) -- 0:00:37
389500 -- [-542.452] (-544.590) (-542.429) (-545.712) * [-546.445] (-550.284) (-543.564) (-544.638) -- 0:00:37
390000 -- (-543.465) (-543.791) [-542.174] (-543.920) * (-545.220) (-546.532) [-543.785] (-543.105) -- 0:00:37
Average standard deviation of split frequencies: 0.017161
390500 -- (-544.454) (-545.591) (-546.978) [-542.758] * (-542.394) (-544.521) (-542.394) [-544.028] -- 0:00:37
391000 -- (-546.454) (-545.001) (-545.398) [-544.207] * (-547.739) (-543.418) [-543.684] (-548.132) -- 0:00:37
391500 -- (-545.753) (-544.414) (-545.942) [-543.205] * (-544.465) (-543.209) [-544.930] (-547.516) -- 0:00:37
392000 -- [-543.502] (-545.131) (-543.777) (-545.010) * (-542.536) (-545.780) [-544.514] (-544.735) -- 0:00:37
392500 -- (-544.219) [-544.530] (-546.897) (-546.967) * (-544.998) (-545.762) (-549.397) [-545.902] -- 0:00:37
393000 -- (-543.786) (-542.797) (-544.723) [-544.968] * (-546.705) (-544.516) (-547.289) [-545.524] -- 0:00:37
393500 -- (-544.224) (-543.195) [-542.480] (-545.653) * (-542.409) [-543.760] (-546.776) (-544.454) -- 0:00:36
394000 -- (-544.472) (-545.275) [-543.787] (-544.429) * (-543.610) (-543.840) (-545.141) [-546.485] -- 0:00:36
394500 -- (-546.338) [-545.384] (-544.101) (-545.660) * (-542.534) (-543.068) [-545.819] (-546.095) -- 0:00:36
395000 -- (-546.973) (-544.947) [-542.579] (-542.843) * (-542.259) (-546.537) [-545.518] (-544.981) -- 0:00:36
Average standard deviation of split frequencies: 0.016666
395500 -- (-543.737) [-543.623] (-546.607) (-543.894) * (-543.104) (-543.384) [-544.060] (-542.456) -- 0:00:36
396000 -- (-542.945) (-550.169) (-544.623) [-542.790] * (-546.213) (-543.880) (-547.835) [-544.125] -- 0:00:36
396500 -- (-544.931) [-543.094] (-546.377) (-544.240) * [-547.872] (-546.097) (-547.091) (-543.320) -- 0:00:36
397000 -- (-546.263) [-543.880] (-542.793) (-542.678) * [-547.901] (-546.871) (-543.331) (-545.111) -- 0:00:36
397500 -- (-542.970) (-545.101) (-543.883) [-545.850] * (-548.331) (-544.439) (-543.939) [-546.207] -- 0:00:36
398000 -- [-543.586] (-544.916) (-544.582) (-549.214) * [-544.350] (-545.259) (-548.727) (-546.805) -- 0:00:36
398500 -- (-544.365) (-543.054) (-542.549) [-543.149] * (-545.763) (-543.075) (-544.258) [-543.667] -- 0:00:36
399000 -- (-542.418) (-543.185) [-544.654] (-546.507) * [-545.173] (-542.960) (-545.378) (-544.662) -- 0:00:36
399500 -- (-545.535) (-543.572) (-551.522) [-545.392] * (-545.633) (-543.358) [-549.512] (-545.261) -- 0:00:36
400000 -- [-543.532] (-543.804) (-544.118) (-544.017) * [-542.789] (-543.122) (-545.966) (-545.956) -- 0:00:36
Average standard deviation of split frequencies: 0.016333
400500 -- (-545.231) [-544.663] (-543.634) (-550.378) * (-544.775) (-542.271) [-545.104] (-544.710) -- 0:00:35
401000 -- (-542.954) [-543.699] (-545.224) (-545.218) * (-543.947) (-542.751) (-542.316) [-543.370] -- 0:00:35
401500 -- (-543.455) (-544.582) [-543.973] (-543.783) * (-545.279) (-544.280) [-543.739] (-544.415) -- 0:00:35
402000 -- (-547.530) (-544.607) (-545.573) [-545.642] * (-542.121) (-543.655) [-544.657] (-542.917) -- 0:00:35
402500 -- (-544.352) [-543.419] (-544.898) (-546.263) * (-543.123) [-543.328] (-544.396) (-543.216) -- 0:00:35
403000 -- (-542.224) (-545.930) (-545.672) [-543.698] * [-543.121] (-548.821) (-545.146) (-544.801) -- 0:00:37
403500 -- (-545.997) (-547.076) (-548.389) [-543.828] * (-543.159) [-547.100] (-546.463) (-543.304) -- 0:00:36
404000 -- (-546.155) (-543.695) [-544.611] (-546.323) * (-543.302) (-543.517) [-544.126] (-545.450) -- 0:00:36
404500 -- (-546.842) [-546.674] (-543.851) (-546.872) * [-545.941] (-543.455) (-544.668) (-543.342) -- 0:00:36
405000 -- (-543.753) (-544.536) [-542.831] (-543.446) * (-545.739) (-542.617) (-544.721) [-544.690] -- 0:00:36
Average standard deviation of split frequencies: 0.015982
405500 -- (-547.970) (-550.422) [-543.397] (-543.706) * (-542.556) [-542.869] (-542.947) (-546.715) -- 0:00:36
406000 -- [-545.456] (-543.461) (-544.275) (-542.299) * (-542.698) (-544.826) (-546.421) [-546.049] -- 0:00:36
406500 -- (-550.133) (-545.199) [-542.472] (-543.871) * (-543.141) (-545.002) (-550.281) [-544.960] -- 0:00:36
407000 -- [-543.217] (-543.342) (-543.266) (-542.669) * [-547.072] (-553.029) (-543.427) (-546.831) -- 0:00:36
407500 -- (-543.998) [-545.298] (-545.654) (-542.606) * [-546.421] (-549.545) (-545.693) (-544.055) -- 0:00:36
408000 -- (-544.636) (-544.718) [-543.338] (-543.050) * (-543.740) (-544.566) [-545.141] (-543.240) -- 0:00:36
408500 -- (-544.376) [-544.138] (-545.530) (-542.903) * [-543.721] (-543.872) (-545.272) (-544.291) -- 0:00:36
409000 -- (-543.655) (-544.332) [-542.445] (-542.668) * (-545.710) (-546.141) [-544.487] (-543.876) -- 0:00:36
409500 -- [-547.891] (-542.403) (-544.105) (-548.484) * (-543.043) (-544.163) (-542.974) [-546.816] -- 0:00:36
410000 -- (-548.090) [-542.342] (-543.797) (-542.677) * (-542.772) [-545.781] (-545.451) (-542.917) -- 0:00:35
Average standard deviation of split frequencies: 0.015463
410500 -- (-545.799) (-544.024) (-542.934) [-545.031] * [-544.549] (-546.686) (-545.138) (-546.150) -- 0:00:35
411000 -- (-543.313) (-546.337) [-543.969] (-543.406) * [-542.993] (-543.622) (-546.491) (-546.084) -- 0:00:35
411500 -- (-542.946) [-548.890] (-546.333) (-547.134) * (-542.694) [-543.212] (-549.973) (-542.807) -- 0:00:35
412000 -- (-544.622) [-542.395] (-544.033) (-543.383) * (-543.640) [-543.212] (-544.299) (-543.001) -- 0:00:35
412500 -- (-544.474) [-543.161] (-543.431) (-550.428) * (-547.880) (-543.468) (-545.292) [-544.221] -- 0:00:35
413000 -- [-544.836] (-547.504) (-544.578) (-545.405) * (-542.661) (-545.000) [-544.201] (-542.323) -- 0:00:35
413500 -- (-547.557) (-545.109) (-542.957) [-545.900] * [-544.248] (-547.695) (-543.452) (-543.199) -- 0:00:35
414000 -- [-545.399] (-544.600) (-544.048) (-545.977) * (-544.688) (-544.308) [-547.078] (-542.479) -- 0:00:35
414500 -- [-543.583] (-545.960) (-542.970) (-542.881) * (-545.756) (-542.624) (-542.931) [-545.316] -- 0:00:35
415000 -- (-543.877) [-544.763] (-543.264) (-544.434) * (-545.580) (-551.210) (-544.164) [-544.106] -- 0:00:35
Average standard deviation of split frequencies: 0.014398
415500 -- (-547.039) [-544.094] (-545.926) (-544.830) * (-546.416) (-542.498) (-545.461) [-544.300] -- 0:00:35
416000 -- [-546.736] (-543.376) (-546.433) (-543.524) * [-544.719] (-544.568) (-545.456) (-544.927) -- 0:00:35
416500 -- [-543.236] (-545.563) (-548.903) (-544.438) * [-543.612] (-545.083) (-546.589) (-546.718) -- 0:00:35
417000 -- [-546.656] (-545.522) (-546.933) (-544.384) * (-544.055) (-543.746) [-546.504] (-545.875) -- 0:00:34
417500 -- (-549.603) (-547.435) [-545.629] (-545.141) * (-544.714) [-545.215] (-543.408) (-543.099) -- 0:00:34
418000 -- [-547.271] (-545.257) (-544.646) (-547.630) * (-543.393) (-544.681) [-543.533] (-543.446) -- 0:00:34
418500 -- (-542.366) (-544.322) (-544.280) [-544.396] * (-543.267) (-544.597) (-546.894) [-544.124] -- 0:00:34
419000 -- (-542.921) (-543.245) [-548.189] (-544.893) * (-543.544) [-542.715] (-545.854) (-544.594) -- 0:00:36
419500 -- (-543.365) [-542.617] (-545.786) (-545.266) * (-545.997) (-543.512) [-543.563] (-548.445) -- 0:00:35
420000 -- (-542.681) (-549.508) [-543.423] (-544.494) * (-544.397) [-543.398] (-544.442) (-544.819) -- 0:00:35
Average standard deviation of split frequencies: 0.013975
420500 -- [-543.029] (-548.307) (-546.539) (-546.439) * [-544.515] (-544.239) (-542.681) (-543.598) -- 0:00:35
421000 -- [-544.224] (-543.321) (-547.179) (-544.469) * (-547.550) [-543.638] (-543.155) (-545.751) -- 0:00:35
421500 -- [-545.666] (-543.618) (-544.855) (-543.784) * (-543.244) [-544.914] (-543.987) (-544.885) -- 0:00:35
422000 -- [-545.537] (-543.668) (-550.445) (-543.582) * (-544.486) [-544.908] (-545.034) (-544.005) -- 0:00:35
422500 -- (-544.352) (-548.808) (-543.646) [-543.803] * (-542.926) (-545.765) (-545.130) [-547.166] -- 0:00:35
423000 -- (-543.906) [-545.137] (-543.273) (-543.112) * (-545.324) (-550.280) (-544.216) [-543.022] -- 0:00:35
423500 -- [-544.633] (-542.668) (-546.991) (-547.652) * (-546.191) (-558.697) [-542.705] (-542.796) -- 0:00:35
424000 -- (-545.599) (-546.590) [-544.679] (-542.635) * (-544.549) (-554.902) [-546.405] (-546.950) -- 0:00:35
424500 -- (-547.227) (-542.757) [-543.414] (-543.357) * (-543.258) [-543.082] (-546.396) (-544.268) -- 0:00:35
425000 -- [-543.350] (-543.303) (-542.397) (-542.825) * (-543.174) [-544.645] (-544.452) (-543.690) -- 0:00:35
Average standard deviation of split frequencies: 0.013033
425500 -- [-543.770] (-546.506) (-542.585) (-544.280) * (-544.288) (-544.439) [-542.553] (-545.612) -- 0:00:35
426000 -- (-544.861) [-543.197] (-546.434) (-545.023) * (-545.266) (-544.932) (-543.874) [-544.995] -- 0:00:35
426500 -- (-546.742) [-542.510] (-549.684) (-544.325) * (-548.798) (-546.703) (-543.314) [-546.233] -- 0:00:34
427000 -- (-543.335) (-543.921) (-547.243) [-543.614] * (-543.199) [-543.600] (-543.545) (-542.644) -- 0:00:34
427500 -- (-547.893) (-544.045) (-543.388) [-544.590] * [-542.552] (-544.350) (-545.379) (-545.349) -- 0:00:34
428000 -- (-548.032) (-545.845) [-544.042] (-545.086) * [-542.531] (-545.120) (-544.761) (-544.020) -- 0:00:34
428500 -- (-551.861) [-545.435] (-551.438) (-544.137) * (-543.083) (-543.583) [-543.711] (-546.061) -- 0:00:34
429000 -- [-544.421] (-545.677) (-544.679) (-544.232) * (-544.112) (-543.654) [-543.770] (-546.110) -- 0:00:34
429500 -- (-543.782) (-544.052) [-542.609] (-546.255) * (-545.574) (-542.874) (-543.709) [-543.870] -- 0:00:34
430000 -- [-542.762] (-545.487) (-543.702) (-545.749) * [-542.858] (-544.534) (-544.531) (-544.155) -- 0:00:34
Average standard deviation of split frequencies: 0.014230
430500 -- [-544.614] (-547.565) (-543.160) (-546.419) * [-544.229] (-544.779) (-542.720) (-546.268) -- 0:00:34
431000 -- (-547.211) (-547.304) (-545.090) [-542.679] * (-543.959) (-543.832) [-544.703] (-547.024) -- 0:00:34
431500 -- (-542.757) (-542.909) (-547.753) [-542.824] * (-544.925) (-542.502) (-550.023) [-543.434] -- 0:00:34
432000 -- (-544.036) (-543.232) (-548.988) [-542.751] * (-544.961) (-547.411) (-543.881) [-542.577] -- 0:00:34
432500 -- [-544.036] (-543.297) (-544.271) (-544.542) * (-547.632) (-546.293) (-544.809) [-544.041] -- 0:00:34
433000 -- (-544.705) (-543.501) (-548.840) [-544.466] * (-546.239) (-547.233) (-546.249) [-545.014] -- 0:00:34
433500 -- (-549.023) (-547.736) [-545.179] (-543.461) * [-545.197] (-548.842) (-542.340) (-547.708) -- 0:00:33
434000 -- [-543.338] (-547.358) (-543.096) (-543.170) * (-545.498) [-544.425] (-543.580) (-542.821) -- 0:00:33
434500 -- (-543.610) (-542.981) (-544.592) [-545.787] * (-546.124) [-546.493] (-545.033) (-542.763) -- 0:00:33
435000 -- (-545.803) [-542.669] (-545.115) (-545.262) * (-543.541) (-545.442) (-543.786) [-543.006] -- 0:00:33
Average standard deviation of split frequencies: 0.013738
435500 -- [-543.143] (-545.621) (-545.339) (-542.436) * (-543.531) (-544.174) [-546.147] (-544.776) -- 0:00:34
436000 -- (-544.530) (-546.461) (-545.259) [-542.641] * (-546.192) (-543.908) [-548.093] (-544.241) -- 0:00:34
436500 -- (-544.263) (-543.430) (-542.926) [-543.363] * [-545.191] (-545.106) (-544.416) (-544.200) -- 0:00:34
437000 -- (-542.689) (-544.361) (-543.397) [-543.127] * (-544.719) (-550.774) (-542.890) [-543.768] -- 0:00:34
437500 -- [-544.550] (-549.126) (-544.318) (-542.975) * [-543.237] (-545.874) (-544.071) (-544.875) -- 0:00:34
438000 -- (-545.154) (-543.038) [-544.592] (-544.764) * (-543.375) [-543.424] (-547.393) (-552.891) -- 0:00:34
438500 -- (-542.747) [-542.660] (-546.043) (-545.191) * (-543.418) (-546.625) [-545.725] (-543.297) -- 0:00:34
439000 -- (-542.089) (-543.447) [-544.324] (-544.318) * (-544.686) (-543.909) (-547.947) [-543.908] -- 0:00:34
439500 -- [-542.751] (-544.024) (-545.636) (-543.835) * (-545.885) [-544.141] (-546.332) (-543.365) -- 0:00:34
440000 -- (-544.125) (-542.280) [-545.077] (-543.481) * (-545.559) (-543.710) (-544.157) [-547.053] -- 0:00:34
Average standard deviation of split frequencies: 0.013655
440500 -- [-545.038] (-543.725) (-544.838) (-545.285) * (-543.947) (-546.995) [-543.554] (-547.535) -- 0:00:34
441000 -- [-543.670] (-544.065) (-547.606) (-546.788) * (-544.150) (-543.839) (-547.761) [-542.356] -- 0:00:34
441500 -- (-543.942) (-544.662) (-547.948) [-542.444] * (-545.411) [-542.234] (-544.167) (-543.477) -- 0:00:34
442000 -- [-544.047] (-543.886) (-545.629) (-543.348) * (-544.954) [-544.520] (-543.262) (-544.239) -- 0:00:34
442500 -- [-542.648] (-551.552) (-545.644) (-546.111) * (-547.084) [-546.664] (-542.690) (-545.692) -- 0:00:34
443000 -- [-543.025] (-545.926) (-544.421) (-543.241) * (-543.771) (-546.722) [-544.552] (-549.909) -- 0:00:33
443500 -- (-543.798) [-547.122] (-543.258) (-543.318) * (-543.712) (-543.750) [-543.987] (-549.891) -- 0:00:33
444000 -- (-542.663) (-543.344) [-545.054] (-542.779) * (-544.512) [-543.322] (-546.727) (-543.677) -- 0:00:33
444500 -- (-547.085) [-545.717] (-542.832) (-543.125) * (-544.967) [-544.817] (-544.405) (-553.007) -- 0:00:33
445000 -- (-545.071) [-547.454] (-544.353) (-544.298) * (-545.595) (-544.107) [-543.520] (-552.555) -- 0:00:33
Average standard deviation of split frequencies: 0.013430
445500 -- (-542.874) [-544.363] (-542.617) (-545.643) * (-555.060) (-545.129) (-546.925) [-549.758] -- 0:00:33
446000 -- (-542.881) (-547.987) [-543.879] (-544.420) * (-544.065) (-545.402) [-546.279] (-549.146) -- 0:00:33
446500 -- [-543.665] (-544.580) (-544.024) (-546.282) * (-545.643) (-544.492) [-543.156] (-544.675) -- 0:00:33
447000 -- [-544.281] (-544.662) (-543.651) (-542.738) * (-551.167) [-546.609] (-543.556) (-542.353) -- 0:00:33
447500 -- (-543.217) [-543.187] (-543.435) (-547.867) * (-547.487) (-547.008) (-546.046) [-543.973] -- 0:00:33
448000 -- [-544.947] (-545.328) (-547.975) (-544.534) * (-549.782) [-545.800] (-544.633) (-545.705) -- 0:00:33
448500 -- (-546.726) (-551.172) [-545.096] (-545.673) * (-546.411) (-542.512) (-543.248) [-545.978] -- 0:00:33
449000 -- [-545.433] (-545.976) (-544.157) (-543.905) * (-546.600) (-542.484) [-544.529] (-545.154) -- 0:00:33
449500 -- (-544.146) [-546.310] (-544.613) (-547.453) * (-546.015) (-542.881) [-542.705] (-542.455) -- 0:00:33
450000 -- (-543.420) (-545.928) [-542.340] (-546.439) * (-545.275) [-544.804] (-544.455) (-546.705) -- 0:00:34
Average standard deviation of split frequencies: 0.013844
450500 -- (-546.237) (-542.997) (-544.460) [-546.182] * [-543.573] (-545.612) (-544.157) (-547.559) -- 0:00:34
451000 -- (-543.679) (-546.035) [-545.619] (-547.115) * [-544.500] (-550.389) (-545.662) (-547.899) -- 0:00:34
451500 -- [-545.073] (-545.189) (-545.565) (-544.083) * (-545.352) (-547.168) (-543.759) [-544.766] -- 0:00:34
452000 -- (-546.511) (-544.961) [-543.603] (-546.760) * [-546.348] (-546.074) (-547.480) (-545.890) -- 0:00:33
452500 -- (-542.770) [-544.459] (-546.481) (-543.545) * [-549.071] (-542.514) (-549.169) (-542.932) -- 0:00:33
453000 -- (-543.866) [-542.743] (-543.797) (-543.558) * (-543.795) (-543.091) [-542.682] (-545.687) -- 0:00:33
453500 -- (-543.946) (-544.606) [-544.915] (-546.015) * (-544.943) [-543.722] (-544.028) (-545.016) -- 0:00:33
454000 -- (-545.022) (-545.413) (-545.143) [-544.767] * [-544.725] (-543.894) (-543.452) (-543.049) -- 0:00:33
454500 -- (-549.024) (-542.328) (-544.360) [-544.991] * [-542.713] (-544.804) (-547.080) (-545.633) -- 0:00:33
455000 -- (-545.846) [-543.113] (-545.758) (-545.214) * [-545.526] (-542.603) (-544.402) (-544.592) -- 0:00:33
Average standard deviation of split frequencies: 0.013318
455500 -- (-545.699) (-543.620) [-546.236] (-544.995) * (-544.940) (-544.198) (-543.270) [-544.201] -- 0:00:33
456000 -- [-544.545] (-542.673) (-545.571) (-543.326) * (-547.982) (-543.783) [-546.418] (-543.756) -- 0:00:33
456500 -- (-546.869) [-543.821] (-543.929) (-545.968) * (-545.479) [-543.209] (-544.636) (-544.519) -- 0:00:33
457000 -- (-545.962) [-543.036] (-544.522) (-542.482) * [-546.806] (-548.074) (-543.722) (-544.988) -- 0:00:33
457500 -- (-549.761) (-545.308) (-545.457) [-542.609] * (-548.695) (-544.199) (-543.539) [-548.702] -- 0:00:33
458000 -- (-545.430) (-542.965) (-544.325) [-545.127] * (-553.687) (-545.141) (-543.691) [-542.780] -- 0:00:33
458500 -- (-545.976) [-542.270] (-543.292) (-543.062) * (-546.249) (-543.592) (-549.462) [-544.577] -- 0:00:33
459000 -- (-544.762) (-544.792) [-547.833] (-543.887) * (-544.338) [-544.380] (-544.519) (-545.824) -- 0:00:33
459500 -- (-546.226) (-547.280) (-546.533) [-546.752] * (-550.039) (-543.513) [-543.897] (-546.789) -- 0:00:32
460000 -- (-543.689) (-548.339) [-544.186] (-543.612) * (-550.140) [-545.092] (-544.673) (-546.968) -- 0:00:32
Average standard deviation of split frequencies: 0.013363
460500 -- (-543.708) (-544.838) [-543.549] (-544.791) * [-544.088] (-544.224) (-544.630) (-545.520) -- 0:00:32
461000 -- (-543.500) (-545.934) (-543.903) [-542.789] * (-547.252) [-542.535] (-544.033) (-545.903) -- 0:00:32
461500 -- [-543.510] (-544.447) (-543.006) (-543.983) * (-545.774) (-544.024) [-542.541] (-543.389) -- 0:00:32
462000 -- (-542.253) (-543.447) (-543.363) [-543.563] * (-542.219) (-548.445) (-545.037) [-545.098] -- 0:00:32
462500 -- [-543.972] (-549.420) (-543.966) (-546.127) * (-542.563) [-546.379] (-542.580) (-543.218) -- 0:00:32
463000 -- [-542.847] (-545.838) (-548.621) (-542.164) * [-543.062] (-544.770) (-543.870) (-546.302) -- 0:00:32
463500 -- [-545.213] (-546.925) (-551.130) (-542.169) * (-544.394) [-542.475] (-544.195) (-543.683) -- 0:00:32
464000 -- (-546.093) (-545.720) [-544.542] (-542.715) * (-546.659) (-546.404) [-545.746] (-545.513) -- 0:00:32
464500 -- (-544.338) [-546.383] (-545.531) (-546.714) * [-546.582] (-543.221) (-543.525) (-543.379) -- 0:00:32
465000 -- (-542.603) [-545.476] (-544.302) (-545.108) * (-543.649) [-543.597] (-542.919) (-547.205) -- 0:00:32
Average standard deviation of split frequencies: 0.013210
465500 -- (-544.121) (-545.464) [-546.502] (-544.910) * [-545.950] (-545.652) (-542.840) (-549.293) -- 0:00:33
466000 -- [-543.532] (-545.039) (-544.595) (-543.975) * (-543.957) (-544.068) [-542.332] (-544.414) -- 0:00:33
466500 -- (-543.092) (-544.083) (-545.093) [-544.204] * (-544.982) [-544.198] (-544.010) (-545.343) -- 0:00:33
467000 -- [-542.840] (-544.353) (-547.603) (-544.730) * (-543.894) [-545.303] (-544.015) (-542.322) -- 0:00:33
467500 -- (-544.394) (-546.131) (-545.027) [-542.811] * [-544.981] (-544.727) (-543.081) (-546.249) -- 0:00:33
468000 -- (-544.502) [-542.912] (-548.883) (-545.823) * (-545.976) [-543.822] (-542.951) (-546.129) -- 0:00:32
468500 -- [-543.063] (-543.161) (-543.707) (-547.105) * (-548.291) (-543.988) (-545.799) [-543.576] -- 0:00:32
469000 -- (-543.890) (-542.590) [-545.487] (-545.465) * (-548.262) [-546.508] (-544.692) (-545.287) -- 0:00:32
469500 -- [-546.336] (-544.525) (-543.398) (-545.753) * [-543.462] (-546.947) (-544.735) (-543.684) -- 0:00:32
470000 -- [-545.148] (-550.553) (-542.867) (-543.113) * [-544.175] (-544.037) (-545.854) (-544.693) -- 0:00:32
Average standard deviation of split frequencies: 0.013079
470500 -- (-547.982) (-545.671) (-544.649) [-542.272] * (-542.728) [-545.726] (-544.729) (-545.393) -- 0:00:32
471000 -- (-548.217) (-547.209) (-544.367) [-542.361] * (-543.445) (-545.900) [-545.319] (-543.388) -- 0:00:32
471500 -- (-545.891) (-545.060) (-544.291) [-545.541] * (-544.634) (-545.497) [-545.444] (-545.523) -- 0:00:32
472000 -- (-545.810) (-543.031) (-543.711) [-543.847] * [-542.441] (-545.277) (-544.340) (-544.152) -- 0:00:32
472500 -- [-545.726] (-544.173) (-545.478) (-548.144) * [-543.298] (-546.072) (-545.219) (-547.763) -- 0:00:32
473000 -- (-544.375) (-545.079) [-544.726] (-544.613) * (-547.053) (-544.011) (-542.843) [-544.301] -- 0:00:32
473500 -- [-542.697] (-544.738) (-544.714) (-543.819) * [-544.155] (-552.280) (-546.155) (-544.077) -- 0:00:32
474000 -- [-544.432] (-545.352) (-546.811) (-546.749) * (-544.341) (-546.710) (-546.848) [-544.119] -- 0:00:32
474500 -- (-545.200) [-546.592] (-545.890) (-542.421) * (-545.962) (-551.559) (-544.540) [-544.473] -- 0:00:32
475000 -- (-545.281) (-546.820) [-546.932] (-543.086) * (-543.930) (-548.359) [-545.126] (-546.380) -- 0:00:32
Average standard deviation of split frequencies: 0.013260
475500 -- (-546.784) (-543.685) [-543.189] (-546.421) * (-543.299) (-542.942) (-544.637) [-545.448] -- 0:00:31
476000 -- [-546.332] (-548.089) (-543.236) (-543.300) * (-543.054) (-545.199) (-544.471) [-543.130] -- 0:00:31
476500 -- [-543.682] (-544.417) (-543.858) (-544.442) * (-544.618) [-543.456] (-545.127) (-544.803) -- 0:00:31
477000 -- [-546.873] (-543.755) (-543.379) (-543.691) * (-545.053) (-542.088) (-546.675) [-546.754] -- 0:00:31
477500 -- [-544.970] (-548.149) (-542.910) (-543.601) * (-544.218) (-542.203) (-544.621) [-542.731] -- 0:00:31
478000 -- (-549.159) (-544.197) (-543.099) [-543.425] * (-544.705) [-543.206] (-542.895) (-548.379) -- 0:00:31
478500 -- [-546.684] (-543.401) (-543.001) (-542.465) * (-546.460) (-544.252) (-545.494) [-542.359] -- 0:00:31
479000 -- (-544.724) [-544.556] (-543.094) (-546.053) * (-543.368) [-544.868] (-542.344) (-542.673) -- 0:00:31
479500 -- (-544.255) (-544.203) (-547.162) [-543.090] * (-543.126) (-547.031) (-546.011) [-545.792] -- 0:00:32
480000 -- (-543.210) (-544.903) (-542.491) [-542.376] * (-543.739) (-543.562) (-543.393) [-543.316] -- 0:00:32
Average standard deviation of split frequencies: 0.012423
480500 -- (-544.228) (-543.878) [-542.542] (-543.137) * (-545.771) [-543.123] (-546.043) (-548.537) -- 0:00:32
481000 -- (-544.036) (-542.611) [-548.607] (-545.258) * (-542.425) (-547.112) [-543.133] (-544.672) -- 0:00:32
481500 -- (-543.274) (-542.952) [-545.240] (-546.707) * (-548.809) (-544.104) [-546.046] (-544.589) -- 0:00:32
482000 -- (-545.266) (-542.246) (-544.691) [-543.638] * (-543.407) (-544.761) (-547.535) [-545.101] -- 0:00:32
482500 -- [-543.650] (-542.593) (-545.213) (-543.334) * [-543.756] (-548.871) (-544.238) (-543.659) -- 0:00:32
483000 -- (-543.908) (-542.301) (-545.690) [-543.939] * (-547.370) (-545.453) (-543.364) [-545.354] -- 0:00:32
483500 -- (-543.401) (-545.177) (-544.538) [-545.385] * (-543.390) (-544.564) [-543.222] (-546.442) -- 0:00:32
484000 -- (-545.236) [-545.990] (-543.051) (-544.476) * (-543.849) [-545.872] (-543.680) (-548.665) -- 0:00:31
484500 -- (-542.771) (-551.700) [-545.755] (-543.866) * [-543.339] (-546.214) (-543.690) (-543.878) -- 0:00:31
485000 -- (-544.580) (-544.679) (-542.518) [-543.866] * (-543.261) [-545.307] (-544.381) (-544.045) -- 0:00:31
Average standard deviation of split frequencies: 0.011747
485500 -- (-544.490) [-544.333] (-543.078) (-542.984) * (-544.094) (-550.663) (-542.544) [-544.743] -- 0:00:31
486000 -- (-549.789) (-545.794) (-545.136) [-543.566] * (-544.935) (-548.806) [-543.055] (-543.268) -- 0:00:31
486500 -- (-544.015) [-544.619] (-545.248) (-542.266) * (-543.410) [-543.443] (-542.972) (-545.218) -- 0:00:31
487000 -- (-546.072) (-543.522) (-548.121) [-543.949] * (-545.866) (-543.970) [-545.587] (-542.440) -- 0:00:31
487500 -- (-544.509) (-546.588) (-546.522) [-544.158] * (-551.368) (-546.108) (-545.407) [-543.884] -- 0:00:31
488000 -- (-543.897) (-545.727) [-545.830] (-544.517) * (-545.896) (-547.931) (-543.486) [-543.108] -- 0:00:31
488500 -- (-543.246) (-542.922) [-543.036] (-542.931) * (-548.243) [-544.354] (-544.410) (-542.745) -- 0:00:31
489000 -- (-543.583) (-544.678) [-547.448] (-549.768) * (-549.711) [-544.504] (-543.708) (-543.645) -- 0:00:31
489500 -- [-544.811] (-544.712) (-543.316) (-546.519) * (-544.636) (-545.026) [-543.337] (-543.745) -- 0:00:31
490000 -- [-544.536] (-548.506) (-542.554) (-545.140) * [-543.044] (-542.950) (-543.679) (-544.557) -- 0:00:31
Average standard deviation of split frequencies: 0.011689
490500 -- (-544.509) (-547.195) (-543.929) [-543.454] * (-543.754) [-542.965] (-546.780) (-542.420) -- 0:00:31
491000 -- [-543.248] (-545.195) (-545.201) (-544.833) * (-543.268) (-543.728) (-545.796) [-543.821] -- 0:00:31
491500 -- (-544.753) (-542.489) [-544.986] (-546.395) * (-543.498) [-544.440] (-546.357) (-547.638) -- 0:00:31
492000 -- (-546.487) [-544.536] (-545.195) (-544.816) * (-547.592) (-550.072) [-543.367] (-543.941) -- 0:00:30
492500 -- (-543.086) (-544.236) [-546.087] (-547.246) * [-546.801] (-544.773) (-546.450) (-542.713) -- 0:00:30
493000 -- [-547.242] (-542.725) (-544.507) (-543.642) * (-543.360) (-545.517) (-543.596) [-543.513] -- 0:00:30
493500 -- (-548.341) [-543.944] (-546.782) (-543.635) * [-542.503] (-546.331) (-544.490) (-543.227) -- 0:00:30
494000 -- [-548.350] (-545.665) (-545.872) (-546.788) * [-543.646] (-545.097) (-544.870) (-543.103) -- 0:00:30
494500 -- [-542.972] (-545.669) (-545.126) (-543.478) * (-543.681) (-547.381) (-547.250) [-546.160] -- 0:00:30
495000 -- [-543.414] (-545.192) (-543.648) (-544.590) * (-546.141) (-545.590) [-545.308] (-548.178) -- 0:00:30
Average standard deviation of split frequencies: 0.011964
495500 -- (-543.477) (-544.477) (-546.032) [-544.914] * (-543.782) [-544.667] (-544.489) (-547.120) -- 0:00:31
496000 -- (-542.470) [-542.586] (-546.353) (-545.270) * (-544.112) (-542.697) [-543.380] (-546.094) -- 0:00:31
496500 -- (-543.808) (-544.416) (-545.708) [-543.643] * (-543.032) (-542.338) [-542.918] (-543.491) -- 0:00:31
497000 -- [-545.855] (-545.953) (-547.110) (-543.453) * [-545.367] (-542.994) (-543.850) (-542.962) -- 0:00:31
497500 -- [-543.356] (-542.224) (-544.724) (-545.978) * (-542.871) [-545.619] (-543.567) (-542.910) -- 0:00:31
498000 -- [-545.678] (-542.424) (-545.709) (-545.660) * (-543.650) [-546.604] (-542.916) (-544.611) -- 0:00:31
498500 -- [-542.826] (-542.914) (-547.097) (-543.375) * [-543.703] (-551.946) (-544.041) (-543.763) -- 0:00:31
499000 -- (-545.902) (-546.386) (-545.875) [-544.246] * (-543.952) [-544.778] (-544.813) (-546.873) -- 0:00:31
499500 -- [-542.731] (-544.930) (-544.621) (-546.559) * (-545.891) (-543.786) (-545.213) [-543.266] -- 0:00:31
500000 -- [-544.484] (-545.297) (-546.933) (-549.061) * (-546.219) [-545.145] (-542.836) (-545.028) -- 0:00:31
Average standard deviation of split frequencies: 0.010856
500500 -- [-544.579] (-544.215) (-545.616) (-552.269) * (-544.779) (-547.969) [-543.560] (-544.299) -- 0:00:30
501000 -- [-548.413] (-548.730) (-544.339) (-553.661) * (-545.025) (-545.238) (-542.756) [-543.755] -- 0:00:30
501500 -- (-544.741) (-546.530) [-545.714] (-544.137) * [-544.554] (-543.836) (-543.837) (-545.814) -- 0:00:30
502000 -- (-543.035) [-546.330] (-543.508) (-543.737) * (-545.116) (-547.752) [-543.770] (-546.434) -- 0:00:30
502500 -- (-544.990) [-542.688] (-545.189) (-543.814) * (-542.372) (-546.939) (-542.752) [-545.169] -- 0:00:30
503000 -- (-542.141) [-545.250] (-542.643) (-543.391) * [-545.880] (-542.173) (-543.957) (-545.917) -- 0:00:30
503500 -- [-542.602] (-544.479) (-545.208) (-543.286) * (-543.890) (-543.861) (-543.992) [-543.544] -- 0:00:30
504000 -- (-544.388) [-542.717] (-544.761) (-544.123) * (-544.759) (-544.209) (-543.553) [-542.707] -- 0:00:30
504500 -- (-548.337) (-550.414) [-544.560] (-542.536) * [-547.600] (-548.367) (-542.591) (-545.056) -- 0:00:30
505000 -- (-546.589) (-545.849) [-544.363] (-543.126) * (-546.991) (-550.504) (-543.809) [-543.714] -- 0:00:30
Average standard deviation of split frequencies: 0.010577
505500 -- [-547.404] (-544.396) (-543.121) (-544.783) * (-544.741) (-542.228) [-542.179] (-543.787) -- 0:00:30
506000 -- [-544.977] (-547.213) (-542.967) (-542.955) * (-543.253) [-543.485] (-545.215) (-543.888) -- 0:00:30
506500 -- (-545.065) (-542.608) [-547.156] (-543.492) * (-544.528) (-543.880) (-544.903) [-547.400] -- 0:00:30
507000 -- (-544.850) (-546.001) (-545.140) [-543.873] * [-545.429] (-549.255) (-544.082) (-545.180) -- 0:00:30
507500 -- [-542.726] (-542.537) (-548.956) (-543.892) * (-542.988) (-544.703) [-542.301] (-543.302) -- 0:00:30
508000 -- (-542.945) (-543.379) [-544.066] (-546.980) * (-542.867) (-543.405) (-542.270) [-544.248] -- 0:00:30
508500 -- (-543.705) [-546.318] (-543.613) (-545.772) * [-543.373] (-542.535) (-545.868) (-543.357) -- 0:00:29
509000 -- (-544.360) (-544.970) [-544.404] (-543.321) * (-544.464) [-545.040] (-546.995) (-543.424) -- 0:00:29
509500 -- (-545.656) [-546.235] (-543.338) (-542.379) * (-544.329) (-543.889) (-546.251) [-544.472] -- 0:00:29
510000 -- (-545.740) (-544.211) (-549.392) [-543.585] * [-544.093] (-543.257) (-547.566) (-546.448) -- 0:00:29
Average standard deviation of split frequencies: 0.011240
510500 -- (-546.901) (-543.798) [-545.990] (-544.619) * (-545.795) [-542.690] (-544.697) (-545.958) -- 0:00:29
511000 -- (-545.080) [-545.044] (-545.596) (-545.141) * (-545.792) (-544.051) (-543.803) [-544.076] -- 0:00:29
511500 -- (-543.822) [-545.842] (-545.715) (-543.482) * (-546.762) (-542.573) (-544.694) [-543.317] -- 0:00:29
512000 -- [-543.672] (-544.832) (-544.667) (-543.874) * (-547.585) [-542.860] (-542.810) (-547.802) -- 0:00:29
512500 -- (-544.113) (-544.426) [-545.000] (-544.459) * (-547.998) (-542.959) (-542.722) [-544.720] -- 0:00:30
513000 -- (-542.894) [-542.896] (-545.147) (-543.703) * (-545.086) (-545.225) (-543.895) [-544.383] -- 0:00:30
513500 -- (-544.472) (-544.534) [-547.057] (-543.511) * (-545.774) (-544.275) [-544.598] (-544.473) -- 0:00:30
514000 -- (-543.758) [-542.544] (-549.019) (-547.238) * (-543.728) [-543.946] (-542.823) (-548.690) -- 0:00:30
514500 -- [-544.213] (-545.480) (-546.738) (-543.011) * [-544.750] (-543.376) (-545.289) (-546.343) -- 0:00:30
515000 -- (-545.964) [-544.614] (-542.480) (-543.656) * (-545.688) [-542.977] (-546.739) (-544.152) -- 0:00:30
Average standard deviation of split frequencies: 0.011232
515500 -- (-546.137) (-544.142) [-543.953] (-542.826) * (-547.850) (-548.006) [-547.307] (-543.020) -- 0:00:30
516000 -- (-542.739) [-545.697] (-544.527) (-543.801) * (-544.354) (-543.121) (-546.003) [-544.592] -- 0:00:30
516500 -- (-544.703) (-548.166) (-544.246) [-543.636] * (-547.785) (-543.497) [-546.946] (-546.814) -- 0:00:29
517000 -- [-545.249] (-545.364) (-543.114) (-545.193) * (-543.958) (-542.308) (-543.895) [-542.998] -- 0:00:29
517500 -- (-544.005) [-543.856] (-543.078) (-544.598) * (-546.271) (-543.748) (-542.687) [-542.576] -- 0:00:29
518000 -- (-545.983) (-542.673) [-543.506] (-543.619) * (-544.591) (-543.093) (-544.888) [-544.013] -- 0:00:29
518500 -- (-542.803) (-546.359) [-544.364] (-543.379) * [-546.581] (-543.455) (-544.976) (-544.781) -- 0:00:29
519000 -- (-543.443) [-546.342] (-543.667) (-544.932) * (-545.243) (-543.950) (-545.830) [-543.871] -- 0:00:29
519500 -- [-543.212] (-543.157) (-543.386) (-548.202) * (-543.872) (-543.928) (-542.586) [-545.186] -- 0:00:29
520000 -- (-543.553) [-546.778] (-544.359) (-548.373) * (-545.322) (-546.363) [-544.706] (-543.800) -- 0:00:29
Average standard deviation of split frequencies: 0.011237
520500 -- (-544.803) [-544.674] (-545.740) (-544.535) * (-546.857) (-545.363) [-545.066] (-547.056) -- 0:00:29
521000 -- (-544.330) (-542.690) (-545.065) [-543.972] * (-545.129) [-543.498] (-543.425) (-546.562) -- 0:00:29
521500 -- (-548.136) [-542.341] (-545.567) (-543.429) * (-543.648) (-542.174) (-542.464) [-550.270] -- 0:00:29
522000 -- [-545.867] (-543.659) (-544.149) (-542.833) * [-544.277] (-542.815) (-544.253) (-544.547) -- 0:00:29
522500 -- [-545.797] (-545.330) (-547.938) (-542.616) * (-542.992) (-544.093) [-544.628] (-544.554) -- 0:00:29
523000 -- (-543.599) [-543.236] (-546.492) (-544.243) * (-545.788) (-545.493) [-543.423] (-542.472) -- 0:00:29
523500 -- (-544.929) (-543.674) [-543.693] (-544.410) * (-544.025) (-546.482) (-542.836) [-542.470] -- 0:00:29
524000 -- (-543.991) (-547.585) [-542.911] (-546.089) * (-546.887) [-542.049] (-543.935) (-544.389) -- 0:00:29
524500 -- (-543.456) (-545.553) [-542.672] (-544.877) * (-544.089) (-542.710) [-543.301] (-542.879) -- 0:00:29
525000 -- (-543.899) [-543.557] (-544.175) (-543.868) * (-545.963) (-543.412) [-545.239] (-547.557) -- 0:00:28
Average standard deviation of split frequencies: 0.010860
525500 -- (-544.142) (-549.224) [-545.524] (-547.035) * (-545.657) (-543.238) (-543.215) [-542.908] -- 0:00:28
526000 -- (-549.422) [-545.008] (-548.357) (-547.587) * [-545.568] (-547.760) (-543.925) (-545.457) -- 0:00:28
526500 -- (-543.460) (-545.007) [-546.900] (-547.464) * (-547.407) (-546.869) [-545.575] (-543.980) -- 0:00:28
527000 -- (-543.375) [-543.567] (-545.472) (-545.344) * (-546.099) [-545.294] (-544.898) (-546.275) -- 0:00:28
527500 -- (-545.856) (-545.431) [-543.474] (-542.311) * [-544.365] (-545.984) (-544.304) (-542.993) -- 0:00:28
528000 -- (-545.702) (-542.752) (-545.553) [-545.366] * [-542.970] (-547.205) (-547.336) (-545.304) -- 0:00:28
528500 -- [-543.205] (-545.174) (-542.808) (-543.823) * (-542.579) (-545.800) [-544.629] (-545.486) -- 0:00:28
529000 -- (-543.000) (-544.351) [-543.555] (-546.539) * (-544.408) (-543.628) (-542.326) [-543.667] -- 0:00:28
529500 -- (-542.974) (-545.391) [-543.865] (-544.867) * (-543.938) (-543.378) (-542.165) [-545.799] -- 0:00:29
530000 -- (-549.336) [-544.165] (-542.615) (-543.181) * (-543.158) (-545.135) (-542.980) [-543.606] -- 0:00:29
Average standard deviation of split frequencies: 0.010764
530500 -- (-544.132) (-545.136) (-542.200) [-543.327] * (-543.804) (-542.367) (-542.608) [-545.906] -- 0:00:29
531000 -- (-546.271) [-545.132] (-544.139) (-548.548) * (-544.231) (-543.815) [-545.453] (-547.126) -- 0:00:29
531500 -- (-545.144) (-546.824) [-545.503] (-547.447) * (-544.219) (-542.133) [-544.851] (-542.466) -- 0:00:29
532000 -- (-543.382) (-547.405) [-543.101] (-546.609) * (-544.398) [-545.228] (-543.754) (-542.693) -- 0:00:29
532500 -- (-543.775) (-544.155) [-543.955] (-543.521) * [-543.394] (-544.717) (-542.253) (-542.920) -- 0:00:28
533000 -- [-542.738] (-548.168) (-544.258) (-544.441) * (-544.145) [-545.042] (-545.152) (-543.183) -- 0:00:28
533500 -- (-545.064) (-547.717) [-544.341] (-544.364) * [-545.874] (-544.378) (-545.464) (-549.487) -- 0:00:28
534000 -- [-547.991] (-544.569) (-553.495) (-544.104) * (-543.270) [-544.710] (-544.295) (-545.205) -- 0:00:28
534500 -- (-543.955) (-544.074) (-544.626) [-545.749] * (-543.012) (-544.497) (-543.649) [-544.481] -- 0:00:28
535000 -- (-543.128) (-545.214) (-546.912) [-546.429] * [-543.761] (-543.266) (-545.679) (-544.729) -- 0:00:28
Average standard deviation of split frequencies: 0.010347
535500 -- [-544.407] (-543.368) (-545.282) (-545.743) * (-544.795) [-544.194] (-543.808) (-545.554) -- 0:00:28
536000 -- (-544.400) [-543.458] (-546.454) (-546.317) * (-544.301) [-546.062] (-544.921) (-542.728) -- 0:00:28
536500 -- [-543.138] (-546.147) (-544.353) (-548.810) * [-543.363] (-543.698) (-548.107) (-543.993) -- 0:00:28
537000 -- (-544.718) (-542.345) (-546.054) [-547.866] * (-549.530) (-543.309) [-542.606] (-543.913) -- 0:00:28
537500 -- [-542.675] (-542.886) (-543.385) (-546.850) * [-547.916] (-544.270) (-542.373) (-545.997) -- 0:00:28
538000 -- [-542.711] (-544.609) (-546.107) (-542.311) * (-551.078) [-546.223] (-544.890) (-548.893) -- 0:00:28
538500 -- [-543.956] (-545.121) (-544.803) (-544.295) * (-544.464) [-543.619] (-544.503) (-544.263) -- 0:00:28
539000 -- (-548.388) (-546.637) [-544.478] (-543.248) * [-543.208] (-547.450) (-543.428) (-544.121) -- 0:00:28
539500 -- (-546.803) (-543.123) (-542.212) [-545.307] * [-542.178] (-543.481) (-547.241) (-542.777) -- 0:00:28
540000 -- [-542.605] (-546.902) (-544.156) (-547.953) * [-543.818] (-544.644) (-548.593) (-544.934) -- 0:00:28
Average standard deviation of split frequencies: 0.010001
540500 -- (-544.799) (-545.231) [-545.641] (-548.160) * (-543.263) (-542.112) (-542.393) [-543.469] -- 0:00:28
541000 -- (-542.926) [-544.040] (-542.548) (-545.166) * (-544.359) (-546.697) (-547.520) [-543.132] -- 0:00:27
541500 -- (-544.327) [-545.152] (-548.432) (-542.899) * (-542.971) (-542.837) (-543.033) [-543.133] -- 0:00:27
542000 -- (-542.862) (-544.082) [-543.332] (-542.553) * (-545.610) [-542.465] (-544.309) (-546.281) -- 0:00:27
542500 -- [-543.910] (-545.361) (-542.848) (-543.732) * (-544.485) (-546.350) [-542.698] (-546.039) -- 0:00:27
543000 -- (-546.659) (-547.529) [-545.763] (-548.033) * (-544.660) [-544.149] (-543.631) (-542.369) -- 0:00:27
543500 -- (-549.494) (-546.690) [-544.897] (-543.121) * (-546.833) (-543.319) (-545.456) [-545.228] -- 0:00:27
544000 -- (-545.630) (-542.956) (-544.306) [-542.862] * [-547.161] (-544.182) (-543.587) (-542.844) -- 0:00:27
544500 -- (-543.938) (-546.587) [-544.693] (-543.200) * [-546.815] (-546.117) (-544.553) (-545.867) -- 0:00:27
545000 -- (-543.940) (-547.910) (-543.449) [-543.905] * (-545.695) (-545.079) [-544.850] (-545.791) -- 0:00:27
Average standard deviation of split frequencies: 0.009281
545500 -- (-546.660) [-545.963] (-546.214) (-550.803) * (-544.820) [-544.117] (-546.016) (-542.821) -- 0:00:27
546000 -- (-545.298) (-547.305) (-542.503) [-546.046] * (-545.034) [-544.951] (-543.577) (-544.890) -- 0:00:28
546500 -- [-545.766] (-547.032) (-542.944) (-545.821) * (-550.075) [-542.483] (-546.204) (-545.037) -- 0:00:28
547000 -- [-544.460] (-546.113) (-543.601) (-543.402) * (-547.328) [-542.310] (-545.882) (-544.385) -- 0:00:28
547500 -- [-545.022] (-546.991) (-544.059) (-545.887) * (-545.795) (-543.824) (-547.369) [-545.100] -- 0:00:28
548000 -- [-542.931] (-543.943) (-543.934) (-544.051) * (-543.992) (-544.086) [-544.434] (-548.046) -- 0:00:28
548500 -- (-543.463) (-544.569) (-544.256) [-542.310] * [-543.028] (-545.101) (-542.858) (-542.607) -- 0:00:27
549000 -- [-543.771] (-544.309) (-546.901) (-546.838) * [-542.408] (-544.727) (-544.445) (-542.786) -- 0:00:27
549500 -- (-544.726) (-544.519) [-544.325] (-544.961) * (-542.787) (-543.284) [-543.848] (-544.626) -- 0:00:27
550000 -- [-543.942] (-542.458) (-544.792) (-543.775) * (-542.999) [-544.338] (-546.486) (-542.555) -- 0:00:27
Average standard deviation of split frequencies: 0.009165
550500 -- [-544.688] (-542.678) (-542.629) (-545.689) * [-543.804] (-546.574) (-549.226) (-547.644) -- 0:00:27
551000 -- (-544.738) (-545.622) [-543.216] (-542.359) * (-546.411) [-544.351] (-543.901) (-549.798) -- 0:00:27
551500 -- (-543.193) [-547.195] (-542.423) (-544.244) * [-543.660] (-544.067) (-547.927) (-552.557) -- 0:00:27
552000 -- (-545.146) [-543.306] (-543.117) (-546.165) * [-544.087] (-543.718) (-545.947) (-543.117) -- 0:00:27
552500 -- (-548.082) (-544.501) [-545.440] (-542.818) * (-544.241) (-547.701) (-546.037) [-547.784] -- 0:00:27
553000 -- (-547.368) [-546.458] (-544.180) (-546.061) * (-543.282) [-545.977] (-543.690) (-543.281) -- 0:00:27
553500 -- [-543.728] (-547.858) (-544.978) (-545.285) * (-543.375) (-545.895) (-546.614) [-543.438] -- 0:00:27
554000 -- [-543.029] (-544.728) (-544.213) (-549.726) * [-547.260] (-544.260) (-545.607) (-546.816) -- 0:00:27
554500 -- (-545.833) (-543.070) [-545.127] (-548.537) * (-544.180) (-543.472) [-543.594] (-547.658) -- 0:00:27
555000 -- (-545.744) (-545.373) (-545.186) [-544.118] * (-547.005) (-542.621) (-546.021) [-542.473] -- 0:00:27
Average standard deviation of split frequencies: 0.009426
555500 -- [-545.208] (-546.649) (-544.216) (-544.749) * (-544.391) (-543.896) [-543.593] (-543.768) -- 0:00:27
556000 -- [-545.663] (-542.532) (-542.457) (-543.646) * [-548.403] (-545.088) (-548.431) (-544.843) -- 0:00:27
556500 -- (-544.131) [-544.063] (-542.569) (-543.631) * (-545.569) [-544.353] (-546.098) (-543.577) -- 0:00:27
557000 -- (-544.174) (-543.865) (-544.452) [-548.091] * (-543.700) (-543.357) [-543.483] (-546.037) -- 0:00:27
557500 -- (-544.207) [-543.168] (-544.431) (-544.616) * (-545.267) (-543.525) [-544.615] (-543.374) -- 0:00:26
558000 -- (-547.228) (-544.929) (-546.325) [-543.898] * (-547.373) (-549.465) [-543.661] (-546.780) -- 0:00:26
558500 -- (-547.068) (-549.880) [-543.165] (-544.463) * (-543.444) (-545.222) (-544.490) [-544.325] -- 0:00:26
559000 -- (-544.908) (-545.413) (-543.986) [-542.625] * (-544.152) [-545.408] (-544.637) (-542.643) -- 0:00:26
559500 -- [-545.092] (-545.884) (-549.281) (-547.237) * (-543.369) [-544.322] (-545.601) (-542.349) -- 0:00:26
560000 -- (-545.192) [-544.934] (-545.225) (-543.955) * (-543.174) (-544.073) [-543.323] (-547.274) -- 0:00:26
Average standard deviation of split frequencies: 0.009447
560500 -- (-542.946) (-546.335) (-545.628) [-543.729] * (-543.069) (-544.792) [-542.101] (-547.983) -- 0:00:26
561000 -- [-542.602] (-543.329) (-544.274) (-548.334) * (-543.103) (-545.144) (-546.382) [-546.311] -- 0:00:26
561500 -- (-547.380) (-546.788) [-543.557] (-543.777) * (-545.313) [-546.237] (-544.553) (-543.835) -- 0:00:26
562000 -- (-544.324) (-545.203) [-542.650] (-543.623) * (-542.292) (-544.572) (-544.850) [-543.621] -- 0:00:26
562500 -- [-544.063] (-542.398) (-542.479) (-542.738) * [-545.761] (-544.707) (-543.880) (-543.554) -- 0:00:26
563000 -- (-543.995) (-544.170) [-544.619] (-546.080) * (-544.253) [-546.019] (-545.334) (-544.290) -- 0:00:27
563500 -- [-543.696] (-543.063) (-544.212) (-547.496) * (-544.172) [-542.893] (-545.009) (-542.553) -- 0:00:27
564000 -- (-542.784) (-549.922) [-543.598] (-542.537) * (-546.163) (-544.037) (-542.856) [-543.519] -- 0:00:27
564500 -- (-543.432) (-545.681) (-544.325) [-543.555] * (-546.642) (-545.646) (-543.047) [-543.188] -- 0:00:27
565000 -- (-543.895) (-542.809) (-544.077) [-543.817] * [-546.742] (-543.974) (-543.907) (-544.050) -- 0:00:26
Average standard deviation of split frequencies: 0.009110
565500 -- (-547.956) (-545.319) [-544.603] (-544.146) * (-547.255) (-544.582) (-544.660) [-546.840] -- 0:00:26
566000 -- (-548.305) (-544.001) (-544.435) [-542.887] * [-545.751] (-545.521) (-542.322) (-545.441) -- 0:00:26
566500 -- (-545.492) [-542.321] (-545.208) (-550.734) * [-543.208] (-543.406) (-543.416) (-546.270) -- 0:00:26
567000 -- (-543.546) (-544.406) (-543.176) [-544.227] * (-546.344) (-544.884) (-543.959) [-542.488] -- 0:00:26
567500 -- (-545.572) (-543.914) (-545.506) [-544.564] * (-546.512) (-543.439) (-543.868) [-542.641] -- 0:00:26
568000 -- (-545.094) (-543.150) [-543.821] (-546.914) * (-542.971) (-547.390) [-543.733] (-543.897) -- 0:00:26
568500 -- [-544.007] (-542.841) (-542.214) (-548.210) * [-545.071] (-544.426) (-543.220) (-542.982) -- 0:00:26
569000 -- (-549.260) [-545.953] (-542.670) (-546.074) * (-544.453) (-545.627) [-544.600] (-543.362) -- 0:00:26
569500 -- (-548.343) (-554.337) [-542.916] (-543.990) * (-547.402) (-545.028) [-543.733] (-542.603) -- 0:00:26
570000 -- (-546.843) [-544.388] (-544.221) (-542.550) * (-549.130) (-544.306) (-545.739) [-544.991] -- 0:00:26
Average standard deviation of split frequencies: 0.008725
570500 -- (-543.291) [-543.174] (-545.721) (-543.681) * [-544.350] (-544.328) (-544.913) (-544.577) -- 0:00:26
571000 -- (-543.435) (-543.262) (-544.803) [-543.097] * (-545.581) [-545.763] (-544.063) (-544.377) -- 0:00:26
571500 -- [-547.543] (-543.805) (-546.243) (-542.571) * (-545.110) [-543.254] (-544.419) (-544.081) -- 0:00:26
572000 -- [-544.141] (-543.740) (-545.060) (-544.050) * (-547.764) (-545.231) [-545.819] (-545.586) -- 0:00:26
572500 -- (-543.453) (-545.929) [-543.204] (-544.781) * [-543.640] (-547.032) (-546.877) (-545.145) -- 0:00:26
573000 -- (-546.764) [-545.118] (-542.441) (-548.913) * [-543.088] (-544.216) (-547.994) (-543.751) -- 0:00:26
573500 -- (-544.748) (-545.650) (-545.219) [-542.164] * (-544.783) [-546.272] (-542.980) (-543.647) -- 0:00:26
574000 -- (-544.464) (-545.823) [-543.749] (-542.301) * (-544.904) (-544.896) (-543.153) [-543.620] -- 0:00:25
574500 -- [-545.714] (-546.120) (-546.672) (-543.267) * (-545.118) (-546.834) (-543.110) [-542.533] -- 0:00:25
575000 -- [-542.818] (-542.682) (-544.827) (-543.967) * (-543.826) (-553.274) (-544.952) [-545.983] -- 0:00:25
Average standard deviation of split frequencies: 0.009258
575500 -- (-547.212) (-543.224) (-544.153) [-544.731] * (-546.142) (-548.286) (-544.116) [-543.338] -- 0:00:25
576000 -- [-544.513] (-546.130) (-544.666) (-546.168) * [-544.907] (-544.810) (-542.764) (-542.947) -- 0:00:25
576500 -- (-545.407) (-544.184) (-544.669) [-543.900] * [-544.830] (-545.539) (-546.334) (-545.153) -- 0:00:25
577000 -- [-544.126] (-546.588) (-544.355) (-543.564) * (-545.218) (-545.390) (-543.571) [-544.573] -- 0:00:25
577500 -- (-544.200) (-545.416) [-542.246] (-544.032) * (-544.277) (-542.775) [-545.465] (-546.001) -- 0:00:25
578000 -- (-545.860) (-543.168) (-548.316) [-544.538] * (-542.362) (-543.570) (-542.318) [-544.741] -- 0:00:25
578500 -- (-542.738) (-543.452) (-544.748) [-545.917] * (-544.528) (-551.712) (-545.917) [-543.552] -- 0:00:25
579000 -- [-545.191] (-550.316) (-542.767) (-543.195) * [-545.290] (-546.247) (-543.496) (-544.058) -- 0:00:25
579500 -- (-543.583) (-545.155) [-545.153] (-543.251) * (-544.491) (-543.786) [-544.055] (-544.315) -- 0:00:25
580000 -- (-544.665) (-542.858) (-545.761) [-546.072] * (-546.741) (-546.927) [-543.789] (-542.626) -- 0:00:26
Average standard deviation of split frequencies: 0.008978
580500 -- (-544.180) [-545.622] (-545.272) (-545.579) * (-546.714) (-543.259) (-545.715) [-543.239] -- 0:00:26
581000 -- (-543.577) (-544.186) (-546.562) [-544.797] * (-547.696) [-544.720] (-544.285) (-545.221) -- 0:00:25
581500 -- [-543.343] (-544.891) (-543.965) (-545.327) * (-543.609) [-545.430] (-543.955) (-546.477) -- 0:00:25
582000 -- (-547.402) [-546.806] (-544.403) (-543.962) * (-546.485) [-545.687] (-543.428) (-543.769) -- 0:00:25
582500 -- (-545.452) (-545.944) [-543.276] (-547.318) * (-548.098) (-542.127) (-545.044) [-548.263] -- 0:00:25
583000 -- (-543.566) (-546.726) [-543.118] (-548.574) * [-542.973] (-544.883) (-543.697) (-549.039) -- 0:00:25
583500 -- (-545.710) (-545.882) (-542.571) [-547.819] * (-544.363) (-543.039) (-546.524) [-549.113] -- 0:00:25
584000 -- (-542.843) [-543.133] (-543.783) (-545.269) * (-542.621) (-547.326) [-548.016] (-543.359) -- 0:00:25
584500 -- (-543.389) (-545.264) [-543.359] (-543.664) * (-543.454) (-548.249) [-544.966] (-543.833) -- 0:00:25
585000 -- (-544.041) (-545.066) (-544.001) [-543.722] * (-546.304) (-547.549) (-545.008) [-545.308] -- 0:00:25
Average standard deviation of split frequencies: 0.008423
585500 -- [-545.511] (-546.387) (-544.457) (-544.423) * [-546.835] (-544.903) (-546.178) (-545.813) -- 0:00:25
586000 -- (-544.869) (-544.468) (-544.294) [-545.482] * [-542.169] (-542.384) (-544.282) (-542.238) -- 0:00:25
586500 -- (-545.157) (-545.883) (-543.587) [-544.870] * (-543.910) [-543.821] (-543.184) (-544.536) -- 0:00:25
587000 -- (-543.375) [-547.954] (-553.624) (-542.772) * (-544.157) [-545.527] (-543.397) (-546.528) -- 0:00:25
587500 -- (-543.298) (-543.912) (-547.826) [-544.851] * (-543.784) (-544.408) [-544.876] (-546.609) -- 0:00:25
588000 -- [-544.276] (-542.557) (-548.534) (-545.071) * [-545.153] (-543.420) (-542.847) (-545.223) -- 0:00:25
588500 -- (-543.498) (-547.840) [-544.645] (-543.320) * (-543.158) (-546.513) [-543.755] (-545.360) -- 0:00:25
589000 -- (-543.590) (-545.676) [-546.021] (-543.851) * (-542.477) (-545.525) [-543.379] (-544.642) -- 0:00:25
589500 -- (-546.230) (-549.194) [-542.620] (-546.409) * (-543.946) (-546.052) (-544.204) [-543.483] -- 0:00:25
590000 -- (-545.772) (-544.072) (-543.363) [-545.965] * [-544.134] (-544.026) (-547.043) (-542.456) -- 0:00:25
Average standard deviation of split frequencies: 0.008263
590500 -- [-548.056] (-544.899) (-544.091) (-547.541) * (-544.354) (-543.585) [-542.946] (-545.621) -- 0:00:24
591000 -- (-546.686) [-545.102] (-542.688) (-543.435) * (-543.309) [-543.943] (-545.831) (-545.037) -- 0:00:24
591500 -- (-544.923) [-544.195] (-542.822) (-548.229) * (-542.927) (-548.341) [-545.367] (-543.271) -- 0:00:24
592000 -- (-542.831) (-545.395) [-543.515] (-543.964) * (-549.280) (-547.389) (-544.622) [-543.100] -- 0:00:24
592500 -- (-542.020) [-544.291] (-548.022) (-546.870) * (-546.938) [-545.783] (-543.724) (-544.567) -- 0:00:24
593000 -- (-543.961) [-546.125] (-550.563) (-544.012) * (-546.071) (-546.648) [-549.155] (-550.381) -- 0:00:24
593500 -- (-543.686) [-542.682] (-549.485) (-551.180) * (-544.677) (-543.082) (-550.201) [-546.855] -- 0:00:24
594000 -- (-545.655) (-548.059) (-544.424) [-546.284] * (-548.626) [-544.290] (-544.236) (-543.222) -- 0:00:24
594500 -- (-545.522) [-544.145] (-544.426) (-545.655) * (-546.266) [-544.461] (-549.904) (-545.680) -- 0:00:24
595000 -- (-542.887) (-544.508) (-543.017) [-547.000] * [-545.914] (-544.040) (-544.851) (-549.474) -- 0:00:24
Average standard deviation of split frequencies: 0.008282
595500 -- (-544.137) (-547.645) [-546.292] (-545.032) * (-546.857) (-545.918) (-543.368) [-542.531] -- 0:00:24
596000 -- (-544.427) [-545.120] (-543.922) (-546.771) * (-547.065) [-542.644] (-542.800) (-545.295) -- 0:00:24
596500 -- [-544.478] (-546.464) (-543.634) (-545.373) * (-543.276) [-544.805] (-542.796) (-544.163) -- 0:00:25
597000 -- (-544.130) [-546.190] (-543.699) (-549.022) * (-544.051) [-543.907] (-544.016) (-545.255) -- 0:00:24
597500 -- (-547.290) [-546.764] (-544.069) (-544.970) * (-544.172) (-545.278) [-543.124] (-544.078) -- 0:00:24
598000 -- (-544.968) (-544.633) [-542.940] (-549.422) * (-544.721) [-543.081] (-543.945) (-544.447) -- 0:00:24
598500 -- [-543.180] (-550.826) (-543.461) (-544.472) * (-547.027) (-542.675) (-545.741) [-544.122] -- 0:00:24
599000 -- (-546.685) (-547.291) [-542.949] (-542.423) * (-545.803) (-546.450) (-546.052) [-546.766] -- 0:00:24
599500 -- (-542.701) [-544.069] (-546.878) (-543.034) * (-543.500) (-542.187) [-543.694] (-542.814) -- 0:00:24
600000 -- [-543.219] (-543.177) (-543.917) (-544.227) * (-546.793) (-543.098) (-544.900) [-543.669] -- 0:00:24
Average standard deviation of split frequencies: 0.008356
600500 -- [-545.516] (-544.514) (-544.545) (-546.739) * (-546.626) (-542.435) (-542.264) [-542.308] -- 0:00:24
601000 -- (-543.486) (-545.602) [-543.786] (-551.832) * (-544.838) (-542.333) (-546.145) [-544.438] -- 0:00:24
601500 -- (-543.402) (-543.934) [-542.905] (-543.283) * (-542.747) (-542.435) [-548.962] (-546.834) -- 0:00:24
602000 -- (-543.660) [-543.832] (-543.028) (-545.368) * (-547.215) (-542.522) (-551.290) [-544.934] -- 0:00:24
602500 -- (-543.687) (-543.556) [-543.330] (-543.971) * (-549.137) [-546.140] (-546.047) (-548.112) -- 0:00:24
603000 -- (-543.520) (-543.210) (-543.681) [-545.651] * (-549.049) (-556.617) [-544.704] (-544.522) -- 0:00:24
603500 -- (-542.960) (-544.310) [-543.323] (-543.306) * (-544.953) (-545.360) (-548.094) [-544.597] -- 0:00:24
604000 -- (-543.070) [-543.935] (-542.631) (-543.313) * [-544.351] (-544.186) (-548.159) (-545.436) -- 0:00:24
604500 -- (-543.503) (-542.556) (-543.420) [-542.821] * (-544.017) (-545.744) [-544.106] (-545.744) -- 0:00:24
605000 -- [-545.562] (-543.958) (-544.689) (-542.534) * (-548.379) [-543.181] (-542.887) (-546.811) -- 0:00:24
Average standard deviation of split frequencies: 0.008603
605500 -- (-545.261) (-543.094) (-548.408) [-544.709] * (-544.282) (-542.586) [-542.655] (-543.041) -- 0:00:24
606000 -- (-544.289) (-544.906) [-546.794] (-544.088) * [-544.120] (-553.190) (-546.065) (-543.490) -- 0:00:24
606500 -- (-544.858) (-543.190) [-542.804] (-544.896) * [-544.905] (-551.561) (-551.845) (-543.536) -- 0:00:24
607000 -- (-544.262) (-543.894) (-544.240) [-545.387] * (-544.460) (-543.817) [-545.666] (-545.290) -- 0:00:23
607500 -- (-542.615) [-543.540] (-543.945) (-545.737) * (-545.701) [-546.173] (-549.123) (-547.308) -- 0:00:23
608000 -- (-543.389) (-543.182) (-546.113) [-543.327] * (-547.591) (-550.485) (-546.416) [-542.836] -- 0:00:23
608500 -- (-544.095) (-543.691) [-543.385] (-543.447) * [-543.682] (-546.864) (-544.074) (-544.456) -- 0:00:23
609000 -- (-543.199) (-543.550) [-542.975] (-549.364) * [-542.663] (-550.294) (-546.606) (-546.705) -- 0:00:23
609500 -- (-545.493) [-544.782] (-544.015) (-544.401) * (-549.298) (-543.747) [-548.712] (-546.983) -- 0:00:23
610000 -- [-544.516] (-544.611) (-545.602) (-547.247) * (-546.576) [-546.270] (-545.248) (-543.505) -- 0:00:23
Average standard deviation of split frequencies: 0.009070
610500 -- (-543.694) (-547.773) [-543.574] (-546.122) * [-543.665] (-544.442) (-546.984) (-544.818) -- 0:00:23
611000 -- (-549.505) (-545.533) [-544.157] (-545.248) * (-546.073) (-545.311) [-547.339] (-543.975) -- 0:00:23
611500 -- (-547.362) (-542.723) (-546.581) [-542.754] * (-544.863) (-547.518) (-544.949) [-544.943] -- 0:00:23
612000 -- (-549.372) (-543.228) (-546.633) [-543.944] * (-543.776) (-547.788) (-542.478) [-544.166] -- 0:00:23
612500 -- (-544.508) [-543.904] (-545.377) (-547.855) * (-544.791) (-548.365) [-544.804] (-544.697) -- 0:00:23
613000 -- (-546.381) (-545.221) (-548.262) [-543.837] * (-544.544) (-544.623) [-542.716] (-545.796) -- 0:00:23
613500 -- (-545.716) (-543.650) [-543.927] (-545.101) * (-544.820) (-545.205) [-544.685] (-549.566) -- 0:00:23
614000 -- [-544.206] (-546.000) (-544.479) (-546.170) * (-548.476) (-544.401) [-543.510] (-547.207) -- 0:00:23
614500 -- [-544.206] (-545.708) (-543.907) (-544.434) * (-543.758) (-544.054) [-543.911] (-543.481) -- 0:00:23
615000 -- (-544.118) (-546.508) [-545.743] (-543.420) * (-543.068) (-542.340) (-541.979) [-545.332] -- 0:00:23
Average standard deviation of split frequencies: 0.008598
615500 -- [-542.738] (-545.146) (-546.602) (-543.320) * (-543.896) [-543.667] (-544.355) (-542.673) -- 0:00:23
616000 -- [-544.314] (-547.115) (-544.070) (-544.741) * (-542.514) [-543.910] (-544.037) (-547.175) -- 0:00:23
616500 -- (-542.332) [-544.894] (-542.507) (-547.282) * [-547.261] (-543.583) (-544.198) (-546.564) -- 0:00:23
617000 -- (-544.243) [-545.489] (-543.150) (-544.627) * [-543.641] (-543.455) (-543.665) (-546.731) -- 0:00:23
617500 -- (-548.998) [-543.579] (-543.942) (-544.121) * (-543.315) [-542.830] (-543.560) (-548.553) -- 0:00:23
618000 -- (-545.976) (-544.422) [-546.083] (-542.991) * (-543.456) (-542.476) [-545.187] (-548.501) -- 0:00:23
618500 -- (-545.722) [-548.202] (-545.594) (-543.249) * [-542.780] (-549.348) (-548.669) (-543.616) -- 0:00:23
619000 -- (-542.758) (-543.117) (-545.820) [-544.003] * (-543.114) (-546.278) (-543.298) [-548.840] -- 0:00:23
619500 -- (-546.791) (-545.226) (-546.413) [-543.683] * (-545.838) (-545.185) [-546.029] (-548.180) -- 0:00:23
620000 -- [-543.960] (-545.068) (-545.577) (-544.802) * [-543.239] (-544.722) (-545.409) (-542.767) -- 0:00:23
Average standard deviation of split frequencies: 0.008070
620500 -- (-543.520) (-546.541) [-544.837] (-543.135) * (-543.348) [-543.109] (-543.921) (-545.864) -- 0:00:23
621000 -- (-544.174) [-546.157] (-546.123) (-548.509) * (-542.670) (-543.912) (-545.706) [-543.354] -- 0:00:23
621500 -- (-544.838) (-545.214) (-542.249) [-543.167] * (-543.534) (-543.679) [-545.745] (-543.879) -- 0:00:23
622000 -- (-542.456) (-544.335) [-544.953] (-548.030) * (-545.190) (-542.843) [-546.203] (-543.938) -- 0:00:23
622500 -- (-546.070) (-543.023) (-545.579) [-547.780] * (-543.982) (-544.565) [-544.345] (-544.208) -- 0:00:23
623000 -- (-543.525) (-548.296) (-542.414) [-545.736] * (-544.272) (-546.423) [-543.318] (-542.823) -- 0:00:22
623500 -- (-544.061) (-546.277) (-542.336) [-545.090] * (-542.847) [-542.889] (-542.482) (-543.647) -- 0:00:22
624000 -- (-545.120) (-543.596) [-544.422] (-542.968) * (-544.392) (-542.647) [-543.437] (-543.040) -- 0:00:22
624500 -- (-548.129) (-544.050) (-546.156) [-549.021] * (-544.536) (-542.593) (-545.153) [-543.538] -- 0:00:22
625000 -- (-542.840) (-548.783) [-546.951] (-545.962) * (-543.996) [-544.023] (-547.502) (-542.169) -- 0:00:22
Average standard deviation of split frequencies: 0.008328
625500 -- (-544.307) (-547.068) [-544.311] (-544.941) * (-544.437) [-542.933] (-544.865) (-547.248) -- 0:00:22
626000 -- (-543.725) (-546.814) [-546.595] (-543.231) * (-546.113) (-544.538) (-543.851) [-543.618] -- 0:00:22
626500 -- (-548.660) (-546.258) (-545.274) [-542.890] * [-544.421] (-546.715) (-545.610) (-543.153) -- 0:00:22
627000 -- [-543.365] (-544.854) (-543.134) (-545.115) * (-544.200) [-545.213] (-549.644) (-543.277) -- 0:00:22
627500 -- (-547.357) (-545.087) (-544.703) [-545.380] * (-544.661) (-543.146) (-545.947) [-543.920] -- 0:00:22
628000 -- [-544.318] (-544.948) (-546.255) (-545.173) * (-544.885) [-542.089] (-548.730) (-544.133) -- 0:00:22
628500 -- (-543.418) (-546.723) (-543.065) [-545.573] * (-544.891) [-546.484] (-544.864) (-544.889) -- 0:00:22
629000 -- (-549.195) [-544.622] (-543.643) (-543.682) * [-544.881] (-546.439) (-545.312) (-544.723) -- 0:00:22
629500 -- (-544.481) (-542.436) [-543.152] (-545.762) * (-545.359) [-543.024] (-545.060) (-549.610) -- 0:00:22
630000 -- (-542.814) [-543.649] (-543.045) (-548.394) * (-546.259) (-546.629) (-544.985) [-545.677] -- 0:00:22
Average standard deviation of split frequencies: 0.007288
630500 -- (-542.434) [-543.797] (-543.561) (-544.907) * [-544.240] (-546.006) (-543.308) (-543.718) -- 0:00:22
631000 -- (-542.781) (-546.544) (-543.750) [-544.177] * [-548.249] (-545.538) (-548.136) (-542.776) -- 0:00:22
631500 -- (-544.091) [-545.339] (-544.097) (-544.358) * (-545.709) (-547.518) (-546.138) [-543.112] -- 0:00:22
632000 -- (-542.717) [-548.282] (-543.683) (-546.577) * (-546.640) [-547.527] (-544.223) (-542.781) -- 0:00:22
632500 -- (-543.824) (-547.547) [-544.177] (-544.515) * (-544.894) (-551.732) [-544.254] (-545.174) -- 0:00:22
633000 -- (-545.672) [-545.421] (-544.382) (-548.528) * [-543.395] (-548.415) (-542.554) (-552.225) -- 0:00:22
633500 -- (-545.431) (-548.531) [-546.405] (-543.616) * [-542.584] (-545.839) (-543.464) (-542.712) -- 0:00:22
634000 -- [-545.837] (-546.220) (-545.936) (-543.488) * [-543.266] (-545.176) (-542.794) (-542.484) -- 0:00:22
634500 -- (-545.507) [-543.835] (-543.483) (-546.216) * (-543.109) (-544.758) (-545.846) [-542.403] -- 0:00:22
635000 -- (-544.032) (-545.901) [-544.103] (-548.489) * (-543.979) (-547.436) (-553.706) [-542.555] -- 0:00:22
Average standard deviation of split frequencies: 0.007363
635500 -- (-545.296) [-543.842] (-545.373) (-548.794) * (-543.094) [-551.265] (-546.555) (-543.948) -- 0:00:22
636000 -- (-543.732) (-544.129) [-544.520] (-546.324) * (-544.618) [-548.060] (-543.067) (-547.441) -- 0:00:22
636500 -- (-547.734) (-547.435) [-544.658] (-544.988) * (-543.669) (-544.129) [-543.347] (-543.630) -- 0:00:22
637000 -- (-547.893) [-546.461] (-542.428) (-544.107) * (-543.064) (-545.037) (-545.158) [-543.530] -- 0:00:22
637500 -- (-544.830) (-544.880) (-547.024) [-546.473] * [-543.734] (-544.235) (-546.449) (-543.390) -- 0:00:22
638000 -- [-545.764] (-543.963) (-543.919) (-544.007) * (-550.968) (-543.690) [-545.104] (-546.493) -- 0:00:22
638500 -- (-546.874) (-544.380) (-542.168) [-548.207] * [-544.838] (-544.071) (-545.687) (-544.229) -- 0:00:22
639000 -- (-546.657) (-544.761) [-542.493] (-544.052) * (-544.019) (-545.409) (-546.288) [-543.684] -- 0:00:22
639500 -- [-545.411] (-545.790) (-542.473) (-543.890) * [-542.891] (-544.501) (-545.213) (-543.585) -- 0:00:21
640000 -- [-545.919] (-546.502) (-543.108) (-546.219) * (-545.766) (-544.558) (-543.838) [-544.156] -- 0:00:21
Average standard deviation of split frequencies: 0.006917
640500 -- (-543.298) (-545.239) [-547.452] (-544.268) * (-545.233) [-545.154] (-544.615) (-543.436) -- 0:00:21
641000 -- (-543.748) [-544.472] (-544.269) (-544.145) * (-548.995) [-546.128] (-547.446) (-543.309) -- 0:00:21
641500 -- (-544.038) [-545.298] (-543.490) (-544.370) * [-545.854] (-546.265) (-547.765) (-543.522) -- 0:00:21
642000 -- [-545.510] (-543.470) (-543.965) (-544.112) * (-550.106) (-544.295) (-543.747) [-545.314] -- 0:00:21
642500 -- [-543.422] (-544.207) (-543.793) (-544.848) * [-544.696] (-543.276) (-545.487) (-547.656) -- 0:00:21
643000 -- (-542.912) [-543.882] (-543.763) (-544.068) * (-545.756) [-543.763] (-548.263) (-549.921) -- 0:00:21
643500 -- [-543.622] (-544.082) (-546.475) (-543.220) * (-548.966) (-545.953) (-544.056) [-543.569] -- 0:00:21
644000 -- [-543.623] (-544.919) (-547.385) (-546.627) * [-543.806] (-544.832) (-546.913) (-544.866) -- 0:00:21
644500 -- (-548.600) [-543.020] (-543.300) (-546.602) * (-544.644) [-543.288] (-543.091) (-543.324) -- 0:00:21
645000 -- [-546.851] (-542.361) (-544.676) (-546.196) * (-542.846) (-542.554) [-548.922] (-543.777) -- 0:00:21
Average standard deviation of split frequencies: 0.006470
645500 -- (-546.600) (-542.261) [-542.226] (-544.667) * (-543.749) [-542.737] (-543.891) (-544.409) -- 0:00:21
646000 -- (-546.538) [-544.900] (-545.593) (-543.512) * [-544.525] (-543.637) (-548.577) (-548.863) -- 0:00:21
646500 -- (-552.089) (-546.842) [-544.356] (-543.721) * (-546.999) [-544.511] (-545.982) (-547.579) -- 0:00:21
647000 -- [-547.228] (-545.891) (-544.437) (-545.501) * (-548.517) (-542.306) [-543.214] (-544.840) -- 0:00:21
647500 -- (-548.515) (-543.615) (-546.807) [-545.522] * [-542.513] (-542.968) (-544.267) (-543.117) -- 0:00:21
648000 -- [-543.823] (-544.393) (-545.988) (-543.277) * (-546.407) (-543.089) [-543.154] (-543.303) -- 0:00:21
648500 -- [-546.017] (-544.093) (-544.922) (-542.644) * [-543.001] (-543.228) (-543.949) (-543.216) -- 0:00:21
649000 -- (-545.219) (-544.203) (-546.139) [-543.464] * (-544.525) [-543.041] (-544.612) (-543.406) -- 0:00:21
649500 -- (-548.297) (-544.319) (-543.903) [-542.906] * (-544.360) [-543.624] (-545.273) (-546.153) -- 0:00:21
650000 -- [-543.260] (-544.050) (-543.420) (-543.782) * (-545.159) (-544.689) (-544.188) [-542.438] -- 0:00:21
Average standard deviation of split frequencies: 0.006520
650500 -- [-543.932] (-544.440) (-543.305) (-546.884) * (-550.281) (-545.359) [-548.056] (-545.794) -- 0:00:21
651000 -- (-543.366) (-544.463) [-544.298] (-543.407) * (-542.399) [-542.769] (-543.683) (-543.957) -- 0:00:21
651500 -- (-543.801) [-542.906] (-542.843) (-542.462) * (-546.214) (-542.845) (-547.529) [-544.185] -- 0:00:21
652000 -- [-544.364] (-543.259) (-549.044) (-542.726) * [-544.692] (-542.686) (-547.858) (-546.199) -- 0:00:21
652500 -- (-543.658) [-543.351] (-546.693) (-543.019) * [-545.331] (-542.306) (-544.075) (-543.085) -- 0:00:21
653000 -- (-544.577) (-549.017) [-543.890] (-543.159) * (-547.087) (-543.356) (-544.287) [-542.678] -- 0:00:21
653500 -- (-543.443) (-545.072) (-545.875) [-543.371] * (-544.639) [-543.202] (-543.103) (-551.461) -- 0:00:21
654000 -- (-544.409) (-544.960) (-542.450) [-544.263] * (-544.297) (-545.266) [-542.693] (-543.431) -- 0:00:21
654500 -- (-548.817) [-542.647] (-542.736) (-544.339) * (-544.965) (-543.199) [-542.415] (-543.117) -- 0:00:21
655000 -- (-545.482) [-543.016] (-543.625) (-543.055) * (-543.479) [-544.487] (-544.035) (-545.890) -- 0:00:21
Average standard deviation of split frequencies: 0.006372
655500 -- [-547.986] (-542.966) (-544.936) (-545.400) * (-543.926) (-543.836) (-544.333) [-543.079] -- 0:00:21
656000 -- [-543.982] (-548.516) (-543.530) (-544.024) * (-542.626) (-545.811) (-546.191) [-543.917] -- 0:00:20
656500 -- (-543.940) [-543.399] (-548.167) (-543.303) * (-542.401) (-546.199) [-546.268] (-546.796) -- 0:00:20
657000 -- (-548.832) (-543.162) (-542.840) [-548.871] * [-543.227] (-544.728) (-546.155) (-543.876) -- 0:00:20
657500 -- [-543.637] (-542.390) (-544.770) (-543.228) * (-542.585) (-548.524) (-542.283) [-544.561] -- 0:00:20
658000 -- (-544.768) [-546.324] (-543.329) (-543.538) * (-542.612) [-546.379] (-543.772) (-544.823) -- 0:00:20
658500 -- (-544.180) (-542.797) [-544.224] (-547.904) * (-548.634) [-545.967] (-543.405) (-543.537) -- 0:00:20
659000 -- (-542.810) [-543.695] (-544.708) (-543.765) * (-545.008) (-542.957) (-543.501) [-542.556] -- 0:00:20
659500 -- (-542.811) (-543.115) (-545.540) [-543.063] * [-543.147] (-542.869) (-544.080) (-545.375) -- 0:00:20
660000 -- (-543.758) (-544.318) (-543.912) [-544.400] * (-544.407) [-543.764] (-549.470) (-542.434) -- 0:00:20
Average standard deviation of split frequencies: 0.005566
660500 -- (-543.566) (-544.318) [-542.888] (-545.809) * [-545.733] (-544.603) (-547.502) (-543.437) -- 0:00:20
661000 -- (-542.835) (-544.695) (-545.640) [-543.440] * (-545.132) [-543.906] (-542.717) (-544.384) -- 0:00:20
661500 -- (-545.227) [-543.815] (-544.783) (-543.525) * (-544.873) [-545.115] (-543.293) (-545.222) -- 0:00:20
662000 -- [-542.792] (-543.591) (-546.480) (-542.715) * (-544.383) (-542.731) (-543.728) [-542.186] -- 0:00:20
662500 -- [-544.081] (-542.515) (-548.962) (-545.330) * (-545.253) (-543.707) (-545.410) [-546.163] -- 0:00:20
663000 -- (-546.764) (-545.243) [-545.799] (-546.161) * (-544.461) (-543.986) (-544.940) [-543.906] -- 0:00:20
663500 -- (-546.527) (-546.985) (-545.515) [-547.980] * (-545.096) (-544.637) (-543.009) [-543.990] -- 0:00:20
664000 -- (-543.374) (-544.535) [-544.420] (-546.686) * (-544.886) (-544.185) [-544.625] (-542.960) -- 0:00:20
664500 -- [-542.621] (-554.339) (-544.463) (-547.227) * (-543.569) (-546.014) (-546.048) [-543.218] -- 0:00:20
665000 -- (-545.752) (-545.371) [-545.561] (-547.983) * (-544.282) (-543.894) [-543.351] (-543.558) -- 0:00:20
Average standard deviation of split frequencies: 0.005332
665500 -- [-549.835] (-546.661) (-543.290) (-542.615) * [-542.630] (-542.367) (-543.462) (-549.369) -- 0:00:20
666000 -- (-542.409) (-544.723) [-543.286] (-545.385) * (-542.534) (-543.857) (-543.267) [-544.135] -- 0:00:20
666500 -- (-542.495) (-542.998) [-543.919] (-543.821) * (-544.053) (-542.822) (-543.401) [-542.891] -- 0:00:20
667000 -- [-545.341] (-545.381) (-544.690) (-544.129) * (-545.382) [-543.470] (-546.052) (-544.125) -- 0:00:20
667500 -- (-546.355) [-547.407] (-551.876) (-544.550) * (-546.463) [-543.352] (-543.272) (-544.576) -- 0:00:20
668000 -- (-544.869) [-545.668] (-547.298) (-543.564) * (-544.407) [-543.917] (-545.754) (-544.615) -- 0:00:20
668500 -- (-544.432) (-545.479) (-543.899) [-543.197] * (-544.747) (-544.218) (-547.604) [-544.369] -- 0:00:20
669000 -- (-544.940) [-544.495] (-544.119) (-543.008) * (-546.500) (-545.348) (-545.263) [-543.925] -- 0:00:20
669500 -- [-543.778] (-546.052) (-545.318) (-542.783) * (-544.807) (-542.885) (-545.655) [-543.850] -- 0:00:20
670000 -- (-545.364) (-546.358) [-544.996] (-544.389) * [-544.812] (-543.856) (-546.669) (-544.336) -- 0:00:20
Average standard deviation of split frequencies: 0.005061
670500 -- (-546.997) [-543.590] (-543.389) (-544.316) * [-542.970] (-543.893) (-545.905) (-547.009) -- 0:00:20
671000 -- (-545.224) (-542.662) [-542.924] (-544.150) * (-543.605) [-546.145] (-544.720) (-543.314) -- 0:00:20
671500 -- (-547.630) (-544.746) [-543.199] (-545.118) * (-544.875) (-548.283) [-542.363] (-548.026) -- 0:00:20
672000 -- [-545.680] (-547.634) (-543.889) (-546.322) * (-542.763) [-544.519] (-545.594) (-546.963) -- 0:00:20
672500 -- (-544.684) (-543.957) (-544.981) [-544.489] * (-546.593) (-544.023) [-543.595] (-544.568) -- 0:00:19
673000 -- (-545.436) (-544.505) [-548.427] (-545.429) * (-545.088) (-544.739) [-542.984] (-547.685) -- 0:00:19
673500 -- (-543.970) [-544.419] (-544.878) (-545.032) * [-543.332] (-549.168) (-550.668) (-543.938) -- 0:00:19
674000 -- [-543.619] (-542.837) (-545.987) (-546.759) * [-543.401] (-549.815) (-549.425) (-546.277) -- 0:00:19
674500 -- (-542.945) (-543.616) [-545.601] (-543.219) * (-543.238) (-547.469) (-544.697) [-544.730] -- 0:00:19
675000 -- [-544.179] (-544.957) (-544.365) (-543.245) * (-545.145) (-546.300) (-543.490) [-543.636] -- 0:00:19
Average standard deviation of split frequencies: 0.005021
675500 -- (-546.341) (-547.442) [-543.997] (-542.789) * (-546.006) [-543.826] (-544.018) (-542.374) -- 0:00:19
676000 -- [-545.422] (-542.816) (-543.550) (-542.535) * (-545.108) (-544.253) (-544.545) [-542.662] -- 0:00:19
676500 -- (-544.704) [-545.364] (-543.948) (-545.276) * (-543.268) (-544.466) [-545.505] (-542.518) -- 0:00:19
677000 -- (-544.492) (-545.124) [-542.989] (-543.900) * (-543.536) [-544.893] (-545.301) (-542.780) -- 0:00:19
677500 -- (-544.248) (-546.403) [-542.645] (-543.872) * (-543.231) [-543.063] (-545.164) (-545.477) -- 0:00:19
678000 -- [-547.002] (-544.719) (-543.536) (-542.704) * (-543.235) [-544.387] (-545.656) (-544.233) -- 0:00:19
678500 -- (-544.725) [-546.696] (-543.881) (-544.782) * [-543.712] (-542.779) (-542.848) (-543.902) -- 0:00:19
679000 -- (-545.184) (-543.673) [-543.752] (-544.098) * [-542.967] (-546.639) (-546.977) (-543.368) -- 0:00:19
679500 -- (-543.596) [-542.565] (-543.567) (-543.870) * (-543.982) (-545.953) (-548.187) [-544.771] -- 0:00:19
680000 -- (-546.803) [-542.655] (-543.366) (-543.681) * [-542.240] (-545.570) (-543.659) (-543.827) -- 0:00:19
Average standard deviation of split frequencies: 0.004940
680500 -- (-543.357) (-545.120) (-542.664) [-543.230] * (-542.859) (-545.476) [-544.223] (-544.656) -- 0:00:19
681000 -- (-542.472) [-543.751] (-544.438) (-544.298) * (-542.896) [-545.672] (-546.887) (-542.684) -- 0:00:19
681500 -- (-542.875) [-543.873] (-544.059) (-543.373) * [-543.626] (-546.315) (-543.772) (-549.570) -- 0:00:19
682000 -- [-544.611] (-544.873) (-544.359) (-543.086) * (-543.178) (-545.308) (-546.768) [-544.718] -- 0:00:19
682500 -- [-542.690] (-543.379) (-543.983) (-546.586) * (-544.156) (-543.617) (-544.779) [-543.037] -- 0:00:19
683000 -- (-545.851) (-543.989) [-545.778] (-543.915) * (-546.846) [-545.427] (-545.944) (-542.503) -- 0:00:19
683500 -- (-544.370) (-544.963) [-542.479] (-544.963) * (-542.315) (-544.513) (-545.627) [-542.863] -- 0:00:19
684000 -- (-542.351) (-548.373) [-542.144] (-547.444) * (-542.065) (-542.920) [-545.185] (-543.183) -- 0:00:19
684500 -- [-543.612] (-542.804) (-542.995) (-544.283) * (-543.036) (-544.546) [-542.704] (-543.008) -- 0:00:19
685000 -- (-544.252) (-544.889) (-547.246) [-543.357] * (-544.851) [-543.503] (-545.631) (-546.898) -- 0:00:19
Average standard deviation of split frequencies: 0.004444
685500 -- (-547.938) (-544.941) (-550.507) [-546.658] * (-544.139) (-543.669) (-546.142) [-543.157] -- 0:00:19
686000 -- (-546.274) (-545.240) (-542.596) [-543.377] * (-544.119) (-542.570) [-542.150] (-544.607) -- 0:00:19
686500 -- (-544.494) [-549.058] (-542.970) (-547.063) * [-548.785] (-544.826) (-542.986) (-545.172) -- 0:00:19
687000 -- (-543.720) (-543.984) [-543.039] (-544.609) * [-544.381] (-545.938) (-543.424) (-543.020) -- 0:00:19
687500 -- (-544.446) (-543.681) [-542.367] (-545.586) * [-543.894] (-545.589) (-545.102) (-543.489) -- 0:00:19
688000 -- (-542.863) (-544.233) (-543.190) [-543.180] * (-545.125) (-545.137) (-544.097) [-542.744] -- 0:00:19
688500 -- (-544.824) (-543.773) [-543.638] (-548.414) * (-544.784) (-546.267) (-544.598) [-544.169] -- 0:00:19
689000 -- (-544.853) [-546.845] (-542.977) (-545.210) * (-546.357) (-545.055) (-550.437) [-546.946] -- 0:00:18
689500 -- [-546.690] (-542.503) (-543.905) (-544.829) * [-542.778] (-545.526) (-544.365) (-548.192) -- 0:00:18
690000 -- [-543.877] (-543.439) (-545.305) (-543.450) * (-543.474) [-544.865] (-544.555) (-543.006) -- 0:00:18
Average standard deviation of split frequencies: 0.004232
690500 -- (-543.823) (-546.702) [-545.593] (-543.471) * (-544.555) (-542.990) (-544.472) [-542.371] -- 0:00:18
691000 -- (-542.972) (-546.288) (-543.041) [-543.063] * [-546.062] (-543.434) (-543.354) (-547.108) -- 0:00:18
691500 -- (-543.400) (-543.614) (-544.098) [-542.492] * (-543.231) [-544.449] (-552.141) (-546.352) -- 0:00:18
692000 -- (-544.567) [-544.754] (-542.530) (-546.981) * (-544.461) (-546.678) (-553.940) [-545.659] -- 0:00:18
692500 -- (-544.082) (-544.973) (-542.748) [-545.964] * [-548.731] (-546.762) (-549.729) (-545.337) -- 0:00:18
693000 -- (-543.030) (-544.791) (-544.471) [-544.482] * (-545.972) (-545.965) (-546.332) [-542.415] -- 0:00:18
693500 -- (-546.537) (-543.297) [-545.308] (-548.929) * (-544.504) (-544.222) (-544.083) [-543.478] -- 0:00:18
694000 -- [-545.736] (-542.760) (-544.837) (-544.450) * (-542.825) (-543.541) [-544.994] (-543.965) -- 0:00:18
694500 -- (-544.983) (-543.467) (-545.755) [-545.265] * [-542.019] (-548.021) (-543.873) (-544.144) -- 0:00:18
695000 -- (-545.539) (-544.474) (-542.926) [-544.083] * (-542.095) (-547.319) (-544.265) [-544.797] -- 0:00:18
Average standard deviation of split frequencies: 0.004425
695500 -- (-543.549) (-543.623) (-542.950) [-543.853] * (-543.341) (-549.878) [-543.514] (-543.656) -- 0:00:18
696000 -- (-543.215) [-545.847] (-545.202) (-543.266) * (-546.953) (-546.192) [-544.115] (-543.495) -- 0:00:18
696500 -- (-546.663) (-546.534) (-543.657) [-548.138] * (-547.034) [-548.326] (-544.821) (-548.550) -- 0:00:18
697000 -- (-543.056) (-543.671) (-545.105) [-544.088] * (-543.595) (-546.646) [-550.951] (-543.540) -- 0:00:18
697500 -- (-547.868) [-542.628] (-546.381) (-543.485) * (-546.752) (-546.252) [-546.051] (-542.667) -- 0:00:18
698000 -- [-545.024] (-544.395) (-545.331) (-545.291) * (-546.414) (-544.572) (-547.459) [-544.301] -- 0:00:18
698500 -- (-546.138) [-543.717] (-550.312) (-544.104) * [-543.906] (-543.416) (-542.972) (-544.966) -- 0:00:18
699000 -- (-545.074) (-547.299) [-545.715] (-544.860) * [-542.949] (-548.601) (-542.651) (-546.462) -- 0:00:18
699500 -- (-543.827) (-546.394) [-545.888] (-544.455) * [-544.148] (-547.638) (-544.177) (-546.938) -- 0:00:18
700000 -- (-543.771) [-546.066] (-546.570) (-543.582) * (-543.544) (-547.338) (-544.609) [-545.564] -- 0:00:18
Average standard deviation of split frequencies: 0.004754
700500 -- (-544.414) (-547.709) [-543.040] (-546.251) * (-544.722) [-545.370] (-544.911) (-543.421) -- 0:00:18
701000 -- (-545.300) (-544.481) [-543.445] (-543.747) * [-544.760] (-546.964) (-544.302) (-543.039) -- 0:00:18
701500 -- (-542.792) (-546.535) [-545.297] (-543.576) * (-544.731) [-543.642] (-545.580) (-543.340) -- 0:00:18
702000 -- (-546.113) [-544.920] (-547.770) (-547.485) * (-544.757) (-544.832) (-543.455) [-543.120] -- 0:00:18
702500 -- [-543.662] (-543.846) (-545.873) (-544.471) * (-548.548) (-546.018) (-542.403) [-543.363] -- 0:00:18
703000 -- (-545.101) [-542.875] (-547.023) (-546.924) * [-546.251] (-545.979) (-545.384) (-542.897) -- 0:00:18
703500 -- (-548.898) (-547.229) [-546.119] (-542.129) * (-543.203) (-545.204) (-544.041) [-543.034] -- 0:00:18
704000 -- [-545.610] (-552.615) (-543.391) (-544.846) * [-544.484] (-549.984) (-545.227) (-543.108) -- 0:00:18
704500 -- (-547.477) [-543.085] (-546.192) (-543.466) * (-545.881) (-542.728) (-549.548) [-544.729] -- 0:00:18
705000 -- (-544.185) (-543.921) (-547.319) [-543.908] * (-543.812) (-543.321) [-543.366] (-546.033) -- 0:00:17
Average standard deviation of split frequencies: 0.005119
705500 -- (-544.294) [-547.460] (-547.203) (-543.543) * (-543.970) [-544.133] (-545.863) (-542.429) -- 0:00:17
706000 -- (-544.112) (-547.303) [-543.262] (-543.913) * [-543.516] (-547.207) (-545.005) (-544.589) -- 0:00:17
706500 -- (-546.437) (-546.268) (-546.891) [-548.255] * (-547.681) (-545.101) (-542.218) [-542.596] -- 0:00:17
707000 -- (-547.204) [-543.379] (-544.228) (-543.568) * (-555.197) [-544.895] (-544.175) (-543.535) -- 0:00:17
707500 -- (-547.478) (-545.976) (-544.190) [-543.820] * (-551.990) (-542.840) [-542.732] (-543.964) -- 0:00:17
708000 -- (-544.783) (-544.514) (-542.948) [-544.113] * (-548.187) (-544.905) (-542.717) [-543.853] -- 0:00:17
708500 -- (-545.090) [-543.548] (-543.433) (-544.056) * (-542.737) (-542.903) [-542.234] (-546.483) -- 0:00:17
709000 -- (-545.358) (-543.771) (-544.737) [-544.263] * (-543.358) (-544.304) [-544.586] (-542.746) -- 0:00:17
709500 -- (-543.243) (-545.031) (-546.127) [-544.331] * (-544.947) (-542.724) (-543.521) [-542.735] -- 0:00:17
710000 -- (-543.417) [-544.259] (-543.367) (-542.188) * (-545.465) (-543.536) [-542.518] (-544.144) -- 0:00:17
Average standard deviation of split frequencies: 0.005174
710500 -- [-543.225] (-546.593) (-545.188) (-543.766) * (-549.975) (-544.722) [-543.817] (-545.647) -- 0:00:17
711000 -- [-543.753] (-542.172) (-543.919) (-542.604) * (-544.149) [-545.889] (-544.818) (-543.125) -- 0:00:17
711500 -- (-545.631) (-544.374) [-545.185] (-543.757) * (-545.613) (-545.259) [-543.833] (-543.155) -- 0:00:17
712000 -- (-544.124) [-544.902] (-544.696) (-544.546) * (-546.795) (-545.931) [-543.773] (-545.108) -- 0:00:17
712500 -- (-544.097) (-543.859) (-545.281) [-543.841] * (-543.511) (-544.081) (-543.355) [-545.147] -- 0:00:17
713000 -- (-544.561) (-545.756) [-544.319] (-542.915) * (-544.617) (-544.482) (-546.570) [-543.277] -- 0:00:17
713500 -- (-542.688) (-545.036) [-542.488] (-547.652) * [-547.284] (-545.886) (-546.465) (-544.875) -- 0:00:17
714000 -- [-544.776] (-546.604) (-542.479) (-548.940) * (-548.242) (-545.456) [-543.726] (-545.396) -- 0:00:17
714500 -- (-544.503) (-545.686) [-545.165] (-544.487) * (-546.366) (-545.071) [-546.198] (-544.650) -- 0:00:17
715000 -- (-542.916) [-543.687] (-544.616) (-543.156) * (-547.031) (-546.313) (-546.488) [-545.086] -- 0:00:17
Average standard deviation of split frequencies: 0.005179
715500 -- (-546.012) (-543.842) [-542.764] (-543.245) * (-545.352) (-542.969) [-546.927] (-545.076) -- 0:00:17
716000 -- (-545.047) (-545.620) (-545.031) [-544.806] * (-542.334) [-546.555] (-544.718) (-544.558) -- 0:00:17
716500 -- (-545.938) [-547.191] (-542.260) (-543.086) * (-543.557) (-543.480) (-546.493) [-544.887] -- 0:00:17
717000 -- [-550.070] (-545.731) (-542.373) (-544.926) * [-546.472] (-542.456) (-545.971) (-543.037) -- 0:00:17
717500 -- (-545.502) (-548.533) [-542.826] (-543.298) * (-547.681) (-544.613) [-542.281] (-546.010) -- 0:00:17
718000 -- (-542.928) [-544.516] (-546.990) (-547.917) * [-543.137] (-545.005) (-543.383) (-545.241) -- 0:00:17
718500 -- (-543.310) [-542.917] (-543.369) (-544.014) * (-546.469) (-544.994) [-543.544] (-544.529) -- 0:00:17
719000 -- (-543.937) (-544.040) [-543.175] (-547.084) * (-547.118) (-544.399) [-546.696] (-545.608) -- 0:00:17
719500 -- (-545.227) (-544.803) (-549.642) [-544.042] * (-544.585) (-544.809) [-544.362] (-550.758) -- 0:00:17
720000 -- (-544.057) (-543.062) (-546.761) [-542.879] * (-546.555) (-543.409) (-543.309) [-544.929] -- 0:00:17
Average standard deviation of split frequencies: 0.005843
720500 -- (-544.207) (-542.537) (-550.913) [-548.829] * (-545.009) (-545.914) (-547.433) [-542.452] -- 0:00:17
721000 -- (-544.725) (-543.215) [-546.303] (-543.714) * (-544.929) (-544.401) (-548.455) [-543.025] -- 0:00:17
721500 -- [-543.921] (-545.088) (-547.138) (-542.900) * (-547.036) (-544.131) [-543.655] (-542.543) -- 0:00:16
722000 -- (-544.284) (-545.576) (-545.041) [-543.325] * (-545.465) (-544.706) [-543.903] (-543.884) -- 0:00:16
722500 -- (-543.160) (-542.520) [-543.267] (-543.009) * (-542.696) (-545.509) [-543.238] (-544.183) -- 0:00:16
723000 -- [-542.734] (-542.697) (-543.568) (-546.573) * (-549.584) (-543.169) (-546.398) [-543.948] -- 0:00:16
723500 -- [-544.867] (-542.991) (-547.478) (-550.771) * (-544.508) (-546.670) (-544.129) [-542.746] -- 0:00:16
724000 -- (-547.956) (-542.282) (-544.054) [-544.951] * (-546.885) (-543.675) (-547.521) [-544.812] -- 0:00:16
724500 -- [-542.384] (-543.708) (-542.977) (-544.531) * (-544.418) [-546.593] (-545.689) (-542.767) -- 0:00:16
725000 -- (-542.416) (-546.373) [-543.713] (-544.648) * (-542.472) (-544.286) (-544.290) [-542.821] -- 0:00:16
Average standard deviation of split frequencies: 0.005714
725500 -- (-547.374) (-543.284) (-547.172) [-542.522] * [-542.577] (-544.487) (-544.502) (-542.998) -- 0:00:16
726000 -- (-548.740) (-543.763) (-545.017) [-543.191] * (-545.965) [-548.422] (-545.520) (-544.015) -- 0:00:16
726500 -- (-545.718) [-545.202] (-543.806) (-547.238) * (-545.446) [-545.450] (-543.652) (-542.834) -- 0:00:16
727000 -- (-545.488) (-545.484) (-545.506) [-545.194] * (-547.744) (-543.838) (-543.145) [-542.237] -- 0:00:16
727500 -- (-546.185) (-543.583) (-545.290) [-542.761] * (-546.446) (-543.870) (-543.146) [-543.425] -- 0:00:16
728000 -- [-545.366] (-542.629) (-546.599) (-544.088) * (-545.826) (-545.279) (-543.925) [-544.237] -- 0:00:16
728500 -- (-547.755) [-544.292] (-545.934) (-543.909) * (-543.188) [-542.883] (-545.072) (-545.285) -- 0:00:16
729000 -- (-544.822) (-546.892) (-547.407) [-543.961] * [-543.304] (-542.605) (-546.646) (-543.585) -- 0:00:16
729500 -- (-547.574) [-544.127] (-545.315) (-543.018) * [-543.289] (-542.843) (-543.512) (-547.156) -- 0:00:16
730000 -- (-545.416) [-543.607] (-544.027) (-544.370) * (-545.188) (-543.328) (-545.789) [-545.002] -- 0:00:16
Average standard deviation of split frequencies: 0.006022
730500 -- (-546.098) [-542.707] (-550.972) (-544.854) * (-544.472) (-546.143) (-549.103) [-542.976] -- 0:00:16
731000 -- (-545.466) (-543.632) (-544.502) [-546.501] * [-544.357] (-545.695) (-545.448) (-543.072) -- 0:00:16
731500 -- (-545.206) (-542.267) (-542.633) [-543.878] * [-544.773] (-542.931) (-545.397) (-545.134) -- 0:00:16
732000 -- (-545.615) [-543.005] (-543.514) (-544.147) * (-544.069) (-544.483) [-551.838] (-544.972) -- 0:00:16
732500 -- (-551.832) (-544.143) (-543.471) [-544.447] * (-545.463) (-544.850) (-543.652) [-546.428] -- 0:00:16
733000 -- (-545.904) (-542.909) (-547.154) [-544.241] * (-543.083) (-543.325) [-544.398] (-544.866) -- 0:00:16
733500 -- [-543.862] (-543.707) (-545.823) (-547.122) * (-544.451) (-543.498) [-544.613] (-543.560) -- 0:00:16
734000 -- (-544.430) [-544.958] (-544.905) (-547.647) * (-546.090) [-542.827] (-545.521) (-543.375) -- 0:00:16
734500 -- (-546.299) (-544.587) (-543.323) [-545.938] * [-544.338] (-542.536) (-544.778) (-545.988) -- 0:00:16
735000 -- [-544.382] (-543.465) (-543.544) (-543.451) * (-547.596) (-543.025) (-542.921) [-546.069] -- 0:00:16
Average standard deviation of split frequencies: 0.006106
735500 -- (-543.478) [-543.260] (-544.948) (-546.311) * (-546.375) (-542.853) [-543.595] (-546.103) -- 0:00:16
736000 -- (-544.926) (-544.744) (-542.451) [-543.721] * [-549.159] (-543.346) (-544.023) (-545.694) -- 0:00:16
736500 -- [-544.969] (-542.952) (-544.642) (-542.905) * [-547.190] (-544.367) (-543.625) (-543.791) -- 0:00:16
737000 -- (-543.806) (-545.586) (-542.342) [-543.316] * (-544.368) (-542.519) [-543.102] (-543.430) -- 0:00:16
737500 -- (-544.037) [-544.165] (-544.566) (-542.658) * (-545.255) (-543.957) (-543.252) [-543.155] -- 0:00:16
738000 -- [-545.034] (-542.772) (-542.860) (-544.732) * (-545.028) (-543.871) [-543.781] (-544.042) -- 0:00:15
738500 -- [-544.013] (-543.412) (-545.758) (-544.156) * (-542.338) (-546.076) (-542.861) [-543.418] -- 0:00:15
739000 -- [-542.792] (-544.223) (-547.532) (-544.821) * (-545.826) (-546.304) [-544.571] (-545.289) -- 0:00:15
739500 -- (-543.764) (-543.123) (-546.575) [-545.397] * [-542.974] (-545.730) (-543.400) (-552.296) -- 0:00:15
740000 -- (-546.783) [-545.295] (-545.939) (-546.492) * (-543.454) (-543.224) [-546.223] (-542.968) -- 0:00:15
Average standard deviation of split frequencies: 0.006025
740500 -- (-543.842) (-549.234) (-545.142) [-545.019] * [-542.209] (-544.207) (-542.620) (-547.283) -- 0:00:15
741000 -- (-546.331) [-544.381] (-546.620) (-544.302) * (-543.253) [-544.453] (-543.144) (-545.094) -- 0:00:15
741500 -- (-543.811) (-543.906) (-543.155) [-544.840] * [-542.663] (-544.221) (-545.546) (-544.191) -- 0:00:15
742000 -- (-545.194) [-544.494] (-544.057) (-546.565) * (-544.611) (-546.373) [-542.632] (-545.425) -- 0:00:15
742500 -- (-545.665) (-549.212) [-543.379] (-544.843) * (-543.218) [-544.017] (-544.499) (-542.701) -- 0:00:15
743000 -- (-543.062) (-544.166) [-542.644] (-546.129) * (-547.856) [-545.756] (-553.476) (-547.591) -- 0:00:15
743500 -- (-542.964) (-546.704) [-543.865] (-544.132) * (-546.114) (-544.583) (-545.195) [-544.208] -- 0:00:15
744000 -- (-545.219) (-542.148) (-543.915) [-543.244] * (-544.922) (-544.043) (-542.225) [-545.188] -- 0:00:15
744500 -- (-545.638) (-542.039) [-544.277] (-549.684) * (-543.443) (-547.742) [-549.631] (-546.999) -- 0:00:15
745000 -- [-547.378] (-542.808) (-544.188) (-546.002) * (-546.636) (-546.167) (-545.721) [-543.120] -- 0:00:15
Average standard deviation of split frequencies: 0.006024
745500 -- (-543.489) (-542.474) (-543.764) [-546.384] * (-542.950) (-548.904) (-542.925) [-543.214] -- 0:00:15
746000 -- (-542.738) (-544.343) (-544.195) [-543.429] * (-546.252) (-545.052) (-544.107) [-544.242] -- 0:00:15
746500 -- [-542.138] (-544.287) (-548.317) (-544.541) * (-542.936) (-543.629) (-543.766) [-543.717] -- 0:00:15
747000 -- (-543.311) [-546.201] (-548.276) (-544.417) * (-544.744) (-544.071) [-548.984] (-545.842) -- 0:00:15
747500 -- (-545.188) (-544.995) (-543.844) [-543.253] * [-547.621] (-543.273) (-542.279) (-543.952) -- 0:00:15
748000 -- [-542.744] (-543.955) (-544.107) (-542.374) * [-544.869] (-543.050) (-546.599) (-545.769) -- 0:00:15
748500 -- (-543.176) (-544.003) [-543.903] (-546.519) * (-547.280) (-545.955) (-546.586) [-542.247] -- 0:00:15
749000 -- (-543.238) [-545.395] (-544.845) (-542.443) * (-546.051) (-543.757) (-543.696) [-548.266] -- 0:00:15
749500 -- (-543.596) [-542.749] (-545.760) (-545.051) * (-547.861) (-544.929) [-545.938] (-544.438) -- 0:00:15
750000 -- (-544.060) (-543.676) [-545.478] (-543.898) * [-544.954] (-550.700) (-543.522) (-544.499) -- 0:00:15
Average standard deviation of split frequencies: 0.005861
750500 -- [-546.340] (-544.191) (-544.431) (-543.970) * (-543.871) (-542.821) (-545.238) [-544.385] -- 0:00:15
751000 -- (-543.645) [-543.681] (-542.694) (-542.366) * (-543.152) (-543.820) (-546.457) [-543.708] -- 0:00:15
751500 -- (-543.595) (-546.682) [-545.952] (-545.945) * (-546.602) (-543.737) [-544.666] (-547.831) -- 0:00:15
752000 -- (-542.568) (-544.016) [-544.169] (-545.959) * (-543.362) (-546.033) (-546.367) [-544.344] -- 0:00:15
752500 -- [-544.510] (-546.805) (-543.897) (-542.689) * (-543.702) [-544.189] (-542.721) (-544.512) -- 0:00:15
753000 -- (-544.274) (-545.951) [-550.946] (-543.452) * (-548.488) (-546.082) (-542.957) [-543.480] -- 0:00:15
753500 -- (-544.497) (-547.516) (-551.617) [-543.651] * [-543.151] (-545.151) (-542.821) (-544.269) -- 0:00:15
754000 -- [-543.817] (-545.898) (-546.465) (-547.274) * (-544.026) (-542.586) [-542.957] (-546.015) -- 0:00:15
754500 -- (-544.004) (-543.460) (-546.387) [-545.078] * [-542.946] (-545.276) (-545.119) (-543.728) -- 0:00:14
755000 -- [-543.201] (-544.449) (-546.724) (-552.632) * [-542.669] (-547.509) (-544.536) (-545.972) -- 0:00:14
Average standard deviation of split frequencies: 0.005737
755500 -- (-542.252) [-544.015] (-544.572) (-545.300) * (-544.195) (-545.517) [-545.310] (-544.762) -- 0:00:14
756000 -- (-543.858) (-543.876) (-545.165) [-544.947] * (-544.120) (-546.145) (-542.698) [-542.760] -- 0:00:14
756500 -- (-547.438) (-543.657) (-544.988) [-546.370] * (-544.751) (-542.823) (-542.566) [-542.690] -- 0:00:14
757000 -- (-550.530) [-544.447] (-544.352) (-544.237) * (-543.064) (-544.030) (-543.195) [-542.709] -- 0:00:14
757500 -- [-544.256] (-544.070) (-544.226) (-544.566) * (-543.648) [-542.693] (-548.526) (-545.202) -- 0:00:14
758000 -- (-547.568) (-544.475) [-544.275] (-553.212) * (-545.340) (-542.647) [-548.489] (-542.233) -- 0:00:14
758500 -- [-547.748] (-542.907) (-543.038) (-548.286) * (-545.207) [-543.733] (-546.800) (-547.217) -- 0:00:14
759000 -- (-544.762) [-544.525] (-545.929) (-543.114) * (-543.306) (-542.822) (-542.733) [-543.153] -- 0:00:14
759500 -- [-543.427] (-543.656) (-544.505) (-545.404) * [-545.318] (-543.484) (-542.737) (-545.415) -- 0:00:14
760000 -- (-544.072) (-543.537) [-545.563] (-544.088) * (-545.425) (-544.738) [-544.195] (-542.530) -- 0:00:14
Average standard deviation of split frequencies: 0.005247
760500 -- (-549.180) (-544.213) (-546.341) [-548.243] * (-543.910) (-544.075) [-543.408] (-544.532) -- 0:00:14
761000 -- [-543.227] (-544.300) (-543.268) (-543.005) * (-547.422) [-546.140] (-542.079) (-543.101) -- 0:00:14
761500 -- (-544.031) (-546.875) (-543.829) [-542.527] * [-549.773] (-542.959) (-543.907) (-542.525) -- 0:00:14
762000 -- (-543.121) [-545.089] (-543.678) (-542.868) * (-545.736) [-542.731] (-545.985) (-543.875) -- 0:00:14
762500 -- [-543.948] (-543.868) (-545.071) (-543.788) * (-542.626) (-544.076) [-545.476] (-548.379) -- 0:00:14
763000 -- (-544.708) [-543.634] (-545.078) (-543.317) * [-544.971] (-543.124) (-542.968) (-546.571) -- 0:00:14
763500 -- (-544.261) [-543.176] (-545.921) (-545.020) * (-542.990) (-544.998) [-544.166] (-544.824) -- 0:00:14
764000 -- [-545.755] (-543.363) (-544.468) (-546.024) * [-543.598] (-544.689) (-543.113) (-545.344) -- 0:00:14
764500 -- (-543.233) [-545.173] (-542.955) (-543.850) * [-544.080] (-543.595) (-543.092) (-542.483) -- 0:00:14
765000 -- (-544.723) [-544.992] (-543.144) (-543.421) * (-545.719) [-544.532] (-542.830) (-542.984) -- 0:00:14
Average standard deviation of split frequencies: 0.005128
765500 -- [-542.651] (-543.521) (-542.609) (-547.980) * (-547.248) (-548.711) [-542.980] (-542.922) -- 0:00:14
766000 -- (-544.964) (-543.247) [-544.911] (-544.245) * (-543.282) (-547.643) (-546.348) [-543.229] -- 0:00:14
766500 -- (-543.292) [-543.704] (-543.898) (-544.960) * (-544.344) (-542.864) [-545.834] (-547.123) -- 0:00:14
767000 -- (-542.594) (-545.545) [-543.944] (-542.562) * (-543.670) (-546.017) [-543.942] (-543.481) -- 0:00:14
767500 -- (-546.953) [-543.872] (-543.791) (-547.320) * [-543.896] (-547.459) (-547.635) (-544.194) -- 0:00:14
768000 -- (-543.939) (-543.854) (-544.151) [-544.983] * [-543.712] (-546.229) (-545.732) (-550.329) -- 0:00:14
768500 -- (-543.553) (-547.213) [-546.693] (-543.378) * (-545.340) [-543.644] (-544.205) (-543.736) -- 0:00:14
769000 -- [-545.753] (-543.360) (-546.824) (-545.547) * [-542.969] (-542.453) (-545.814) (-543.532) -- 0:00:14
769500 -- (-542.885) [-543.640] (-544.586) (-544.478) * (-543.221) (-545.336) (-545.106) [-543.245] -- 0:00:14
770000 -- (-543.172) (-545.017) (-545.304) [-542.517] * (-546.529) (-545.794) [-543.996] (-547.656) -- 0:00:14
Average standard deviation of split frequencies: 0.005383
770500 -- (-544.112) (-547.728) [-545.508] (-543.969) * (-546.520) (-544.596) (-544.919) [-544.165] -- 0:00:13
771000 -- (-543.898) (-548.016) (-547.625) [-543.436] * [-544.988] (-544.028) (-544.807) (-544.725) -- 0:00:13
771500 -- (-543.707) (-545.785) (-544.093) [-543.318] * (-546.736) [-546.403] (-545.348) (-544.212) -- 0:00:13
772000 -- [-543.216] (-543.956) (-545.030) (-544.636) * (-546.863) [-545.680] (-543.878) (-543.234) -- 0:00:13
772500 -- [-544.325] (-544.495) (-542.902) (-542.406) * [-546.572] (-545.585) (-543.352) (-544.742) -- 0:00:13
773000 -- (-546.008) (-545.756) (-545.051) [-544.072] * (-544.534) [-547.081] (-543.445) (-549.273) -- 0:00:13
773500 -- (-542.694) (-544.122) [-543.819] (-546.978) * (-545.092) (-543.696) (-548.423) [-545.904] -- 0:00:13
774000 -- [-542.510] (-545.642) (-546.465) (-546.759) * (-546.410) (-546.456) [-544.847] (-543.246) -- 0:00:13
774500 -- (-547.140) [-544.512] (-543.536) (-544.164) * (-544.549) (-544.357) (-542.248) [-544.621] -- 0:00:13
775000 -- [-545.597] (-544.749) (-543.155) (-546.992) * (-544.814) (-544.355) (-542.559) [-544.473] -- 0:00:13
Average standard deviation of split frequencies: 0.005062
775500 -- (-542.947) (-549.101) (-542.840) [-542.610] * (-545.299) (-548.453) (-546.830) [-543.459] -- 0:00:13
776000 -- [-542.976] (-551.481) (-545.797) (-544.702) * (-544.216) (-548.403) (-546.958) [-543.006] -- 0:00:13
776500 -- (-543.783) (-548.024) (-543.867) [-543.693] * [-545.655] (-549.017) (-544.098) (-544.354) -- 0:00:13
777000 -- [-544.930] (-543.602) (-546.732) (-543.353) * [-543.502] (-550.346) (-546.401) (-544.460) -- 0:00:13
777500 -- (-544.276) (-544.048) (-543.997) [-546.204] * (-545.322) (-543.314) (-545.588) [-546.080] -- 0:00:13
778000 -- (-544.978) (-542.843) [-543.420] (-544.890) * (-544.814) [-544.851] (-545.199) (-545.392) -- 0:00:13
778500 -- (-544.937) (-544.745) (-545.332) [-544.635] * (-545.124) [-546.842] (-547.744) (-544.632) -- 0:00:13
779000 -- (-544.161) (-546.401) [-544.396] (-544.339) * [-547.009] (-545.274) (-549.696) (-542.715) -- 0:00:13
779500 -- (-547.038) (-548.185) [-543.064] (-543.905) * (-547.177) (-545.926) [-545.367] (-542.330) -- 0:00:13
780000 -- (-544.255) (-547.478) (-543.758) [-544.567] * (-543.689) [-546.293] (-542.639) (-544.085) -- 0:00:13
Average standard deviation of split frequencies: 0.005314
780500 -- [-543.095] (-544.528) (-543.599) (-544.816) * (-546.972) [-544.035] (-553.583) (-543.810) -- 0:00:13
781000 -- (-543.743) (-545.549) (-546.520) [-545.901] * [-542.675] (-542.291) (-547.112) (-543.384) -- 0:00:13
781500 -- (-544.232) (-546.326) [-542.575] (-545.152) * (-544.232) [-543.248] (-543.498) (-545.890) -- 0:00:13
782000 -- (-545.121) (-545.434) (-542.427) [-542.918] * (-544.070) (-543.410) (-545.747) [-543.799] -- 0:00:13
782500 -- (-547.385) (-545.079) (-542.402) [-546.399] * [-543.723] (-546.257) (-545.252) (-543.388) -- 0:00:13
783000 -- (-546.901) [-545.719] (-543.703) (-544.157) * (-544.225) (-548.317) (-543.140) [-544.536] -- 0:00:13
783500 -- (-549.209) (-544.568) [-546.418] (-542.219) * (-542.922) (-544.357) (-545.763) [-543.215] -- 0:00:13
784000 -- (-544.787) (-545.758) [-544.967] (-542.240) * (-543.946) (-544.432) [-543.285] (-543.625) -- 0:00:13
784500 -- (-546.679) (-543.595) (-545.323) [-543.412] * (-545.105) (-543.434) [-546.052] (-543.139) -- 0:00:13
785000 -- [-546.262] (-546.519) (-547.629) (-548.177) * (-545.268) [-543.657] (-544.485) (-543.110) -- 0:00:13
Average standard deviation of split frequencies: 0.005398
785500 -- (-544.182) [-544.219] (-548.106) (-544.886) * (-546.898) (-553.091) [-546.670] (-542.868) -- 0:00:13
786000 -- [-543.746] (-544.008) (-542.799) (-543.237) * (-544.078) [-546.400] (-547.984) (-544.440) -- 0:00:13
786500 -- [-542.344] (-545.081) (-544.839) (-543.841) * (-542.759) (-544.564) [-544.852] (-542.544) -- 0:00:13
787000 -- (-543.239) [-544.451] (-544.929) (-544.972) * (-544.300) (-543.868) (-543.425) [-544.663] -- 0:00:12
787500 -- [-543.412] (-543.761) (-543.433) (-546.891) * [-543.183] (-545.272) (-547.094) (-549.679) -- 0:00:12
788000 -- (-544.851) [-546.859] (-546.390) (-547.636) * [-544.943] (-543.929) (-549.744) (-551.193) -- 0:00:12
788500 -- (-545.928) (-546.842) [-549.524] (-544.293) * (-544.277) (-550.798) (-544.819) [-545.713] -- 0:00:12
789000 -- (-544.388) (-544.391) [-545.670] (-547.063) * (-542.771) (-545.105) [-543.997] (-544.512) -- 0:00:12
789500 -- [-545.142] (-544.978) (-546.060) (-547.829) * (-543.882) (-546.312) (-544.507) [-543.448] -- 0:00:12
790000 -- (-546.671) (-545.158) [-543.974] (-549.061) * (-543.209) (-546.168) [-543.446] (-542.648) -- 0:00:12
Average standard deviation of split frequencies: 0.005684
790500 -- (-542.169) [-543.581] (-542.541) (-542.822) * (-544.420) (-544.123) (-545.179) [-542.210] -- 0:00:12
791000 -- [-543.943] (-543.162) (-544.011) (-543.332) * [-545.778] (-544.927) (-544.420) (-542.894) -- 0:00:12
791500 -- (-547.712) (-543.306) (-544.600) [-545.641] * (-549.899) [-543.537] (-545.836) (-545.487) -- 0:00:12
792000 -- (-548.795) (-545.479) [-545.131] (-548.450) * (-548.811) (-544.156) (-545.868) [-543.023] -- 0:00:12
792500 -- (-545.613) (-545.246) [-543.348] (-544.478) * (-542.489) [-542.962] (-543.589) (-542.777) -- 0:00:12
793000 -- (-544.562) (-543.932) (-543.004) [-543.717] * (-542.966) (-542.378) (-545.141) [-544.296] -- 0:00:12
793500 -- (-546.705) [-545.237] (-544.275) (-546.251) * [-542.583] (-544.805) (-543.932) (-544.784) -- 0:00:12
794000 -- (-544.851) (-544.685) (-543.554) [-549.033] * [-543.065] (-545.826) (-544.781) (-543.714) -- 0:00:12
794500 -- (-547.740) (-552.845) (-543.550) [-542.105] * [-543.804] (-549.474) (-551.412) (-545.938) -- 0:00:12
795000 -- [-546.034] (-547.105) (-544.106) (-545.543) * (-550.759) [-544.944] (-544.777) (-542.729) -- 0:00:12
Average standard deviation of split frequencies: 0.005922
795500 -- (-544.879) (-545.806) [-543.181] (-542.490) * (-550.936) [-543.022] (-545.941) (-544.740) -- 0:00:12
796000 -- [-543.575] (-542.835) (-543.089) (-545.422) * [-543.424] (-544.013) (-543.800) (-545.357) -- 0:00:12
796500 -- [-543.368] (-544.012) (-545.336) (-543.278) * [-542.975] (-542.920) (-544.126) (-542.924) -- 0:00:12
797000 -- [-543.304] (-543.291) (-544.349) (-545.162) * [-543.695] (-542.654) (-543.202) (-543.177) -- 0:00:12
797500 -- (-542.985) [-545.272] (-546.719) (-544.708) * (-551.835) [-545.990] (-543.268) (-543.123) -- 0:00:12
798000 -- (-551.012) (-544.744) [-544.926] (-545.676) * (-546.098) (-545.439) [-544.841] (-548.902) -- 0:00:12
798500 -- [-546.693] (-544.298) (-545.938) (-543.687) * (-546.099) (-543.786) [-543.249] (-548.426) -- 0:00:12
799000 -- [-548.053] (-547.224) (-543.911) (-543.997) * (-542.769) (-548.569) [-544.272] (-546.448) -- 0:00:12
799500 -- (-545.904) (-545.846) (-550.025) [-543.639] * [-542.964] (-542.982) (-545.364) (-547.576) -- 0:00:12
800000 -- (-543.311) (-545.062) (-544.222) [-544.958] * (-545.461) (-545.085) (-546.221) [-543.763] -- 0:00:12
Average standard deviation of split frequencies: 0.006072
800500 -- [-543.052] (-551.246) (-546.605) (-542.582) * (-548.201) (-544.085) [-543.931] (-550.422) -- 0:00:12
801000 -- [-542.775] (-548.018) (-548.173) (-542.443) * [-545.416] (-546.366) (-543.168) (-549.759) -- 0:00:12
801500 -- (-542.978) [-544.447] (-542.986) (-545.762) * (-544.541) (-547.667) (-544.307) [-546.832] -- 0:00:12
802000 -- (-543.776) (-552.184) (-544.197) [-543.194] * [-543.851] (-545.726) (-544.165) (-544.486) -- 0:00:12
802500 -- [-544.272] (-546.247) (-550.104) (-542.716) * (-547.402) [-546.258] (-543.138) (-547.906) -- 0:00:12
803000 -- (-545.237) (-545.886) [-544.686] (-543.273) * [-543.410] (-544.804) (-543.627) (-543.758) -- 0:00:12
803500 -- (-545.192) [-543.200] (-546.176) (-546.183) * [-544.273] (-543.934) (-542.827) (-547.147) -- 0:00:11
804000 -- (-544.954) (-544.632) (-545.195) [-544.179] * (-543.648) (-542.930) (-543.641) [-544.178] -- 0:00:11
804500 -- (-543.478) (-543.111) (-545.912) [-546.803] * (-544.842) (-543.236) [-547.456] (-546.729) -- 0:00:11
805000 -- (-544.616) (-543.590) [-542.595] (-546.169) * [-543.737] (-548.744) (-543.455) (-544.018) -- 0:00:11
Average standard deviation of split frequencies: 0.005995
805500 -- (-544.699) (-544.052) (-545.471) [-543.313] * (-543.695) (-548.742) (-543.647) [-543.902] -- 0:00:11
806000 -- (-545.856) (-544.568) (-543.442) [-542.795] * [-542.935] (-544.139) (-544.558) (-544.545) -- 0:00:11
806500 -- (-546.753) (-543.516) [-542.547] (-544.530) * (-542.096) [-543.806] (-543.339) (-544.661) -- 0:00:11
807000 -- [-545.226] (-546.603) (-547.679) (-542.935) * (-542.222) (-546.240) (-543.029) [-544.280] -- 0:00:11
807500 -- (-546.443) [-544.403] (-545.204) (-542.751) * (-545.360) (-545.578) [-542.911] (-549.089) -- 0:00:11
808000 -- [-542.985] (-543.278) (-545.316) (-543.994) * (-544.239) [-544.146] (-546.739) (-544.863) -- 0:00:11
808500 -- (-545.876) (-545.094) [-543.530] (-543.228) * (-550.150) (-544.075) (-542.826) [-544.939] -- 0:00:11
809000 -- (-545.327) (-547.192) [-544.238] (-543.547) * [-544.233] (-544.187) (-544.795) (-543.320) -- 0:00:11
809500 -- [-547.096] (-542.835) (-543.407) (-543.562) * [-544.049] (-544.346) (-544.899) (-544.251) -- 0:00:11
810000 -- [-542.764] (-545.532) (-545.762) (-543.697) * [-544.343] (-545.207) (-544.570) (-542.945) -- 0:00:11
Average standard deviation of split frequencies: 0.006178
810500 -- [-543.827] (-544.617) (-543.775) (-544.650) * (-544.590) (-542.488) [-545.345] (-543.708) -- 0:00:11
811000 -- (-543.832) [-543.637] (-543.353) (-548.321) * [-544.741] (-547.162) (-543.452) (-545.789) -- 0:00:11
811500 -- [-543.263] (-543.466) (-542.885) (-548.154) * (-545.544) [-542.685] (-542.631) (-546.168) -- 0:00:11
812000 -- [-545.930] (-545.652) (-543.457) (-544.033) * (-543.778) (-546.428) [-545.847] (-545.109) -- 0:00:11
812500 -- (-545.179) (-544.012) [-544.276] (-543.481) * (-545.718) (-547.080) (-543.789) [-541.994] -- 0:00:11
813000 -- (-548.651) (-543.223) [-546.673] (-543.210) * (-546.236) [-543.824] (-546.518) (-545.405) -- 0:00:11
813500 -- (-546.229) (-543.524) [-543.196] (-543.705) * [-544.111] (-543.649) (-543.344) (-544.136) -- 0:00:11
814000 -- [-544.356] (-546.016) (-544.114) (-545.277) * (-544.619) (-544.177) [-547.295] (-543.238) -- 0:00:11
814500 -- [-542.305] (-552.005) (-544.276) (-547.092) * (-545.109) [-543.133] (-544.215) (-543.286) -- 0:00:11
815000 -- (-545.610) [-547.361] (-547.328) (-547.592) * [-542.535] (-542.745) (-544.532) (-543.825) -- 0:00:11
Average standard deviation of split frequencies: 0.006571
815500 -- (-545.118) (-547.414) (-543.569) [-542.471] * (-543.187) (-543.696) [-544.135] (-544.640) -- 0:00:11
816000 -- [-544.276] (-542.895) (-543.099) (-542.919) * (-542.637) (-545.318) (-544.092) [-543.882] -- 0:00:11
816500 -- [-544.748] (-543.615) (-544.155) (-545.151) * (-544.821) [-543.571] (-543.213) (-542.873) -- 0:00:11
817000 -- (-547.730) (-542.909) [-542.750] (-543.829) * (-545.980) [-543.278] (-547.076) (-544.803) -- 0:00:11
817500 -- (-543.317) [-547.138] (-542.585) (-546.184) * (-546.020) (-548.869) (-547.163) [-543.618] -- 0:00:11
818000 -- [-543.739] (-543.113) (-544.869) (-543.212) * (-543.946) (-543.278) (-545.474) [-545.721] -- 0:00:11
818500 -- (-547.809) [-544.848] (-543.447) (-543.460) * (-545.366) (-544.997) (-545.606) [-544.929] -- 0:00:11
819000 -- (-548.958) (-545.980) [-543.328] (-544.259) * (-546.925) (-546.775) (-547.201) [-547.071] -- 0:00:11
819500 -- (-548.414) (-545.732) [-542.671] (-544.348) * (-544.830) (-542.637) [-542.094] (-547.234) -- 0:00:11
820000 -- [-545.324] (-545.683) (-542.652) (-547.767) * (-544.982) (-546.469) [-544.489] (-545.421) -- 0:00:10
Average standard deviation of split frequencies: 0.006606
820500 -- [-543.357] (-545.140) (-545.456) (-545.223) * [-542.941] (-548.526) (-544.160) (-543.225) -- 0:00:10
821000 -- (-542.635) [-547.785] (-544.947) (-543.013) * (-542.842) (-545.343) [-546.568] (-543.197) -- 0:00:10
821500 -- [-547.756] (-543.598) (-543.121) (-544.567) * [-543.871] (-544.976) (-547.374) (-542.590) -- 0:00:10
822000 -- (-548.298) (-547.043) (-544.738) [-544.053] * (-555.361) (-546.340) [-542.970] (-546.593) -- 0:00:10
822500 -- (-546.785) (-548.786) (-545.930) [-543.470] * (-545.211) (-549.398) [-544.927] (-543.471) -- 0:00:10
823000 -- (-549.496) [-543.262] (-543.624) (-544.179) * [-545.485] (-546.538) (-545.396) (-544.540) -- 0:00:10
823500 -- (-547.863) [-545.991] (-544.773) (-542.852) * (-544.231) (-545.824) (-543.219) [-543.236] -- 0:00:10
824000 -- (-547.033) [-545.068] (-544.064) (-544.439) * (-543.950) [-545.548] (-543.741) (-546.148) -- 0:00:10
824500 -- (-546.088) [-542.654] (-544.121) (-545.719) * (-546.629) [-542.105] (-543.482) (-544.239) -- 0:00:10
825000 -- (-544.252) (-545.167) [-543.864] (-543.448) * [-543.889] (-544.350) (-545.544) (-546.303) -- 0:00:10
Average standard deviation of split frequencies: 0.006278
825500 -- (-542.782) (-544.477) (-548.061) [-542.175] * (-545.067) [-542.449] (-546.975) (-544.565) -- 0:00:10
826000 -- [-542.777] (-545.334) (-544.323) (-546.602) * [-544.647] (-542.763) (-542.509) (-542.721) -- 0:00:10
826500 -- (-542.987) (-543.518) (-543.585) [-543.767] * (-542.670) [-545.023] (-544.790) (-543.251) -- 0:00:10
827000 -- (-543.058) (-543.626) [-544.232] (-543.452) * (-543.190) (-543.207) [-545.848] (-543.526) -- 0:00:10
827500 -- (-543.972) (-546.966) (-543.569) [-545.061] * [-544.466] (-548.097) (-544.505) (-547.530) -- 0:00:10
828000 -- (-547.975) [-545.125] (-544.209) (-546.479) * (-542.491) (-547.542) (-543.421) [-542.755] -- 0:00:10
828500 -- (-546.853) (-544.158) (-545.834) [-544.590] * (-545.887) (-547.942) [-543.810] (-548.395) -- 0:00:10
829000 -- (-544.029) (-544.637) (-545.351) [-544.664] * (-542.001) (-548.847) [-544.423] (-543.815) -- 0:00:10
829500 -- [-544.502] (-544.492) (-543.267) (-544.914) * (-543.656) [-548.898] (-544.239) (-543.579) -- 0:00:10
830000 -- (-546.375) (-542.731) (-542.843) [-546.252] * (-544.284) (-549.024) [-545.030] (-544.613) -- 0:00:10
Average standard deviation of split frequencies: 0.006668
830500 -- (-546.146) [-542.588] (-544.557) (-545.384) * (-545.479) (-546.996) [-542.318] (-547.897) -- 0:00:10
831000 -- (-544.900) (-542.563) [-543.583] (-542.675) * (-544.107) (-548.814) (-544.492) [-546.082] -- 0:00:10
831500 -- (-545.994) (-545.886) (-544.245) [-543.180] * (-544.383) (-546.427) [-544.945] (-544.098) -- 0:00:10
832000 -- (-546.373) (-548.268) (-544.404) [-542.689] * (-543.553) (-546.556) (-543.509) [-543.357] -- 0:00:10
832500 -- [-542.222] (-546.978) (-547.363) (-544.036) * (-545.777) [-544.886] (-546.369) (-543.923) -- 0:00:10
833000 -- [-543.645] (-543.662) (-543.787) (-543.161) * [-542.949] (-544.545) (-543.139) (-546.236) -- 0:00:10
833500 -- (-542.846) (-543.043) (-545.738) [-544.184] * (-548.706) (-549.770) [-546.626] (-544.963) -- 0:00:10
834000 -- [-543.059] (-542.869) (-546.630) (-546.456) * (-545.283) (-546.078) (-545.902) [-542.550] -- 0:00:10
834500 -- [-542.854] (-544.031) (-542.763) (-543.967) * (-542.361) (-544.559) [-543.778] (-542.377) -- 0:00:10
835000 -- (-542.531) [-543.836] (-542.893) (-544.988) * (-542.744) (-545.086) [-543.354] (-544.061) -- 0:00:10
Average standard deviation of split frequencies: 0.006308
835500 -- [-550.656] (-545.017) (-542.921) (-545.259) * (-544.205) (-544.447) [-544.030] (-545.032) -- 0:00:10
836000 -- [-546.371] (-548.937) (-547.117) (-545.140) * (-542.524) [-544.503] (-542.573) (-544.193) -- 0:00:10
836500 -- [-545.415] (-544.255) (-545.741) (-544.438) * (-543.826) (-544.655) [-544.801] (-546.327) -- 0:00:09
837000 -- (-545.449) [-543.126] (-543.077) (-542.548) * (-544.457) (-543.157) (-544.153) [-543.833] -- 0:00:09
837500 -- [-543.732] (-545.676) (-544.248) (-544.536) * (-544.275) [-543.137] (-548.231) (-546.255) -- 0:00:09
838000 -- (-542.959) (-545.884) (-545.513) [-543.246] * (-543.843) [-543.451] (-543.130) (-544.743) -- 0:00:09
838500 -- [-545.541] (-547.026) (-543.105) (-543.555) * [-544.086] (-542.878) (-543.594) (-549.364) -- 0:00:09
839000 -- (-544.890) [-545.503] (-544.661) (-545.403) * (-543.403) (-544.386) (-543.402) [-544.426] -- 0:00:09
839500 -- (-544.100) (-543.001) (-543.792) [-544.988] * [-543.507] (-545.019) (-544.357) (-544.575) -- 0:00:09
840000 -- (-543.400) (-542.966) [-544.017] (-543.275) * (-543.048) (-543.573) (-546.080) [-544.061] -- 0:00:09
Average standard deviation of split frequencies: 0.006168
840500 -- (-545.834) [-543.014] (-544.843) (-542.848) * [-543.306] (-545.546) (-542.969) (-543.447) -- 0:00:09
841000 -- (-544.017) [-547.411] (-543.793) (-545.369) * [-542.760] (-543.335) (-549.121) (-545.487) -- 0:00:09
841500 -- (-544.188) [-543.866] (-542.251) (-542.474) * (-542.764) (-544.441) (-544.776) [-547.887] -- 0:00:09
842000 -- (-543.393) (-543.149) (-542.378) [-543.180] * [-542.297] (-547.294) (-542.528) (-545.534) -- 0:00:09
842500 -- (-544.364) [-545.907] (-545.076) (-542.911) * [-542.673] (-544.940) (-543.021) (-545.804) -- 0:00:09
843000 -- (-542.805) (-542.777) (-544.327) [-542.379] * [-546.735] (-543.241) (-543.444) (-543.994) -- 0:00:09
843500 -- [-544.493] (-543.960) (-543.451) (-548.102) * (-543.976) [-545.429] (-547.093) (-544.388) -- 0:00:09
844000 -- (-542.951) [-544.898] (-544.391) (-544.876) * (-543.759) (-545.403) (-542.093) [-547.175] -- 0:00:09
844500 -- (-542.625) [-545.687] (-543.550) (-545.277) * [-543.217] (-546.389) (-545.331) (-542.937) -- 0:00:09
845000 -- [-542.515] (-549.154) (-543.869) (-542.509) * (-543.037) [-545.950] (-544.958) (-543.073) -- 0:00:09
Average standard deviation of split frequencies: 0.005990
845500 -- (-545.334) (-543.306) [-543.165] (-543.268) * [-546.195] (-542.287) (-542.538) (-543.494) -- 0:00:09
846000 -- (-542.467) [-543.629] (-544.614) (-546.371) * [-544.289] (-546.106) (-543.182) (-544.225) -- 0:00:09
846500 -- [-546.173] (-544.404) (-542.392) (-544.293) * [-543.473] (-543.611) (-543.162) (-543.478) -- 0:00:09
847000 -- [-542.697] (-544.227) (-542.516) (-542.929) * (-543.916) (-543.842) [-543.860] (-544.727) -- 0:00:09
847500 -- (-542.980) (-543.013) (-543.826) [-542.925] * (-544.381) (-544.114) [-543.362] (-543.050) -- 0:00:09
848000 -- (-545.540) [-544.475] (-546.139) (-544.428) * (-543.731) (-542.994) (-542.585) [-542.564] -- 0:00:09
848500 -- [-544.163] (-545.042) (-544.158) (-543.817) * [-544.066] (-543.251) (-544.449) (-542.672) -- 0:00:09
849000 -- (-543.462) (-543.958) [-543.868] (-544.651) * (-543.471) (-542.418) [-545.542] (-543.094) -- 0:00:09
849500 -- [-545.270] (-543.339) (-544.495) (-543.335) * (-543.589) (-544.445) [-542.997] (-546.812) -- 0:00:09
850000 -- (-547.351) (-542.745) (-544.732) [-549.060] * (-545.888) (-545.134) (-542.934) [-547.200] -- 0:00:09
Average standard deviation of split frequencies: 0.006130
850500 -- [-543.393] (-546.961) (-545.041) (-545.147) * (-546.365) (-544.682) [-545.790] (-543.463) -- 0:00:09
851000 -- (-545.272) [-543.510] (-543.988) (-544.519) * (-546.610) (-544.809) (-546.192) [-543.790] -- 0:00:09
851500 -- (-545.079) (-542.402) [-544.476] (-547.441) * [-543.265] (-549.464) (-546.949) (-547.453) -- 0:00:09
852000 -- (-548.372) (-542.709) (-546.830) [-546.398] * (-544.195) [-543.682] (-548.073) (-544.731) -- 0:00:09
852500 -- (-543.504) (-544.033) (-547.163) [-543.872] * (-544.274) (-544.568) [-545.717] (-546.615) -- 0:00:08
853000 -- (-545.851) (-542.796) [-543.143] (-544.869) * [-545.133] (-551.001) (-549.151) (-548.276) -- 0:00:08
853500 -- (-547.467) [-549.312] (-544.042) (-546.381) * (-547.873) [-546.684] (-543.984) (-548.919) -- 0:00:08
854000 -- (-546.762) (-544.065) (-545.003) [-546.381] * [-544.679] (-544.812) (-545.777) (-543.749) -- 0:00:08
854500 -- (-542.963) [-545.169] (-545.402) (-544.899) * (-543.543) (-546.121) [-544.424] (-543.272) -- 0:00:08
855000 -- [-542.741] (-544.342) (-546.358) (-546.227) * (-542.211) (-545.605) [-544.254] (-544.476) -- 0:00:08
Average standard deviation of split frequencies: 0.005748
855500 -- (-543.664) [-545.095] (-548.775) (-545.659) * (-547.785) (-547.944) [-543.742] (-544.131) -- 0:00:08
856000 -- (-544.888) (-544.905) (-542.722) [-543.693] * [-549.040] (-543.996) (-544.497) (-544.927) -- 0:00:08
856500 -- (-546.347) [-544.511] (-545.371) (-547.954) * (-543.939) (-546.682) [-543.012] (-545.113) -- 0:00:08
857000 -- (-543.484) (-549.181) (-545.634) [-551.886] * [-544.606] (-543.932) (-545.504) (-546.241) -- 0:00:08
857500 -- (-543.484) (-549.858) [-543.335] (-544.780) * [-542.206] (-549.769) (-545.471) (-543.810) -- 0:00:08
858000 -- (-547.976) (-548.980) (-544.084) [-543.961] * (-542.931) (-542.707) (-543.165) [-543.957] -- 0:00:08
858500 -- (-545.715) (-543.916) (-544.701) [-542.662] * (-543.170) (-545.081) (-542.819) [-543.421] -- 0:00:08
859000 -- (-545.951) (-543.872) (-547.992) [-543.096] * [-546.117] (-544.850) (-548.646) (-543.977) -- 0:00:08
859500 -- (-545.503) (-543.739) [-546.335] (-543.068) * [-543.235] (-546.535) (-544.143) (-545.281) -- 0:00:08
860000 -- (-544.206) (-544.035) (-544.600) [-543.115] * (-542.936) (-543.219) [-546.354] (-544.973) -- 0:00:08
Average standard deviation of split frequencies: 0.005648
860500 -- (-543.132) (-545.971) (-549.664) [-543.775] * (-544.774) [-543.534] (-543.737) (-547.974) -- 0:00:08
861000 -- (-543.264) (-546.028) [-546.877] (-544.006) * (-544.120) [-544.229] (-544.475) (-547.717) -- 0:00:08
861500 -- (-549.184) (-547.040) (-543.119) [-543.070] * (-547.429) (-544.271) [-543.140] (-543.805) -- 0:00:08
862000 -- (-542.648) (-545.192) [-548.245] (-544.732) * (-543.787) (-548.871) (-542.792) [-543.951] -- 0:00:08
862500 -- (-542.167) (-542.276) [-546.011] (-543.346) * [-544.081] (-546.683) (-543.632) (-542.397) -- 0:00:08
863000 -- (-543.404) (-543.494) (-544.506) [-544.095] * (-542.854) [-544.841] (-542.946) (-543.355) -- 0:00:08
863500 -- [-543.838] (-545.115) (-546.300) (-543.466) * (-542.944) [-543.523] (-544.352) (-544.439) -- 0:00:08
864000 -- [-544.105] (-544.433) (-544.597) (-542.798) * (-544.965) (-546.583) (-543.750) [-544.974] -- 0:00:08
864500 -- (-543.927) (-542.991) (-544.243) [-544.793] * (-544.251) [-548.147] (-545.373) (-545.229) -- 0:00:08
865000 -- (-543.223) (-544.249) (-544.264) [-543.637] * (-544.227) (-548.630) (-544.340) [-544.996] -- 0:00:08
Average standard deviation of split frequencies: 0.006022
865500 -- [-546.325] (-546.098) (-542.273) (-546.016) * (-547.291) [-546.911] (-544.866) (-545.332) -- 0:00:08
866000 -- [-543.606] (-545.163) (-543.057) (-543.447) * (-546.910) [-547.275] (-542.520) (-549.758) -- 0:00:08
866500 -- (-543.178) (-546.320) (-546.070) [-543.899] * (-546.271) (-548.502) (-542.489) [-542.600] -- 0:00:08
867000 -- [-543.158] (-545.652) (-543.096) (-543.990) * (-545.620) [-547.041] (-543.117) (-542.676) -- 0:00:08
867500 -- [-542.218] (-543.315) (-544.045) (-544.309) * [-545.472] (-545.124) (-544.170) (-546.529) -- 0:00:08
868000 -- [-542.327] (-546.316) (-542.709) (-544.472) * (-543.054) (-544.452) (-546.131) [-543.219] -- 0:00:08
868500 -- (-544.366) [-544.643] (-546.072) (-543.470) * [-544.233] (-546.494) (-545.372) (-547.715) -- 0:00:08
869000 -- (-543.178) (-544.761) (-545.677) [-543.475] * [-543.474] (-544.253) (-546.156) (-543.287) -- 0:00:07
869500 -- (-545.151) (-545.467) [-543.779] (-543.632) * (-542.745) [-544.263] (-543.603) (-542.789) -- 0:00:07
870000 -- (-544.513) (-544.683) (-547.582) [-544.481] * (-543.322) (-544.295) [-543.447] (-544.020) -- 0:00:07
Average standard deviation of split frequencies: 0.006057
870500 -- (-546.807) (-545.619) (-551.949) [-544.148] * (-542.424) [-544.130] (-545.175) (-546.170) -- 0:00:07
871000 -- (-549.213) [-542.121] (-553.274) (-542.907) * (-544.415) (-543.311) [-543.096] (-544.513) -- 0:00:07
871500 -- (-544.150) (-542.864) (-545.078) [-543.690] * (-543.469) (-543.384) [-542.252] (-546.917) -- 0:00:07
872000 -- (-546.077) (-545.399) (-543.577) [-543.737] * (-544.806) (-546.231) (-545.037) [-547.321] -- 0:00:07
872500 -- (-543.689) (-542.803) [-543.095] (-544.134) * (-544.649) (-545.014) (-543.511) [-545.376] -- 0:00:07
873000 -- (-544.948) (-543.891) [-542.393] (-543.344) * [-545.366] (-545.367) (-543.330) (-543.093) -- 0:00:07
873500 -- (-544.888) (-544.831) [-543.157] (-545.236) * (-544.698) [-544.204] (-543.216) (-543.230) -- 0:00:07
874000 -- (-544.275) [-546.217] (-542.390) (-546.050) * (-543.601) (-551.517) [-542.785] (-544.164) -- 0:00:07
874500 -- (-543.086) (-545.162) [-542.859] (-543.356) * (-546.401) (-547.670) [-543.960] (-544.219) -- 0:00:07
875000 -- (-544.122) (-547.079) (-546.315) [-542.869] * (-547.930) [-543.713] (-545.605) (-544.505) -- 0:00:07
Average standard deviation of split frequencies: 0.006155
875500 -- (-546.353) (-544.580) (-546.586) [-542.337] * [-545.245] (-543.755) (-544.038) (-545.026) -- 0:00:07
876000 -- (-546.094) (-544.711) [-545.234] (-542.505) * (-543.155) (-543.617) (-544.918) [-543.621] -- 0:00:07
876500 -- (-544.992) (-553.066) [-542.900] (-544.547) * [-544.339] (-544.503) (-550.339) (-544.039) -- 0:00:07
877000 -- (-545.738) (-555.127) (-542.609) [-542.971] * (-543.277) [-543.284] (-543.783) (-546.655) -- 0:00:07
877500 -- [-542.529] (-554.122) (-543.774) (-546.651) * (-546.372) [-543.334] (-544.522) (-543.867) -- 0:00:07
878000 -- [-543.514] (-544.176) (-542.460) (-544.018) * [-542.894] (-547.182) (-543.729) (-543.903) -- 0:00:07
878500 -- (-542.402) [-546.357] (-544.320) (-544.593) * (-545.000) (-543.320) [-543.353] (-542.638) -- 0:00:07
879000 -- (-542.378) (-546.195) (-544.218) [-546.151] * (-545.464) [-543.150] (-551.893) (-546.578) -- 0:00:07
879500 -- (-543.086) (-544.756) [-546.139] (-543.288) * (-545.535) [-545.081] (-545.502) (-545.638) -- 0:00:07
880000 -- (-543.214) (-545.197) [-543.709] (-543.113) * (-545.443) (-544.663) [-542.341] (-542.366) -- 0:00:07
Average standard deviation of split frequencies: 0.006356
880500 -- [-543.643] (-544.722) (-544.617) (-542.524) * (-544.979) (-548.901) (-544.214) [-544.332] -- 0:00:07
881000 -- (-542.808) (-543.017) [-542.568] (-543.154) * (-543.366) (-550.133) (-544.279) [-543.174] -- 0:00:07
881500 -- (-544.842) (-543.726) (-548.356) [-546.214] * (-543.161) (-545.315) [-543.745] (-544.462) -- 0:00:07
882000 -- (-543.928) (-543.467) [-543.793] (-544.868) * (-545.144) [-545.372] (-544.465) (-543.237) -- 0:00:07
882500 -- [-542.765] (-543.740) (-545.831) (-546.587) * (-545.013) [-546.937] (-546.104) (-544.295) -- 0:00:07
883000 -- (-544.976) (-544.049) (-544.513) [-545.713] * [-545.620] (-545.773) (-546.179) (-544.972) -- 0:00:07
883500 -- (-543.844) [-543.858] (-548.360) (-546.322) * (-545.446) (-542.606) [-543.531] (-544.598) -- 0:00:07
884000 -- [-544.793] (-542.893) (-548.987) (-543.973) * (-542.425) [-543.072] (-545.836) (-548.352) -- 0:00:07
884500 -- [-543.892] (-543.955) (-546.145) (-543.489) * (-546.882) (-544.174) [-542.982] (-543.232) -- 0:00:07
885000 -- [-545.453] (-542.475) (-545.372) (-543.125) * (-543.993) [-543.354] (-546.508) (-545.295) -- 0:00:07
Average standard deviation of split frequencies: 0.006285
885500 -- [-547.023] (-543.685) (-547.912) (-543.838) * (-546.613) (-544.148) [-545.534] (-544.053) -- 0:00:06
886000 -- (-545.922) [-543.773] (-546.125) (-543.144) * (-544.080) (-543.311) (-545.670) [-542.276] -- 0:00:06
886500 -- (-542.742) (-543.171) [-543.025] (-542.955) * (-546.014) (-542.696) (-544.632) [-543.857] -- 0:00:06
887000 -- (-544.905) (-543.707) [-543.960] (-542.932) * (-546.382) (-543.119) (-543.198) [-544.679] -- 0:00:06
887500 -- [-543.075] (-545.194) (-544.859) (-545.486) * [-543.312] (-544.127) (-544.750) (-547.737) -- 0:00:06
888000 -- (-542.398) (-543.759) (-548.821) [-543.178] * (-545.577) (-543.391) [-546.746] (-547.636) -- 0:00:06
888500 -- (-544.107) (-545.417) [-544.303] (-542.137) * [-542.681] (-543.158) (-545.639) (-544.511) -- 0:00:06
889000 -- [-542.869] (-548.512) (-544.834) (-543.912) * [-546.313] (-543.467) (-542.716) (-547.487) -- 0:00:06
889500 -- (-544.174) (-544.179) (-545.967) [-545.038] * (-547.665) (-543.217) [-543.059] (-544.020) -- 0:00:06
890000 -- (-542.291) [-543.843] (-547.634) (-546.114) * (-549.432) (-543.299) [-542.261] (-544.488) -- 0:00:06
Average standard deviation of split frequencies: 0.006102
890500 -- [-545.840] (-548.779) (-543.670) (-542.255) * (-546.101) (-545.321) (-542.185) [-542.803] -- 0:00:06
891000 -- (-544.745) [-545.432] (-545.397) (-544.869) * (-542.205) (-547.139) (-542.598) [-545.333] -- 0:00:06
891500 -- (-545.364) [-546.240] (-544.599) (-543.594) * (-543.810) [-543.260] (-543.856) (-547.270) -- 0:00:06
892000 -- [-544.494] (-545.307) (-544.160) (-543.028) * (-543.652) [-542.764] (-544.000) (-548.711) -- 0:00:06
892500 -- [-544.304] (-545.778) (-545.733) (-543.851) * (-543.736) [-544.272] (-543.980) (-543.236) -- 0:00:06
893000 -- [-544.098] (-545.418) (-544.583) (-545.164) * (-545.540) (-544.569) (-543.319) [-543.354] -- 0:00:06
893500 -- (-546.561) [-544.258] (-547.077) (-542.524) * (-546.999) (-546.295) [-545.838] (-548.911) -- 0:00:06
894000 -- [-543.938] (-551.497) (-544.915) (-546.238) * (-544.315) (-543.877) (-545.695) [-547.114] -- 0:00:06
894500 -- (-547.784) (-551.959) [-543.353] (-544.146) * (-546.487) [-543.879] (-542.344) (-545.309) -- 0:00:06
895000 -- (-547.160) (-546.876) (-544.793) [-543.897] * (-546.401) [-544.779] (-544.800) (-546.358) -- 0:00:06
Average standard deviation of split frequencies: 0.006083
895500 -- (-544.425) [-547.974] (-543.176) (-542.839) * [-542.735] (-548.754) (-543.131) (-544.930) -- 0:00:06
896000 -- (-544.142) [-545.795] (-548.001) (-546.526) * (-544.439) (-543.659) [-545.801] (-544.329) -- 0:00:06
896500 -- (-547.832) (-543.515) (-544.582) [-543.110] * (-545.170) [-544.013] (-550.718) (-549.569) -- 0:00:06
897000 -- [-545.488] (-545.611) (-546.388) (-544.233) * (-543.980) [-549.074] (-546.099) (-543.159) -- 0:00:06
897500 -- (-542.910) (-542.913) (-545.312) [-544.266] * (-543.767) (-542.734) (-545.966) [-543.150] -- 0:00:06
898000 -- (-543.663) [-542.243] (-545.288) (-542.705) * (-545.108) [-542.504] (-548.867) (-544.719) -- 0:00:06
898500 -- (-543.438) [-543.061] (-546.923) (-544.378) * [-544.058] (-545.360) (-550.215) (-543.814) -- 0:00:06
899000 -- (-546.428) (-545.399) [-544.807] (-545.963) * (-545.162) (-549.200) [-544.287] (-547.891) -- 0:00:06
899500 -- (-548.225) (-543.406) [-544.844] (-546.644) * (-545.161) [-543.364] (-545.405) (-545.020) -- 0:00:06
900000 -- [-543.766] (-543.667) (-543.232) (-545.283) * (-543.031) (-543.402) (-544.778) [-543.797] -- 0:00:06
Average standard deviation of split frequencies: 0.005986
900500 -- (-545.796) (-545.492) (-542.808) [-544.272] * (-547.330) (-544.040) [-543.064] (-542.264) -- 0:00:06
901000 -- (-546.404) (-544.380) [-542.238] (-542.560) * [-543.915] (-544.805) (-545.207) (-542.913) -- 0:00:06
901500 -- (-547.004) [-546.298] (-542.572) (-543.196) * (-543.475) (-546.700) (-546.420) [-543.563] -- 0:00:06
902000 -- [-544.975] (-543.835) (-543.617) (-547.607) * [-544.041] (-542.860) (-546.829) (-543.679) -- 0:00:05
902500 -- (-544.091) [-545.267] (-545.295) (-543.831) * (-548.079) (-544.595) (-543.063) [-542.832] -- 0:00:05
903000 -- (-544.776) (-542.950) [-545.578] (-543.947) * (-545.087) (-542.534) [-544.455] (-543.588) -- 0:00:05
903500 -- (-545.372) (-544.263) (-545.874) [-544.062] * (-544.508) (-546.463) [-543.295] (-542.537) -- 0:00:05
904000 -- [-545.923] (-546.966) (-543.400) (-544.331) * (-545.683) (-545.228) (-543.284) [-545.171] -- 0:00:05
904500 -- [-543.619] (-547.776) (-546.241) (-543.236) * (-546.740) (-543.960) [-543.283] (-547.330) -- 0:00:05
905000 -- (-544.423) (-545.910) (-546.566) [-544.810] * [-544.780] (-543.660) (-550.467) (-542.397) -- 0:00:05
Average standard deviation of split frequencies: 0.006179
905500 -- (-546.582) (-542.941) [-544.222] (-546.706) * (-544.273) (-544.973) (-543.013) [-544.327] -- 0:00:05
906000 -- (-544.116) (-544.010) [-543.774] (-543.989) * (-543.647) [-545.085] (-544.243) (-545.321) -- 0:00:05
906500 -- (-542.872) (-546.124) (-543.299) [-546.884] * [-547.105] (-542.725) (-546.578) (-544.328) -- 0:00:05
907000 -- [-542.954] (-544.678) (-543.968) (-543.277) * [-546.547] (-542.971) (-551.632) (-542.818) -- 0:00:05
907500 -- [-544.397] (-545.281) (-544.199) (-543.410) * (-545.233) [-543.728] (-546.399) (-544.513) -- 0:00:05
908000 -- (-543.540) (-544.092) (-544.321) [-543.823] * (-546.385) (-545.026) (-547.555) [-545.193] -- 0:00:05
908500 -- (-546.159) [-543.779] (-543.832) (-544.536) * (-542.365) [-544.116] (-543.405) (-543.688) -- 0:00:05
909000 -- [-544.136] (-544.484) (-543.859) (-543.655) * (-544.639) (-545.134) [-544.424] (-545.253) -- 0:00:05
909500 -- (-544.155) [-542.983] (-542.895) (-544.415) * (-546.275) [-543.296] (-545.621) (-547.180) -- 0:00:05
910000 -- [-543.900] (-545.104) (-545.787) (-543.171) * (-542.804) (-544.168) [-543.608] (-543.237) -- 0:00:05
Average standard deviation of split frequencies: 0.006438
910500 -- (-545.560) (-545.072) [-544.120] (-544.818) * [-542.488] (-543.175) (-545.205) (-543.832) -- 0:00:05
911000 -- (-543.371) (-543.091) [-543.856] (-544.128) * (-543.056) [-546.047] (-542.791) (-543.304) -- 0:00:05
911500 -- (-543.157) (-543.798) [-542.734] (-542.585) * [-543.923] (-545.303) (-546.815) (-547.021) -- 0:00:05
912000 -- (-543.538) [-544.870] (-544.656) (-544.425) * (-548.710) (-542.059) (-545.551) [-547.265] -- 0:00:05
912500 -- (-542.460) [-546.268] (-545.493) (-543.376) * (-544.778) (-544.826) [-546.796] (-543.690) -- 0:00:05
913000 -- [-545.402] (-544.923) (-545.851) (-542.483) * (-542.777) (-543.705) [-543.624] (-546.617) -- 0:00:05
913500 -- (-542.793) (-543.442) [-544.143] (-543.053) * [-542.485] (-547.914) (-545.857) (-547.757) -- 0:00:05
914000 -- (-543.681) (-542.049) (-544.286) [-544.622] * (-547.607) (-546.186) (-546.747) [-544.999] -- 0:00:05
914500 -- (-544.405) [-549.120] (-548.044) (-544.355) * (-546.633) (-542.598) [-544.970] (-542.717) -- 0:00:05
915000 -- (-544.071) (-543.730) (-543.472) [-543.254] * [-544.583] (-543.847) (-547.324) (-544.116) -- 0:00:05
Average standard deviation of split frequencies: 0.005950
915500 -- [-543.625] (-543.400) (-544.156) (-547.441) * (-543.892) (-542.902) [-546.728] (-545.231) -- 0:00:05
916000 -- (-543.527) [-546.076] (-545.061) (-545.770) * [-542.407] (-544.041) (-542.601) (-556.113) -- 0:00:05
916500 -- (-547.234) (-544.717) [-542.679] (-544.995) * (-544.304) (-543.969) (-544.496) [-550.119] -- 0:00:05
917000 -- (-545.232) [-544.005] (-542.638) (-544.771) * (-543.051) [-542.839] (-545.377) (-548.952) -- 0:00:05
917500 -- (-546.014) [-543.598] (-542.741) (-542.172) * (-543.685) (-542.669) (-543.526) [-545.088] -- 0:00:05
918000 -- (-546.424) [-542.895] (-543.753) (-546.551) * (-543.890) (-543.249) (-545.832) [-546.083] -- 0:00:05
918500 -- (-550.434) (-546.341) (-545.775) [-544.327] * [-542.188] (-544.342) (-544.703) (-544.298) -- 0:00:04
919000 -- (-546.348) [-545.096] (-548.036) (-547.317) * (-543.378) (-543.797) [-545.510] (-544.503) -- 0:00:04
919500 -- (-543.138) [-547.116] (-548.571) (-543.550) * (-542.765) [-544.505] (-546.426) (-544.007) -- 0:00:04
920000 -- (-552.569) (-546.683) [-543.955] (-542.907) * [-543.555] (-545.091) (-547.168) (-543.722) -- 0:00:04
Average standard deviation of split frequencies: 0.005512
920500 -- (-544.976) (-544.158) (-544.414) [-542.625] * [-543.018] (-546.981) (-543.109) (-543.936) -- 0:00:04
921000 -- (-542.758) [-543.250] (-544.563) (-542.841) * (-542.934) (-543.949) [-546.593] (-546.678) -- 0:00:04
921500 -- [-542.854] (-545.169) (-544.488) (-543.965) * (-545.735) (-542.562) [-543.186] (-544.388) -- 0:00:04
922000 -- [-542.759] (-544.727) (-547.377) (-547.268) * (-545.279) (-544.053) [-543.896] (-545.588) -- 0:00:04
922500 -- (-544.149) (-543.768) (-549.662) [-545.644] * (-545.107) [-544.056] (-544.351) (-545.656) -- 0:00:04
923000 -- (-544.641) (-542.673) [-544.180] (-552.987) * (-544.067) (-544.033) (-543.169) [-547.638] -- 0:00:04
923500 -- (-550.078) [-543.562] (-547.653) (-546.861) * [-542.902] (-542.553) (-546.103) (-543.320) -- 0:00:04
924000 -- (-550.539) [-543.633] (-543.777) (-547.624) * (-544.179) (-543.642) [-544.472] (-543.270) -- 0:00:04
924500 -- (-546.605) (-543.025) (-543.619) [-543.536] * (-545.303) (-543.862) (-547.989) [-544.741] -- 0:00:04
925000 -- (-543.832) (-543.825) (-542.602) [-546.336] * [-544.615] (-545.480) (-547.206) (-543.164) -- 0:00:04
Average standard deviation of split frequencies: 0.005390
925500 -- (-545.058) [-543.625] (-543.953) (-544.649) * (-545.734) (-544.271) (-544.170) [-544.737] -- 0:00:04
926000 -- [-543.009] (-543.602) (-543.930) (-544.037) * (-548.002) (-545.608) (-545.523) [-544.724] -- 0:00:04
926500 -- (-543.195) (-546.702) (-544.065) [-543.327] * (-552.052) [-544.084] (-544.456) (-543.817) -- 0:00:04
927000 -- (-542.807) [-544.126] (-546.498) (-544.763) * (-542.976) (-544.425) (-544.676) [-542.052] -- 0:00:04
927500 -- (-544.599) (-546.099) [-543.854] (-544.433) * (-544.097) (-542.830) [-543.540] (-545.384) -- 0:00:04
928000 -- (-546.333) (-545.342) [-544.905] (-545.747) * (-544.194) (-543.676) (-546.060) [-545.192] -- 0:00:04
928500 -- [-546.455] (-543.678) (-550.613) (-545.830) * (-544.132) (-546.690) [-543.629] (-545.084) -- 0:00:04
929000 -- (-545.370) [-546.580] (-546.473) (-543.064) * (-544.915) (-544.355) [-544.144] (-542.703) -- 0:00:04
929500 -- (-546.110) (-546.413) (-544.144) [-543.341] * (-543.236) [-544.973] (-544.528) (-545.040) -- 0:00:04
930000 -- (-545.047) (-543.595) (-542.772) [-543.708] * (-547.268) (-544.439) (-545.129) [-545.495] -- 0:00:04
Average standard deviation of split frequencies: 0.005363
930500 -- (-547.273) [-544.542] (-543.439) (-542.601) * [-545.385] (-546.048) (-547.127) (-545.988) -- 0:00:04
931000 -- (-547.280) (-543.897) (-542.579) [-546.372] * [-543.784] (-544.722) (-548.946) (-547.242) -- 0:00:04
931500 -- (-546.348) (-543.531) [-543.105] (-547.117) * (-544.991) [-544.877] (-545.829) (-546.088) -- 0:00:04
932000 -- (-546.417) (-545.101) (-542.337) [-546.303] * [-543.050] (-542.728) (-547.242) (-548.058) -- 0:00:04
932500 -- (-546.000) (-544.954) [-543.301] (-545.242) * [-542.934] (-544.711) (-545.344) (-542.529) -- 0:00:04
933000 -- (-543.928) [-545.795] (-543.122) (-548.296) * [-544.611] (-544.510) (-545.814) (-543.903) -- 0:00:04
933500 -- (-544.887) (-544.411) [-543.053] (-549.413) * (-546.451) (-543.713) (-542.681) [-544.202] -- 0:00:04
934000 -- (-544.967) (-547.729) [-545.713] (-548.512) * (-543.399) [-543.194] (-545.737) (-544.045) -- 0:00:04
934500 -- (-545.248) [-545.671] (-547.340) (-543.849) * (-544.395) [-546.547] (-546.439) (-543.981) -- 0:00:03
935000 -- (-545.851) [-543.598] (-544.346) (-544.110) * (-547.658) (-546.955) (-545.723) [-543.677] -- 0:00:03
Average standard deviation of split frequencies: 0.005257
935500 -- (-547.947) [-544.283] (-545.228) (-548.295) * (-543.488) (-545.427) [-543.717] (-544.088) -- 0:00:03
936000 -- (-543.029) [-544.053] (-547.467) (-546.504) * (-542.613) (-545.564) [-544.292] (-545.039) -- 0:00:03
936500 -- (-542.651) [-544.053] (-545.767) (-544.131) * (-543.914) (-547.075) (-544.593) [-545.422] -- 0:00:03
937000 -- (-546.836) [-544.672] (-545.876) (-543.645) * (-544.299) (-544.961) [-542.814] (-543.527) -- 0:00:03
937500 -- (-545.502) (-545.499) [-544.965] (-545.416) * (-544.634) (-543.287) (-544.985) [-545.115] -- 0:00:03
938000 -- [-545.059] (-549.887) (-544.505) (-546.357) * (-545.184) (-546.994) (-547.353) [-546.238] -- 0:00:03
938500 -- (-544.402) (-545.116) (-546.335) [-542.668] * (-545.264) [-545.544] (-545.125) (-544.809) -- 0:00:03
939000 -- (-544.328) (-545.038) (-543.889) [-544.864] * (-547.426) (-545.878) [-546.878] (-544.791) -- 0:00:03
939500 -- (-544.689) (-544.832) [-544.914] (-545.884) * (-544.428) (-546.226) (-545.962) [-542.824] -- 0:00:03
940000 -- (-545.051) (-545.934) [-546.403] (-543.846) * (-550.531) (-545.066) (-547.400) [-542.915] -- 0:00:03
Average standard deviation of split frequencies: 0.005387
940500 -- (-545.570) [-546.337] (-542.771) (-546.846) * (-545.563) (-544.384) (-542.520) [-543.957] -- 0:00:03
941000 -- (-545.371) [-549.464] (-543.318) (-544.575) * (-542.897) (-545.265) [-543.970] (-547.883) -- 0:00:03
941500 -- (-545.618) (-542.724) [-548.898] (-544.121) * (-542.669) (-542.946) [-542.239] (-544.277) -- 0:00:03
942000 -- [-544.500] (-543.274) (-543.711) (-546.229) * (-543.940) (-543.493) (-542.845) [-542.884] -- 0:00:03
942500 -- (-547.305) [-543.282] (-543.749) (-543.681) * [-546.761] (-543.278) (-546.326) (-545.488) -- 0:00:03
943000 -- (-549.234) [-544.693] (-544.899) (-542.904) * (-545.328) (-542.480) [-545.472] (-545.497) -- 0:00:03
943500 -- (-544.233) (-546.487) [-546.866] (-543.888) * (-547.089) (-544.503) [-543.201] (-543.428) -- 0:00:03
944000 -- (-547.159) (-543.628) [-544.482] (-544.414) * (-548.287) (-544.811) [-544.206] (-543.290) -- 0:00:03
944500 -- [-542.614] (-544.076) (-543.202) (-544.488) * (-545.211) (-544.585) [-544.121] (-546.046) -- 0:00:03
945000 -- (-542.327) [-545.409] (-542.813) (-542.570) * (-543.598) (-544.186) (-543.182) [-544.718] -- 0:00:03
Average standard deviation of split frequencies: 0.005159
945500 -- (-543.373) (-546.375) [-543.353] (-544.326) * (-545.320) (-543.107) [-542.078] (-545.853) -- 0:00:03
946000 -- [-543.523] (-542.542) (-544.707) (-543.377) * (-544.119) (-545.803) [-545.998] (-544.884) -- 0:00:03
946500 -- (-542.745) [-542.745] (-544.390) (-545.713) * (-544.858) (-548.914) [-544.019] (-543.020) -- 0:00:03
947000 -- [-543.491] (-544.944) (-543.527) (-545.995) * (-544.410) (-544.774) [-545.845] (-543.925) -- 0:00:03
947500 -- (-545.764) [-544.418] (-550.063) (-547.367) * [-544.153] (-543.894) (-546.296) (-544.947) -- 0:00:03
948000 -- (-543.614) (-544.839) [-544.029] (-547.112) * (-544.096) (-544.155) (-547.917) [-543.378] -- 0:00:03
948500 -- (-543.549) [-543.970] (-546.563) (-545.920) * [-544.662] (-543.755) (-546.612) (-543.709) -- 0:00:03
949000 -- (-543.010) (-543.853) (-547.634) [-543.905] * [-546.072] (-543.154) (-542.704) (-542.513) -- 0:00:03
949500 -- (-543.567) (-544.234) (-544.131) [-542.703] * (-542.561) [-543.784] (-542.386) (-543.824) -- 0:00:03
950000 -- (-543.713) (-543.512) (-544.753) [-542.975] * (-542.772) (-543.717) (-543.459) [-544.829] -- 0:00:03
Average standard deviation of split frequencies: 0.005331
950500 -- (-543.472) (-543.358) (-543.769) [-544.359] * [-542.534] (-542.874) (-542.428) (-544.909) -- 0:00:03
951000 -- [-544.755] (-543.441) (-543.394) (-542.357) * [-546.954] (-542.859) (-543.881) (-549.912) -- 0:00:02
951500 -- [-544.915] (-549.524) (-546.945) (-544.931) * [-543.244] (-543.076) (-543.232) (-547.188) -- 0:00:02
952000 -- (-544.316) [-547.867] (-543.590) (-543.710) * [-545.768] (-542.657) (-543.758) (-544.778) -- 0:00:02
952500 -- (-544.447) (-545.358) (-546.803) [-542.967] * (-542.609) [-543.475] (-546.317) (-543.260) -- 0:00:02
953000 -- [-543.723] (-547.892) (-548.623) (-543.298) * [-545.391] (-545.771) (-543.937) (-544.913) -- 0:00:02
953500 -- [-543.453] (-545.421) (-552.176) (-546.050) * (-548.345) (-547.956) (-543.124) [-543.398] -- 0:00:02
954000 -- [-543.535] (-543.771) (-549.368) (-543.281) * (-547.009) (-547.032) (-543.672) [-543.924] -- 0:00:02
954500 -- (-543.617) (-545.987) [-542.677] (-545.019) * (-547.184) (-550.306) [-543.549] (-545.466) -- 0:00:02
955000 -- (-543.873) (-546.835) (-543.496) [-547.305] * (-544.896) (-549.324) [-544.009] (-543.285) -- 0:00:02
Average standard deviation of split frequencies: 0.005116
955500 -- [-542.522] (-547.616) (-543.984) (-544.769) * (-542.870) (-545.188) [-545.508] (-545.474) -- 0:00:02
956000 -- (-543.122) (-548.884) (-544.355) [-545.240] * (-546.090) [-547.559] (-545.715) (-544.248) -- 0:00:02
956500 -- (-545.383) (-546.423) [-547.512] (-544.445) * (-543.272) (-547.376) [-544.517] (-542.207) -- 0:00:02
957000 -- [-544.706] (-544.773) (-544.993) (-544.164) * (-543.567) [-543.797] (-546.465) (-542.737) -- 0:00:02
957500 -- [-543.398] (-543.945) (-542.912) (-545.501) * (-546.854) [-547.381] (-545.275) (-542.836) -- 0:00:02
958000 -- (-542.961) (-545.279) [-544.414] (-547.267) * (-543.212) [-548.760] (-542.644) (-542.245) -- 0:00:02
958500 -- (-544.352) [-542.303] (-546.398) (-552.466) * [-543.606] (-547.920) (-544.383) (-543.649) -- 0:00:02
959000 -- [-543.023] (-543.660) (-546.232) (-545.723) * (-547.110) [-543.618] (-543.915) (-543.082) -- 0:00:02
959500 -- [-546.951] (-545.008) (-545.585) (-544.005) * (-543.871) (-542.924) [-543.782] (-543.552) -- 0:00:02
960000 -- (-547.258) (-542.590) [-543.617] (-543.673) * (-548.928) (-543.531) [-546.845] (-544.901) -- 0:00:02
Average standard deviation of split frequencies: 0.005201
960500 -- (-547.815) [-543.552] (-544.360) (-545.515) * (-545.391) (-543.669) [-545.242] (-544.766) -- 0:00:02
961000 -- (-543.272) (-546.852) (-545.808) [-543.578] * (-545.063) (-544.556) (-543.481) [-542.691] -- 0:00:02
961500 -- (-546.235) (-543.209) (-546.532) [-544.432] * (-544.069) (-543.477) (-543.701) [-544.271] -- 0:00:02
962000 -- (-544.794) (-543.530) (-544.646) [-543.648] * (-543.046) [-543.558] (-544.608) (-543.642) -- 0:00:02
962500 -- (-546.344) [-545.257] (-547.656) (-545.668) * (-545.086) [-544.804] (-544.266) (-543.125) -- 0:00:02
963000 -- [-543.350] (-543.176) (-546.537) (-547.241) * [-543.960] (-544.967) (-546.615) (-546.883) -- 0:00:02
963500 -- (-544.578) (-542.552) (-542.727) [-544.648] * (-546.062) (-543.285) (-543.717) [-545.907] -- 0:00:02
964000 -- (-544.088) [-542.979] (-546.488) (-544.277) * (-548.206) [-543.496] (-543.105) (-544.573) -- 0:00:02
964500 -- (-552.066) (-546.860) (-545.402) [-546.747] * (-549.014) [-544.799] (-543.741) (-546.625) -- 0:00:02
965000 -- (-542.754) [-545.951] (-548.743) (-545.743) * [-545.041] (-543.253) (-545.461) (-545.444) -- 0:00:02
Average standard deviation of split frequencies: 0.005276
965500 -- (-543.848) (-545.307) [-547.667] (-545.598) * [-543.249] (-544.157) (-542.856) (-547.362) -- 0:00:02
966000 -- (-544.046) (-543.882) (-545.299) [-543.038] * (-548.359) [-547.492] (-544.605) (-544.844) -- 0:00:02
966500 -- [-542.176] (-543.225) (-543.014) (-542.487) * (-544.616) (-542.539) [-548.690] (-545.687) -- 0:00:02
967000 -- (-544.510) [-542.275] (-543.375) (-543.021) * (-546.615) [-542.784] (-544.717) (-547.815) -- 0:00:02
967500 -- (-544.800) (-543.366) [-544.618] (-542.906) * [-546.520] (-543.712) (-543.204) (-545.205) -- 0:00:01
968000 -- (-542.241) (-543.683) (-542.882) [-543.721] * (-547.636) (-544.484) (-543.531) [-545.026] -- 0:00:01
968500 -- (-543.256) (-544.140) [-544.209] (-544.144) * (-545.137) (-543.002) (-542.794) [-546.140] -- 0:00:01
969000 -- [-543.386] (-543.062) (-543.742) (-542.798) * (-542.976) (-543.991) (-543.595) [-544.513] -- 0:00:01
969500 -- (-542.827) [-542.986] (-542.912) (-543.755) * (-544.868) (-543.056) (-542.596) [-543.888] -- 0:00:01
970000 -- (-543.879) (-543.862) (-543.347) [-543.423] * (-543.258) (-542.433) (-543.253) [-542.884] -- 0:00:01
Average standard deviation of split frequencies: 0.005860
970500 -- [-546.023] (-544.034) (-543.867) (-543.468) * (-542.488) [-542.643] (-544.299) (-545.278) -- 0:00:01
971000 -- (-545.156) (-545.115) (-547.158) [-543.446] * (-545.128) (-544.532) (-546.412) [-543.466] -- 0:00:01
971500 -- (-544.552) (-547.497) (-546.398) [-544.276] * (-543.850) (-542.650) (-546.229) [-543.640] -- 0:00:01
972000 -- (-542.683) (-543.970) (-546.074) [-545.047] * (-544.067) [-542.996] (-547.032) (-545.987) -- 0:00:01
972500 -- (-543.000) [-551.484] (-545.054) (-546.291) * (-545.760) (-545.176) (-545.590) [-543.511] -- 0:00:01
973000 -- (-545.621) (-546.293) [-543.951] (-545.507) * [-543.533] (-546.235) (-544.964) (-543.671) -- 0:00:01
973500 -- [-545.382] (-546.084) (-542.878) (-543.887) * (-545.029) (-545.144) [-542.929] (-546.700) -- 0:00:01
974000 -- (-545.701) [-545.327] (-545.376) (-544.528) * (-543.918) [-542.951] (-544.840) (-542.736) -- 0:00:01
974500 -- (-546.499) (-544.515) (-544.712) [-543.884] * [-544.805] (-543.449) (-542.362) (-546.378) -- 0:00:01
975000 -- (-543.715) (-549.747) [-547.901] (-546.505) * (-543.666) (-542.679) [-542.429] (-549.305) -- 0:00:01
Average standard deviation of split frequencies: 0.006343
975500 -- (-544.908) [-546.610] (-545.446) (-546.274) * (-544.152) (-544.129) [-546.624] (-544.771) -- 0:00:01
976000 -- (-545.138) (-545.040) (-543.203) [-544.204] * [-548.382] (-543.529) (-544.491) (-544.357) -- 0:00:01
976500 -- (-545.772) (-544.893) (-543.129) [-544.107] * [-543.358] (-544.881) (-544.029) (-544.230) -- 0:00:01
977000 -- [-546.609] (-544.600) (-543.686) (-546.582) * (-543.955) [-543.079] (-544.357) (-544.909) -- 0:00:01
977500 -- (-544.658) (-546.651) [-542.751] (-545.721) * (-543.276) (-542.440) [-545.030] (-544.585) -- 0:00:01
978000 -- (-543.668) (-550.746) (-545.110) [-542.996] * [-545.464] (-546.607) (-545.118) (-543.787) -- 0:00:01
978500 -- [-543.700] (-544.938) (-546.060) (-544.004) * (-542.818) (-542.237) [-543.220] (-543.701) -- 0:00:01
979000 -- (-542.849) (-544.047) (-543.093) [-543.504] * [-542.693] (-546.484) (-543.506) (-543.768) -- 0:00:01
979500 -- (-543.882) (-543.354) [-543.421] (-542.491) * [-547.295] (-543.682) (-544.209) (-544.570) -- 0:00:01
980000 -- (-544.870) (-547.389) [-543.792] (-542.940) * (-545.566) (-542.340) (-547.253) [-543.514] -- 0:00:01
Average standard deviation of split frequencies: 0.006009
980500 -- (-548.969) [-544.400] (-544.236) (-544.435) * (-546.941) (-542.372) (-543.508) [-546.611] -- 0:00:01
981000 -- [-546.583] (-545.669) (-543.833) (-542.460) * [-543.340] (-544.407) (-543.006) (-546.349) -- 0:00:01
981500 -- (-547.614) [-542.751] (-543.884) (-545.658) * (-547.599) (-546.574) [-544.160] (-548.589) -- 0:00:01
982000 -- (-546.856) [-547.683] (-543.982) (-545.964) * (-548.892) (-547.607) [-545.732] (-547.932) -- 0:00:01
982500 -- (-546.943) [-549.624] (-544.948) (-542.841) * (-544.559) (-545.598) [-543.429] (-547.501) -- 0:00:01
983000 -- [-544.723] (-546.378) (-552.462) (-546.671) * (-543.618) [-544.774] (-545.241) (-545.586) -- 0:00:01
983500 -- (-542.387) [-545.053] (-549.200) (-546.366) * [-543.832] (-544.208) (-543.316) (-544.550) -- 0:00:01
984000 -- (-545.364) [-547.518] (-547.629) (-548.722) * [-543.907] (-542.867) (-544.879) (-544.102) -- 0:00:00
984500 -- (-543.972) (-546.271) (-546.847) [-546.603] * (-543.816) [-543.823] (-545.499) (-542.660) -- 0:00:00
985000 -- (-544.307) [-548.491] (-543.772) (-543.041) * (-543.418) (-543.779) (-543.501) [-546.129] -- 0:00:00
Average standard deviation of split frequencies: 0.005767
985500 -- (-542.867) [-543.783] (-543.850) (-544.709) * [-545.895] (-542.645) (-545.108) (-545.680) -- 0:00:00
986000 -- (-542.300) (-543.700) (-544.254) [-542.806] * (-544.189) [-542.503] (-545.581) (-543.368) -- 0:00:00
986500 -- [-545.294] (-543.336) (-544.995) (-543.010) * (-545.577) [-544.978] (-542.686) (-545.613) -- 0:00:00
987000 -- (-544.749) [-543.677] (-543.171) (-544.685) * (-545.680) (-545.072) (-547.752) [-545.820] -- 0:00:00
987500 -- (-544.030) [-543.239] (-547.029) (-544.024) * (-542.803) [-544.670] (-544.780) (-554.342) -- 0:00:00
988000 -- (-543.919) (-546.579) [-545.152] (-544.750) * [-546.745] (-544.649) (-545.612) (-547.654) -- 0:00:00
988500 -- (-544.772) [-543.238] (-543.596) (-542.791) * (-546.658) (-543.477) (-544.018) [-546.125] -- 0:00:00
989000 -- (-546.566) [-548.243] (-542.864) (-545.022) * (-546.385) [-542.624] (-543.461) (-549.600) -- 0:00:00
989500 -- (-547.245) (-545.784) [-543.350] (-543.847) * [-542.992] (-542.875) (-545.505) (-545.102) -- 0:00:00
990000 -- (-544.827) [-544.743] (-543.808) (-544.287) * [-546.503] (-544.241) (-543.607) (-542.999) -- 0:00:00
Average standard deviation of split frequencies: 0.005859
990500 -- (-543.475) (-544.261) (-542.480) [-544.191] * (-545.100) (-545.297) (-543.867) [-544.067] -- 0:00:00
991000 -- (-543.852) (-545.773) [-543.421] (-546.503) * [-542.653] (-544.670) (-545.723) (-543.089) -- 0:00:00
991500 -- [-543.778] (-543.433) (-543.987) (-547.157) * (-544.523) [-543.739] (-545.556) (-542.903) -- 0:00:00
992000 -- [-544.085] (-544.248) (-550.469) (-554.305) * (-543.943) [-543.808] (-543.278) (-543.815) -- 0:00:00
992500 -- (-546.961) [-546.521] (-543.207) (-542.736) * (-545.475) (-545.942) [-546.785] (-545.083) -- 0:00:00
993000 -- (-544.493) (-543.307) (-544.375) [-544.868] * (-544.648) (-544.050) [-542.721] (-545.065) -- 0:00:00
993500 -- (-546.212) [-546.345] (-543.703) (-544.736) * [-548.876] (-545.166) (-545.258) (-544.315) -- 0:00:00
994000 -- [-546.528] (-544.242) (-547.929) (-545.271) * (-543.793) (-542.882) (-549.435) [-545.410] -- 0:00:00
994500 -- [-543.259] (-543.578) (-549.058) (-543.990) * (-544.762) [-543.485] (-547.574) (-543.508) -- 0:00:00
995000 -- (-553.108) (-544.188) (-546.372) [-543.423] * [-545.879] (-543.426) (-547.154) (-543.563) -- 0:00:00
Average standard deviation of split frequencies: 0.006212
995500 -- [-543.652] (-543.072) (-546.050) (-544.259) * [-545.326] (-544.751) (-548.145) (-542.410) -- 0:00:00
996000 -- (-543.735) [-546.916] (-543.868) (-542.306) * (-545.573) (-542.704) [-545.992] (-543.905) -- 0:00:00
996500 -- (-543.856) (-548.009) [-544.854] (-545.194) * (-543.904) [-542.446] (-545.841) (-542.984) -- 0:00:00
997000 -- (-543.308) (-547.699) (-549.576) [-544.078] * [-544.739] (-547.212) (-543.770) (-551.116) -- 0:00:00
997500 -- (-543.553) [-544.347] (-544.258) (-545.066) * (-544.388) [-547.730] (-544.484) (-543.336) -- 0:00:00
998000 -- (-543.338) (-543.170) [-543.588] (-546.370) * [-543.812] (-545.528) (-544.756) (-544.329) -- 0:00:00
998500 -- (-543.311) [-543.074] (-544.114) (-544.942) * [-544.148] (-543.331) (-543.197) (-548.071) -- 0:00:00
999000 -- (-544.028) (-543.993) [-543.894] (-544.734) * [-544.413] (-544.275) (-543.671) (-544.012) -- 0:00:00
999500 -- (-542.878) (-546.870) (-547.223) [-545.822] * (-544.204) (-545.226) (-543.264) [-548.037] -- 0:00:00
1000000 -- (-543.949) (-546.711) (-544.222) [-543.007] * [-544.752] (-546.492) (-543.556) (-548.293) -- 0:00:00
Average standard deviation of split frequencies: 0.006065
Analysis completed in 1 mins 1 seconds
Analysis used 59.85 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -541.98
Likelihood of best state for "cold" chain of run 2 was -541.98
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.1 % ( 23 %) Dirichlet(Pi{all})
35.7 % ( 29 %) Slider(Pi{all})
78.4 % ( 52 %) Multiplier(Alpha{1,2})
77.0 % ( 53 %) Multiplier(Alpha{3})
26.3 % ( 31 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 81 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 83 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.4 % ( 20 %) Dirichlet(Pi{all})
35.3 % ( 36 %) Slider(Pi{all})
78.8 % ( 53 %) Multiplier(Alpha{1,2})
78.3 % ( 48 %) Multiplier(Alpha{3})
24.7 % ( 28 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 31 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166561 0.82 0.67
3 | 166876 166173 0.84
4 | 166963 166963 166464
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166217 0.82 0.67
3 | 166872 166425 0.83
4 | 167243 167078 166165
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -543.64
| 1 |
| 2 1 |
| 2 2 2 2 |
| 11 1 1 2 1 |
| 1 1 2 2 * 1 1 2 |
| 21 1 2 1 2 1 12 1* 12 2 |
|2 *1 2 2 112 1 12 2 1 2 1*1 12 |
| 2 2 2 2 1 2 2 11 2 2 |
| 1 1 22 2 2 2 2 1 2 1 1|
|1 * 2 22 1 1 2 2 2 2 1 12 |
| 2 1 1 1 2 * 2 2 |
| 1 2 1 1 11 |
| 1 1 1 1 2|
| 2 1 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -545.25
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -543.72 -546.44
2 -543.68 -546.53
--------------------------------------
TOTAL -543.70 -546.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891576 0.086246 0.371625 1.487745 0.864515 1348.85 1424.92 1.000
r(A<->C){all} 0.172299 0.020198 0.000039 0.459779 0.135666 238.20 244.94 1.000
r(A<->G){all} 0.158695 0.020256 0.000094 0.455404 0.120018 245.62 260.93 1.000
r(A<->T){all} 0.159804 0.019295 0.000054 0.440958 0.121059 162.81 227.11 1.000
r(C<->G){all} 0.163122 0.018984 0.000046 0.435558 0.127865 182.73 195.09 1.002
r(C<->T){all} 0.168428 0.018457 0.000032 0.445883 0.133072 155.42 161.45 1.000
r(G<->T){all} 0.177652 0.020922 0.000128 0.470564 0.141598 209.05 245.53 1.004
pi(A){all} 0.206847 0.000406 0.167213 0.247585 0.206158 1501.00 1501.00 1.000
pi(C){all} 0.290556 0.000514 0.246875 0.336049 0.289707 1297.02 1366.97 1.000
pi(G){all} 0.302253 0.000517 0.260995 0.348609 0.302098 1068.51 1177.89 1.000
pi(T){all} 0.200344 0.000401 0.162235 0.237918 0.199148 1329.29 1407.88 1.000
alpha{1,2} 0.426439 0.231693 0.000112 1.397201 0.263693 1066.65 1104.08 1.000
alpha{3} 0.464306 0.244376 0.000240 1.471718 0.295432 1140.19 1257.97 1.000
pinvar{all} 0.996028 0.000022 0.986855 0.999996 0.997564 1244.84 1323.26 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- ..****
9 -- .**.**
10 -- ..*.*.
11 -- ..*..*
12 -- ....**
13 -- ...**.
14 -- ...*.*
15 -- .*.*..
16 -- ..**..
17 -- .**...
18 -- .*.***
19 -- .***.*
20 -- .****.
21 -- .*..*.
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 472 0.157229 0.003769 0.154564 0.159893 2
8 470 0.156562 0.004711 0.153231 0.159893 2
9 451 0.150233 0.008009 0.144570 0.155896 2
10 446 0.148568 0.000942 0.147901 0.149234 2
11 438 0.145903 0.007537 0.140573 0.151233 2
12 432 0.143904 0.010364 0.136576 0.151233 2
13 430 0.143238 0.002827 0.141239 0.145237 2
14 428 0.142572 0.019786 0.128581 0.156562 2
15 425 0.141572 0.003298 0.139241 0.143904 2
16 420 0.139907 0.003769 0.137242 0.142572 2
17 420 0.139907 0.003769 0.137242 0.142572 2
18 415 0.138241 0.008951 0.131912 0.144570 2
19 411 0.136909 0.002355 0.135243 0.138574 2
20 409 0.136243 0.008009 0.130580 0.141905 2
21 403 0.134244 0.003298 0.131912 0.136576 2
22 294 0.097935 0.005653 0.093937 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100396 0.009461 0.000068 0.291021 0.069999 1.000 2
length{all}[2] 0.098790 0.009565 0.000021 0.291475 0.068704 1.000 2
length{all}[3] 0.098319 0.010079 0.000022 0.289130 0.068445 1.000 2
length{all}[4] 0.097905 0.009493 0.000048 0.297540 0.066764 1.000 2
length{all}[5] 0.099170 0.009973 0.000043 0.296800 0.067874 1.001 2
length{all}[6] 0.097783 0.009125 0.000044 0.286787 0.068313 1.000 2
length{all}[7] 0.096829 0.011537 0.000011 0.314022 0.063075 0.998 2
length{all}[8] 0.101471 0.010417 0.000310 0.300635 0.073991 0.999 2
length{all}[9] 0.100258 0.009612 0.000133 0.327268 0.067176 1.009 2
length{all}[10] 0.099475 0.009383 0.000031 0.300964 0.068445 0.999 2
length{all}[11] 0.094302 0.009277 0.000136 0.260055 0.063531 1.000 2
length{all}[12] 0.104140 0.010329 0.000257 0.311611 0.072617 1.010 2
length{all}[13] 0.101514 0.010661 0.000181 0.328130 0.067609 1.001 2
length{all}[14] 0.104327 0.010679 0.000068 0.319638 0.076260 0.998 2
length{all}[15] 0.095820 0.009578 0.000106 0.293274 0.064446 0.998 2
length{all}[16] 0.090156 0.008975 0.000145 0.260207 0.055998 0.998 2
length{all}[17] 0.100238 0.010230 0.000143 0.274610 0.072064 0.999 2
length{all}[18] 0.097311 0.011474 0.000336 0.310719 0.065862 1.000 2
length{all}[19] 0.097304 0.010098 0.000303 0.315432 0.063947 1.000 2
length{all}[20] 0.097895 0.010560 0.000011 0.284898 0.064263 0.998 2
length{all}[21] 0.102712 0.009294 0.000240 0.318563 0.072338 1.000 2
length{all}[22] 0.097947 0.010330 0.000068 0.294811 0.069198 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006065
Maximum standard deviation of split frequencies = 0.019786
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 396
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 46 patterns at 132 / 132 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 46 patterns at 132 / 132 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
44896 bytes for conP
4048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010392 0.064738 0.077050 0.054294 0.033263 0.075327 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -562.152409
Iterating by ming2
Initial: fx= 562.152409
x= 0.01039 0.06474 0.07705 0.05429 0.03326 0.07533 0.30000 1.30000
1 h-m-p 0.0000 0.0001 316.1872 ++ 554.159551 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0091 35.5788 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 288.7344 +++ 539.408716 m 0.0002 45 | 2/8
4 h-m-p 0.0017 0.0121 27.5024 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 258.9796 +++ 528.457552 m 0.0002 77 | 3/8
6 h-m-p 0.0019 0.0191 18.8953 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 224.9390 ++ 524.351026 m 0.0001 109 | 4/8
8 h-m-p 0.0012 0.0320 12.7603 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 183.8774 ++ 521.563266 m 0.0001 140 | 5/8
10 h-m-p 0.0013 0.0566 8.0934 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 130.2454 ++ 521.335882 m 0.0000 171 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 ++Y 521.335882 0 0.2560 184 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 Y 521.335882 0 0.4000 197 | 6/8
14 h-m-p 0.0454 8.0000 0.0000 N 521.335882 0 0.0114 210
Out..
lnL = -521.335882
211 lfun, 211 eigenQcodon, 1266 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.093598 0.028522 0.034737 0.057924 0.059910 0.064398 0.299930 0.848811 0.119582
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 19.205856
np = 9
lnL0 = -562.389977
Iterating by ming2
Initial: fx= 562.389977
x= 0.09360 0.02852 0.03474 0.05792 0.05991 0.06440 0.29993 0.84881 0.11958
1 h-m-p 0.0000 0.0002 277.5889 +++ 542.565548 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0001 294.5268 ++ 538.698148 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0000 3031.8952 ++ 527.233464 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0001 186.5175 ++ 526.396701 m 0.0001 51 | 4/9
5 h-m-p 0.0000 0.0000 1602.8029 ++ 525.152569 m 0.0000 63 | 5/9
6 h-m-p 0.0004 0.0020 22.0354 ++ 524.745682 m 0.0020 75 | 6/9
7 h-m-p 0.0120 1.1990 2.8313 -------------.. | 6/9
8 h-m-p 0.0000 0.0002 126.3657 +++ 521.335903 m 0.0002 111 | 7/9
9 h-m-p 0.1970 8.0000 0.0001 +++ 521.335903 m 8.0000 124 | 7/9
10 h-m-p 0.0086 4.3157 0.1863 +++++ 521.335882 m 4.3157 141 | 8/9
11 h-m-p 0.2725 1.3625 0.0867 ++ 521.335880 m 1.3625 155 | 9/9
12 h-m-p 0.0160 8.0000 0.0000 Y 521.335880 0 0.0160 168
Out..
lnL = -521.335880
169 lfun, 507 eigenQcodon, 2028 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106434 0.037480 0.038355 0.048297 0.070647 0.032999 0.000100 1.764730 0.554536 0.386961 1.384461
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.431732
np = 11
lnL0 = -563.091741
Iterating by ming2
Initial: fx= 563.091741
x= 0.10643 0.03748 0.03835 0.04830 0.07065 0.03300 0.00011 1.76473 0.55454 0.38696 1.38446
1 h-m-p 0.0000 0.0000 294.9780 ++ 562.592140 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0010 180.0888 ++++ 538.146980 m 0.0010 32 | 2/11
3 h-m-p 0.0000 0.0000 601.8927 ++ 535.585778 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0001 113.5756 ++ 535.052186 m 0.0001 60 | 4/11
5 h-m-p 0.0000 0.0001 317.1533 ++ 531.258830 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0002 510.4714 ++ 525.636206 m 0.0002 88 | 6/11
7 h-m-p 0.0000 0.0000 4593.8165 ++ 523.423106 m 0.0000 102 | 7/11
8 h-m-p 0.0160 8.0000 1.7700 -------------.. | 7/11
9 h-m-p 0.0000 0.0001 127.2888 ++ 521.335885 m 0.0001 141 | 8/11
10 h-m-p 0.3638 8.0000 0.0000 +++ 521.335885 m 8.0000 156 | 8/11
11 h-m-p 0.0160 8.0000 0.0029 +++++ 521.335885 m 8.0000 176 | 8/11
12 h-m-p 0.0160 8.0000 1.9665 ++++Y 521.335878 0 4.0960 197 | 8/11
13 h-m-p 1.6000 8.0000 0.1076 ++ 521.335878 m 8.0000 211 | 8/11
14 h-m-p 0.0620 0.5640 13.8887 C 521.335878 0 0.0713 228 | 8/11
15 h-m-p 0.0904 0.6240 10.9656 C 521.335878 0 0.0266 242 | 8/11
16 h-m-p 1.0035 8.0000 0.2909 -C 521.335878 0 0.0786 257 | 8/11
17 h-m-p 1.6000 8.0000 0.0005 ++ 521.335878 m 8.0000 274 | 8/11
18 h-m-p 1.6000 8.0000 0.0005 ++ 521.335878 m 8.0000 291 | 8/11
19 h-m-p 0.0974 8.0000 0.0419 ---N 521.335878 0 0.0004 311 | 8/11
20 h-m-p 0.4746 8.0000 0.0000 +++ 521.335878 m 8.0000 329 | 8/11
21 h-m-p 0.0160 8.0000 0.1078 +++++ 521.335878 m 8.0000 349 | 8/11
22 h-m-p 0.0260 3.8940 33.2023 ++Y 521.335876 0 0.4157 368 | 8/11
23 h-m-p 1.6000 8.0000 0.9820 C 521.335876 0 2.4188 382 | 8/11
24 h-m-p 1.6000 8.0000 0.0593 ------Y 521.335876 0 0.0001 405 | 8/11
25 h-m-p 0.0160 8.0000 0.1404 +++++ 521.335876 m 8.0000 425 | 8/11
26 h-m-p 0.0766 8.0000 14.6581 +Y 521.335876 0 0.2037 443 | 8/11
27 h-m-p 1.6000 8.0000 1.4568 -------C 521.335876 0 0.0000 464 | 8/11
28 h-m-p 0.0318 8.0000 0.0011 C 521.335876 0 0.0080 478 | 8/11
29 h-m-p 1.6000 8.0000 0.0000 --------------C 521.335876 0 0.0000 509
Out..
lnL = -521.335876
510 lfun, 2040 eigenQcodon, 9180 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -521.334150 S = -521.332895 -0.000479
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:03
did 20 / 46 patterns 0:03
did 30 / 46 patterns 0:03
did 40 / 46 patterns 0:03
did 46 / 46 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.055685 0.048674 0.074508 0.021184 0.068399 0.052286 0.000100 0.971172 1.074050
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.169019
np = 9
lnL0 = -561.566816
Iterating by ming2
Initial: fx= 561.566816
x= 0.05569 0.04867 0.07451 0.02118 0.06840 0.05229 0.00011 0.97117 1.07405
1 h-m-p 0.0000 0.0000 296.0023 ++ 561.101946 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0288 34.6083 +++++ 542.597339 m 0.0288 29 | 2/9
3 h-m-p 0.0002 0.0010 96.5260 ++ 537.744126 m 0.0010 41 | 3/9
4 h-m-p 0.0001 0.0004 67.0267 ++ 534.003198 m 0.0004 53 | 4/9
5 h-m-p 0.0086 0.0559 2.6972 -------------.. | 4/9
6 h-m-p 0.0000 0.0001 254.9341 ++ 527.434313 m 0.0001 88 | 5/9
7 h-m-p 0.0160 8.0000 1.5372 -------------.. | 5/9
8 h-m-p 0.0000 0.0000 223.0783 ++ 526.082741 m 0.0000 123 | 6/9
9 h-m-p 0.0160 8.0000 1.2352 -------------.. | 6/9
10 h-m-p 0.0000 0.0000 181.5805 ++ 525.130146 m 0.0000 158 | 7/9
11 h-m-p 0.0160 8.0000 0.8458 -------------.. | 7/9
12 h-m-p 0.0000 0.0002 126.7250 +++ 521.335903 m 0.0002 196 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 -------N 521.335903 0 0.0000 215 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 N 521.335903 0 0.0160 228
Out..
lnL = -521.335903
229 lfun, 2519 eigenQcodon, 13740 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067085 0.095740 0.072454 0.059370 0.032608 0.042188 0.000100 0.900000 0.377337 1.508754 1.300027
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 19.968380
np = 11
lnL0 = -564.262331
Iterating by ming2
Initial: fx= 564.262331
x= 0.06708 0.09574 0.07245 0.05937 0.03261 0.04219 0.00011 0.90000 0.37734 1.50875 1.30003
1 h-m-p 0.0000 0.0000 256.6567 ++ 564.100670 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0013 149.5113 ++++ 542.317232 m 0.0013 32 | 2/11
3 h-m-p 0.0000 0.0000 1497.7789 ++ 536.739712 m 0.0000 46 | 3/11
4 h-m-p 0.0011 0.0074 39.3701 ++ 529.004194 m 0.0074 60 | 4/11
5 h-m-p 0.0000 0.0000 3254.1505 ++ 528.357356 m 0.0000 74 | 5/11
6 h-m-p 0.0008 0.0043 14.3787 ++ 527.702327 m 0.0043 88 | 6/11
7 h-m-p 0.0001 0.0004 76.2641 ++ 526.153151 m 0.0004 102 | 7/11
8 h-m-p 0.0004 0.0044 56.8294 ++ 522.720601 m 0.0044 116 | 7/11
9 h-m-p 0.0000 0.0000 211.7723
h-m-p: 0.00000000e+00 0.00000000e+00 2.11772274e+02 522.720601
.. | 7/11
10 h-m-p 0.0000 0.0001 129.5461 ++ 521.335903 m 0.0001 141 | 8/11
11 h-m-p 1.6000 8.0000 0.0000 ++ 521.335903 m 8.0000 155 | 7/11
12 h-m-p 0.0000 0.0000 0.0006
h-m-p: 1.97683617e-15 9.88418085e-15 5.50365516e-04 521.335903
.. | 7/11
13 h-m-p 0.0160 8.0000 0.0002 +++++ 521.335902 m 8.0000 190
QuantileBeta(0.15, 0.00495, 1.54316) = 7.195252e-163 2000 rounds
| 7/11
14 h-m-p 0.0212 8.0000 0.0721 +++++ 521.335881 m 8.0000 211 | 7/11
15 h-m-p 1.6000 8.0000 0.0247 ++ 521.335879 m 8.0000 229 | 7/11
16 h-m-p 0.1408 0.7039 0.3186 ++ 521.335879 m 0.7039 247 | 8/11
17 h-m-p 0.2892 8.0000 0.0019 +++ 521.335879 m 8.0000 266 | 8/11
18 h-m-p 0.0160 8.0000 1.4455 +++++ 521.335877 m 8.0000 286 | 8/11
19 h-m-p 1.6000 8.0000 3.9721 ++ 521.335876 m 8.0000 300 | 8/11
20 h-m-p 1.0377 5.1886 10.8544 ++ 521.335876 m 5.1886 314 | 8/11
21 h-m-p 0.0000 0.0000 113.5798
h-m-p: 0.00000000e+00 0.00000000e+00 1.13579762e+02 521.335876
.. | 8/11
22 h-m-p 0.0160 8.0000 0.0000 C 521.335876 0 0.0160 339 | 7/11
23 h-m-p 0.0160 8.0000 0.0000 Y 521.335876 0 0.0160 356
Out..
lnL = -521.335876
357 lfun, 4284 eigenQcodon, 23562 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -521.333565 S = -521.332819 -0.000327
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:12
did 20 / 46 patterns 0:13
did 30 / 46 patterns 0:13
did 40 / 46 patterns 0:13
did 46 / 46 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132
NC_011896_1_WP_010908572_1_1971_MLBR_RS09355 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
NC_002677_1_NP_302251_1_1123_rpsH MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR
**************************************************
NC_011896_1_WP_010908572_1_1971_MLBR_RS09355 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
NC_002677_1_NP_302251_1_1123_rpsH TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425 TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG
**************************************************
NC_011896_1_WP_010908572_1_1971_MLBR_RS09355 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
NC_002677_1_NP_302251_1_1123_rpsH LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425 LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
********************************
>NC_011896_1_WP_010908572_1_1971_MLBR_RS09355 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG >NC_002677_1_NP_302251_1_1123_rpsH ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG >NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG >NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG >NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG >NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425 ATGACCATGACGGACCCGATCGCAGATTTTTTGACACGTCTGCGCAACGC CAATTCGGCGTATCACGACGAAGTGACTGTGCCGCACTCCAATATCAAGG CCAACATCGCCCAGATCCTTAAGAACGAAGGATACATCCGAGACTTCCGT ACCGAAGACGCTCGTGTCGGCAAGTCATTGATCATCCAACTCAAGTACGG ACCCAGCCGGGAGCGTAGCATCGCTGGTTTGCGCCGGGTGTCCAAGCCGG GGTTGCGGGTGTATGCGAAGTCGATCAACTTGCCGCGTGTGCTGGGCGGT CTGGGCGTGGTCATCATCTCGACCTCCTCAGGCCTGCTGACCGACCGTCA GGCAGCCAGGCAGGGTGTGGGCGGCGAAGTCCTCGCGTACGTGTGG
>NC_011896_1_WP_010908572_1_1971_MLBR_RS09355 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW >NC_002677_1_NP_302251_1_1123_rpsH MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW >NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW >NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW >NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW >NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425 MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFR TEDARVGKSLIIQLKYGPSRERSIAGLRRVSKPGLRVYAKSINLPRVLGG LGVVIISTSSGLLTDRQAARQGVGGEVLAYVW
#NEXUS
[ID: 0224444458]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908572_1_1971_MLBR_RS09355
NC_002677_1_NP_302251_1_1123_rpsH
NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330
NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450
NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160
NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908572_1_1971_MLBR_RS09355,
2 NC_002677_1_NP_302251_1_1123_rpsH,
3 NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330,
4 NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450,
5 NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160,
6 NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06999859,2:0.06870406,3:0.06844452,4:0.06676439,5:0.06787427,6:0.06831296);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06999859,2:0.06870406,3:0.06844452,4:0.06676439,5:0.06787427,6:0.06831296);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -543.72 -546.44
2 -543.68 -546.53
--------------------------------------
TOTAL -543.70 -546.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891576 0.086246 0.371625 1.487745 0.864515 1348.85 1424.92 1.000
r(A<->C){all} 0.172299 0.020198 0.000039 0.459779 0.135666 238.20 244.94 1.000
r(A<->G){all} 0.158695 0.020256 0.000094 0.455404 0.120018 245.62 260.93 1.000
r(A<->T){all} 0.159804 0.019295 0.000054 0.440958 0.121059 162.81 227.11 1.000
r(C<->G){all} 0.163122 0.018984 0.000046 0.435558 0.127865 182.73 195.09 1.002
r(C<->T){all} 0.168428 0.018457 0.000032 0.445883 0.133072 155.42 161.45 1.000
r(G<->T){all} 0.177652 0.020922 0.000128 0.470564 0.141598 209.05 245.53 1.004
pi(A){all} 0.206847 0.000406 0.167213 0.247585 0.206158 1501.00 1501.00 1.000
pi(C){all} 0.290556 0.000514 0.246875 0.336049 0.289707 1297.02 1366.97 1.000
pi(G){all} 0.302253 0.000517 0.260995 0.348609 0.302098 1068.51 1177.89 1.000
pi(T){all} 0.200344 0.000401 0.162235 0.237918 0.199148 1329.29 1407.88 1.000
alpha{1,2} 0.426439 0.231693 0.000112 1.397201 0.263693 1066.65 1104.08 1.000
alpha{3} 0.464306 0.244376 0.000240 1.471718 0.295432 1140.19 1257.97 1.000
pinvar{all} 0.996028 0.000022 0.986855 0.999996 0.997564 1244.84 1323.26 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpsH/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 132
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 3 3 3 3 3 3 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 6 6 6 6 6 6
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 5 5 5 5 5 5 | CCG 4 4 4 4 4 4 | CAG 3 3 3 3 3 3 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 11 11 11 11 11 11 | ACC 4 4 4 4 4 4 | AAC 4 4 4 4 4 4 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 6 6 6 6 6 6 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3
GTC 3 3 3 3 3 3 | GCC 4 4 4 4 4 4 | GAC 5 5 5 5 5 5 | GGC 6 6 6 6 6 6
GTA 0 0 0 0 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 4 4 4 4 4 4 | GGA 2 2 2 2 2 2
GTG 8 8 8 8 8 8 | GCG 3 3 3 3 3 3 | GAG 1 1 1 1 1 1 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908572_1_1971_MLBR_RS09355
position 1: T:0.15909 C:0.23485 A:0.26515 G:0.34091
position 2: T:0.29545 C:0.23485 A:0.25758 G:0.21212
position 3: T:0.14394 C:0.40152 A:0.09848 G:0.35606
Average T:0.19949 C:0.29040 A:0.20707 G:0.30303
#2: NC_002677_1_NP_302251_1_1123_rpsH
position 1: T:0.15909 C:0.23485 A:0.26515 G:0.34091
position 2: T:0.29545 C:0.23485 A:0.25758 G:0.21212
position 3: T:0.14394 C:0.40152 A:0.09848 G:0.35606
Average T:0.19949 C:0.29040 A:0.20707 G:0.30303
#3: NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330
position 1: T:0.15909 C:0.23485 A:0.26515 G:0.34091
position 2: T:0.29545 C:0.23485 A:0.25758 G:0.21212
position 3: T:0.14394 C:0.40152 A:0.09848 G:0.35606
Average T:0.19949 C:0.29040 A:0.20707 G:0.30303
#4: NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450
position 1: T:0.15909 C:0.23485 A:0.26515 G:0.34091
position 2: T:0.29545 C:0.23485 A:0.25758 G:0.21212
position 3: T:0.14394 C:0.40152 A:0.09848 G:0.35606
Average T:0.19949 C:0.29040 A:0.20707 G:0.30303
#5: NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160
position 1: T:0.15909 C:0.23485 A:0.26515 G:0.34091
position 2: T:0.29545 C:0.23485 A:0.25758 G:0.21212
position 3: T:0.14394 C:0.40152 A:0.09848 G:0.35606
Average T:0.19949 C:0.29040 A:0.20707 G:0.30303
#6: NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425
position 1: T:0.15909 C:0.23485 A:0.26515 G:0.34091
position 2: T:0.29545 C:0.23485 A:0.25758 G:0.21212
position 3: T:0.14394 C:0.40152 A:0.09848 G:0.35606
Average T:0.19949 C:0.29040 A:0.20707 G:0.30303
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 6 | TCC 18 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 18 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 36
CTC 12 | CCC 6 | CAC 12 | CGC 12
CTA 0 | CCA 0 | Gln Q CAA 6 | CGA 6
CTG 30 | CCG 24 | CAG 18 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 0
ATC 66 | ACC 24 | AAC 24 | AGC 12
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 12 | ACG 6 | AAG 36 | AGG 6
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 18
GTC 18 | GCC 24 | GAC 30 | GGC 36
GTA 0 | GCA 12 | Glu E GAA 24 | GGA 12
GTG 48 | GCG 18 | GAG 6 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15909 C:0.23485 A:0.26515 G:0.34091
position 2: T:0.29545 C:0.23485 A:0.25758 G:0.21212
position 3: T:0.14394 C:0.40152 A:0.09848 G:0.35606
Average T:0.19949 C:0.29040 A:0.20707 G:0.30303
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -521.335882 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299930 1.300027
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908572_1_1971_MLBR_RS09355: 0.000004, NC_002677_1_NP_302251_1_1123_rpsH: 0.000004, NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330: 0.000004, NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450: 0.000004, NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160: 0.000004, NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29993
omega (dN/dS) = 1.30003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 321.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 321.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 321.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 321.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 321.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 321.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -521.335880 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908572_1_1971_MLBR_RS09355: 0.000004, NC_002677_1_NP_302251_1_1123_rpsH: 0.000004, NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330: 0.000004, NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450: 0.000004, NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160: 0.000004, NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 324.6 71.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 324.6 71.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 324.6 71.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 324.6 71.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 324.6 71.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 324.6 71.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -521.335876 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000559 0.013051 0.000001 5.936925
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908572_1_1971_MLBR_RS09355: 0.000004, NC_002677_1_NP_302251_1_1123_rpsH: 0.000004, NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330: 0.000004, NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450: 0.000004, NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160: 0.000004, NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00056 0.01305 0.98639
w: 0.00000 1.00000 5.93692
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 324.6 71.4 5.8692 0.0000 0.0000 0.0 0.0
7..2 0.000 324.6 71.4 5.8692 0.0000 0.0000 0.0 0.0
7..3 0.000 324.6 71.4 5.8692 0.0000 0.0000 0.0 0.0
7..4 0.000 324.6 71.4 5.8692 0.0000 0.0000 0.0 0.0
7..5 0.000 324.6 71.4 5.8692 0.0000 0.0000 0.0 0.0
7..6 0.000 324.6 71.4 5.8692 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908572_1_1971_MLBR_RS09355)
Pr(w>1) post mean +- SE for w
1 M 0.986* 5.869
2 T 0.986* 5.869
3 M 0.986* 5.869
4 T 0.986* 5.869
5 D 0.986* 5.869
6 P 0.986* 5.869
7 I 0.986* 5.869
8 A 0.986* 5.869
9 D 0.986* 5.869
10 F 0.986* 5.869
11 L 0.986* 5.869
12 T 0.986* 5.869
13 R 0.986* 5.869
14 L 0.986* 5.869
15 R 0.986* 5.869
16 N 0.986* 5.869
17 A 0.986* 5.869
18 N 0.986* 5.869
19 S 0.986* 5.869
20 A 0.986* 5.869
21 Y 0.986* 5.869
22 H 0.986* 5.869
23 D 0.986* 5.869
24 E 0.986* 5.869
25 V 0.986* 5.869
26 T 0.986* 5.869
27 V 0.986* 5.869
28 P 0.986* 5.869
29 H 0.986* 5.869
30 S 0.986* 5.869
31 N 0.986* 5.869
32 I 0.986* 5.869
33 K 0.986* 5.869
34 A 0.986* 5.869
35 N 0.986* 5.869
36 I 0.986* 5.869
37 A 0.986* 5.869
38 Q 0.986* 5.869
39 I 0.986* 5.869
40 L 0.986* 5.869
41 K 0.986* 5.869
42 N 0.986* 5.869
43 E 0.986* 5.869
44 G 0.986* 5.869
45 Y 0.986* 5.869
46 I 0.986* 5.869
47 R 0.986* 5.869
48 D 0.986* 5.869
49 F 0.986* 5.869
50 R 0.986* 5.869
51 T 0.986* 5.869
52 E 0.986* 5.869
53 D 0.986* 5.869
54 A 0.986* 5.869
55 R 0.986* 5.869
56 V 0.986* 5.869
57 G 0.986* 5.869
58 K 0.986* 5.869
59 S 0.986* 5.869
60 L 0.986* 5.869
61 I 0.986* 5.869
62 I 0.986* 5.869
63 Q 0.986* 5.869
64 L 0.986* 5.869
65 K 0.986* 5.869
66 Y 0.986* 5.869
67 G 0.986* 5.869
68 P 0.986* 5.869
69 S 0.986* 5.869
70 R 0.986* 5.869
71 E 0.986* 5.869
72 R 0.986* 5.869
73 S 0.986* 5.869
74 I 0.986* 5.869
75 A 0.986* 5.869
76 G 0.986* 5.869
77 L 0.986* 5.869
78 R 0.986* 5.869
79 R 0.986* 5.869
80 V 0.986* 5.869
81 S 0.986* 5.869
82 K 0.986* 5.869
83 P 0.986* 5.869
84 G 0.986* 5.869
85 L 0.986* 5.869
86 R 0.986* 5.869
87 V 0.986* 5.869
88 Y 0.986* 5.869
89 A 0.986* 5.869
90 K 0.986* 5.869
91 S 0.986* 5.869
92 I 0.986* 5.869
93 N 0.986* 5.869
94 L 0.986* 5.869
95 P 0.986* 5.869
96 R 0.986* 5.869
97 V 0.986* 5.869
98 L 0.986* 5.869
99 G 0.986* 5.869
100 G 0.986* 5.869
101 L 0.986* 5.869
102 G 0.986* 5.869
103 V 0.986* 5.869
104 V 0.986* 5.869
105 I 0.986* 5.869
106 I 0.986* 5.869
107 S 0.986* 5.869
108 T 0.986* 5.869
109 S 0.986* 5.869
110 S 0.986* 5.869
111 G 0.986* 5.869
112 L 0.986* 5.869
113 L 0.986* 5.869
114 T 0.986* 5.869
115 D 0.986* 5.869
116 R 0.986* 5.869
117 Q 0.986* 5.869
118 A 0.986* 5.869
119 A 0.986* 5.869
120 R 0.986* 5.869
121 Q 0.986* 5.869
122 G 0.986* 5.869
123 V 0.986* 5.869
124 G 0.986* 5.869
125 G 0.986* 5.869
126 E 0.986* 5.869
127 V 0.986* 5.869
128 L 0.986* 5.869
129 A 0.986* 5.869
130 Y 0.986* 5.869
131 V 0.986* 5.869
132 W 0.986* 5.869
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908572_1_1971_MLBR_RS09355)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -521.335903 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.352933
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908572_1_1971_MLBR_RS09355: 0.000004, NC_002677_1_NP_302251_1_1123_rpsH: 0.000004, NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330: 0.000004, NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450: 0.000004, NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160: 0.000004, NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.35293
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 324.6 71.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 324.6 71.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 324.6 71.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 324.6 71.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 324.6 71.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 324.6 71.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -521.335876 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 99.000000 1.628314 13.148610
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908572_1_1971_MLBR_RS09355: 0.000004, NC_002677_1_NP_302251_1_1123_rpsH: 0.000004, NZ_LVXE01000061_1_WP_010908572_1_2371_A3216_RS12330: 0.000004, NZ_LYPH01000044_1_WP_010908572_1_1772_A8144_RS08450: 0.000004, NZ_CP029543_1_WP_010908572_1_1996_DIJ64_RS10160: 0.000004, NZ_AP014567_1_WP_010908572_1_2049_JK2ML_RS10425: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 99.00000 q = 1.62831
(p1 = 0.99999) w = 13.14861
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.95929 0.97176 0.97789 0.98213 0.98545 0.98825 0.99073 0.99303 0.99530 0.99781 13.14861
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 324.6 71.4 13.1485 0.0000 0.0000 0.0 0.0
7..2 0.000 324.6 71.4 13.1485 0.0000 0.0000 0.0 0.0
7..3 0.000 324.6 71.4 13.1485 0.0000 0.0000 0.0 0.0
7..4 0.000 324.6 71.4 13.1485 0.0000 0.0000 0.0 0.0
7..5 0.000 324.6 71.4 13.1485 0.0000 0.0000 0.0 0.0
7..6 0.000 324.6 71.4 13.1485 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908572_1_1971_MLBR_RS09355)
Pr(w>1) post mean +- SE for w
1 M 1.000** 13.148
2 T 1.000** 13.148
3 M 1.000** 13.148
4 T 1.000** 13.148
5 D 1.000** 13.148
6 P 1.000** 13.148
7 I 1.000** 13.148
8 A 1.000** 13.148
9 D 1.000** 13.148
10 F 1.000** 13.148
11 L 1.000** 13.148
12 T 1.000** 13.148
13 R 1.000** 13.148
14 L 1.000** 13.148
15 R 1.000** 13.148
16 N 1.000** 13.148
17 A 1.000** 13.148
18 N 1.000** 13.148
19 S 1.000** 13.148
20 A 1.000** 13.148
21 Y 1.000** 13.148
22 H 1.000** 13.148
23 D 1.000** 13.148
24 E 1.000** 13.148
25 V 1.000** 13.148
26 T 1.000** 13.148
27 V 1.000** 13.148
28 P 1.000** 13.148
29 H 1.000** 13.148
30 S 1.000** 13.148
31 N 1.000** 13.148
32 I 1.000** 13.148
33 K 1.000** 13.148
34 A 1.000** 13.148
35 N 1.000** 13.148
36 I 1.000** 13.148
37 A 1.000** 13.148
38 Q 1.000** 13.148
39 I 1.000** 13.148
40 L 1.000** 13.148
41 K 1.000** 13.148
42 N 1.000** 13.148
43 E 1.000** 13.148
44 G 1.000** 13.148
45 Y 1.000** 13.148
46 I 1.000** 13.148
47 R 1.000** 13.148
48 D 1.000** 13.148
49 F 1.000** 13.148
50 R 1.000** 13.148
51 T 1.000** 13.148
52 E 1.000** 13.148
53 D 1.000** 13.148
54 A 1.000** 13.148
55 R 1.000** 13.148
56 V 1.000** 13.148
57 G 1.000** 13.148
58 K 1.000** 13.148
59 S 1.000** 13.148
60 L 1.000** 13.148
61 I 1.000** 13.148
62 I 1.000** 13.148
63 Q 1.000** 13.148
64 L 1.000** 13.148
65 K 1.000** 13.148
66 Y 1.000** 13.148
67 G 1.000** 13.148
68 P 1.000** 13.148
69 S 1.000** 13.148
70 R 1.000** 13.148
71 E 1.000** 13.148
72 R 1.000** 13.148
73 S 1.000** 13.148
74 I 1.000** 13.148
75 A 1.000** 13.148
76 G 1.000** 13.148
77 L 1.000** 13.148
78 R 1.000** 13.148
79 R 1.000** 13.148
80 V 1.000** 13.148
81 S 1.000** 13.148
82 K 1.000** 13.148
83 P 1.000** 13.148
84 G 1.000** 13.148
85 L 1.000** 13.148
86 R 1.000** 13.148
87 V 1.000** 13.148
88 Y 1.000** 13.148
89 A 1.000** 13.148
90 K 1.000** 13.148
91 S 1.000** 13.148
92 I 1.000** 13.148
93 N 1.000** 13.148
94 L 1.000** 13.148
95 P 1.000** 13.148
96 R 1.000** 13.148
97 V 1.000** 13.148
98 L 1.000** 13.148
99 G 1.000** 13.148
100 G 1.000** 13.148
101 L 1.000** 13.148
102 G 1.000** 13.148
103 V 1.000** 13.148
104 V 1.000** 13.148
105 I 1.000** 13.148
106 I 1.000** 13.148
107 S 1.000** 13.148
108 T 1.000** 13.148
109 S 1.000** 13.148
110 S 1.000** 13.148
111 G 1.000** 13.148
112 L 1.000** 13.148
113 L 1.000** 13.148
114 T 1.000** 13.148
115 D 1.000** 13.148
116 R 1.000** 13.148
117 Q 1.000** 13.148
118 A 1.000** 13.148
119 A 1.000** 13.148
120 R 1.000** 13.148
121 Q 1.000** 13.148
122 G 1.000** 13.148
123 V 1.000** 13.148
124 G 1.000** 13.148
125 G 1.000** 13.148
126 E 1.000** 13.148
127 V 1.000** 13.148
128 L 1.000** 13.148
129 A 1.000** 13.148
130 Y 1.000** 13.148
131 V 1.000** 13.148
132 W 1.000** 13.148
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908572_1_1971_MLBR_RS09355)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -521.33588 Model 2: PositiveSelection -521.335876 Model 0: one-ratio -521.335882 Model 7: beta -521.335903 Model 8: beta&w>1 -521.335876 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 7.999999979801942E-6 Model 8 vs 7 5.400000009103678E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
