--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:21:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsI/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -626.23 -629.90
2 -626.24 -630.61
--------------------------------------
TOTAL -626.23 -630.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886971 0.085846 0.384532 1.458633 0.850121 1452.04 1454.85 1.000
r(A<->C){all} 0.178483 0.021159 0.000031 0.458376 0.146321 106.19 249.33 1.008
r(A<->G){all} 0.159389 0.017365 0.000012 0.420971 0.127049 221.02 244.15 1.002
r(A<->T){all} 0.163371 0.017520 0.000621 0.426681 0.129967 163.74 252.40 1.004
r(C<->G){all} 0.164594 0.018667 0.000030 0.440226 0.131792 189.25 240.53 1.007
r(C<->T){all} 0.168440 0.020874 0.000024 0.456280 0.132588 273.34 356.15 1.001
r(G<->T){all} 0.165724 0.020680 0.000001 0.463767 0.123291 271.68 332.17 1.000
pi(A){all} 0.202830 0.000345 0.166076 0.238816 0.202215 1303.39 1374.75 1.000
pi(C){all} 0.287696 0.000428 0.246638 0.326871 0.287956 1171.65 1255.15 1.000
pi(G){all} 0.320773 0.000439 0.278479 0.359412 0.320602 981.97 1115.18 1.001
pi(T){all} 0.188701 0.000327 0.152602 0.223223 0.187955 1038.64 1113.71 1.001
alpha{1,2} 0.438900 0.253876 0.000100 1.410039 0.255783 1096.16 1166.87 1.001
alpha{3} 0.452962 0.223648 0.000145 1.408192 0.289632 1141.56 1321.28 1.000
pinvar{all} 0.996545 0.000019 0.989027 1.000000 0.997906 999.28 1182.69 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -604.78569
Model 2: PositiveSelection -604.785674
Model 0: one-ratio -604.78569
Model 7: beta -604.78569
Model 8: beta&w>1 -604.785677
Model 0 vs 1 0.0
Model 2 vs 1 3.200000014658144E-5
Model 8 vs 7 2.6000000161729986E-5
>C1
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
>C2
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
>C3
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
>C4
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
>C5
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
>C6
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=153
C1 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
C2 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
C3 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
C4 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
C5 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
C6 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
**************************************************
C1 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
C2 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
C3 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
C4 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
C5 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
C6 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
**************************************************
C1 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
C2 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
C3 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
C4 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
C5 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
C6 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
**************************************************
C1 SKR
C2 SKR
C3 SKR
C4 SKR
C5 SKR
C6 SKR
***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4590]--->[4590]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.468 Mb, Max= 30.687 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
C2 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
C3 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
C4 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
C5 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
C6 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
**************************************************
C1 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
C2 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
C3 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
C4 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
C5 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
C6 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
**************************************************
C1 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
C2 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
C3 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
C4 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
C5 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
C6 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
**************************************************
C1 SKR
C2 SKR
C3 SKR
C4 SKR
C5 SKR
C6 SKR
***
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
C2 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
C3 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
C4 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
C5 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
C6 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
**************************************************
C1 CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
C2 CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
C3 CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
C4 CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
C5 CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
C6 CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
**************************************************
C1 GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
C2 GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
C3 GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
C4 GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
C5 GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
C6 GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
**************************************************
C1 TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
C2 TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
C3 TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
C4 TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
C5 TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
C6 TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
**************************************************
C1 TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
C2 TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
C3 TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
C4 TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
C5 TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
C6 TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
**************************************************
C1 TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
C2 TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
C3 TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
C4 TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
C5 TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
C6 TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
**************************************************
C1 GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
C2 GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
C3 GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
C4 GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
C5 GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
C6 GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
**************************************************
C1 CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
C2 CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
C3 CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
C4 CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
C5 CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
C6 CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
**************************************************
C1 CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
C2 CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
C3 CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
C4 CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
C5 CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
C6 CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
**************************************************
C1 AGCAAGCGC
C2 AGCAAGCGC
C3 AGCAAGCGC
C4 AGCAAGCGC
C5 AGCAAGCGC
C6 AGCAAGCGC
*********
>C1
GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
AGCAAGCGC
>C2
GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
AGCAAGCGC
>C3
GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
AGCAAGCGC
>C4
GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
AGCAAGCGC
>C5
GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
AGCAAGCGC
>C6
GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC
CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC
GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG
TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA
TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT
TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG
GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA
CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA
CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC
AGCAAGCGC
>C1
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
>C2
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
>C3
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
>C4
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
>C5
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
>C6
VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
SKR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 459 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792783
Setting output file names to "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 882253158
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0483631343
Seed = 457469917
Swapseed = 1579792783
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1027.264005 -- -24.965149
Chain 2 -- -1027.263946 -- -24.965149
Chain 3 -- -1027.264005 -- -24.965149
Chain 4 -- -1027.264005 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1027.263946 -- -24.965149
Chain 2 -- -1027.263946 -- -24.965149
Chain 3 -- -1027.264005 -- -24.965149
Chain 4 -- -1027.264005 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1027.264] (-1027.264) (-1027.264) (-1027.264) * [-1027.264] (-1027.264) (-1027.264) (-1027.264)
500 -- (-634.511) (-636.595) (-645.066) [-640.988] * (-640.197) (-642.613) (-638.477) [-643.462] -- 0:00:00
1000 -- [-638.657] (-637.131) (-636.604) (-636.701) * (-634.026) (-639.368) (-636.327) [-632.583] -- 0:00:00
1500 -- (-635.689) (-638.064) (-644.450) [-631.762] * (-632.788) (-644.115) (-630.063) [-634.203] -- 0:00:00
2000 -- (-637.107) (-634.810) [-630.342] (-642.572) * (-631.057) (-646.043) [-632.455] (-639.266) -- 0:00:00
2500 -- (-642.649) (-643.366) [-633.627] (-641.062) * (-643.754) [-638.610] (-640.966) (-645.713) -- 0:00:00
3000 -- (-637.674) (-640.418) (-636.700) [-636.915] * (-647.551) [-634.291] (-640.139) (-643.728) -- 0:00:00
3500 -- (-633.720) [-637.424] (-635.822) (-646.853) * (-630.217) (-646.334) (-636.923) [-635.311] -- 0:00:00
4000 -- [-635.289] (-633.387) (-636.515) (-630.161) * [-640.221] (-635.483) (-640.385) (-639.254) -- 0:00:00
4500 -- (-631.332) [-637.950] (-634.034) (-635.353) * (-634.206) (-638.798) (-636.500) [-637.232] -- 0:00:00
5000 -- (-632.029) [-641.777] (-639.085) (-634.467) * (-632.562) (-641.221) (-637.870) [-634.293] -- 0:00:00
Average standard deviation of split frequencies: 0.088815
5500 -- (-634.741) (-632.835) (-637.004) [-636.072] * (-638.166) (-638.317) (-643.098) [-641.487] -- 0:00:00
6000 -- [-637.561] (-632.133) (-642.790) (-632.000) * [-635.375] (-632.450) (-636.342) (-631.459) -- 0:00:00
6500 -- [-636.640] (-640.643) (-641.735) (-638.961) * [-646.475] (-635.831) (-635.119) (-636.376) -- 0:00:00
7000 -- [-643.817] (-632.730) (-636.529) (-638.979) * [-632.426] (-636.472) (-646.838) (-639.189) -- 0:00:00
7500 -- (-635.827) (-638.699) (-639.449) [-634.697] * (-635.342) [-630.109] (-632.039) (-637.261) -- 0:00:00
8000 -- (-642.930) (-639.150) [-638.418] (-636.080) * (-636.254) (-640.526) [-632.360] (-642.404) -- 0:00:00
8500 -- (-638.754) (-634.168) (-632.359) [-633.383] * (-643.535) [-641.197] (-634.965) (-628.064) -- 0:00:00
9000 -- [-630.292] (-634.184) (-635.765) (-631.979) * (-643.545) [-642.256] (-637.064) (-630.914) -- 0:00:00
9500 -- (-637.209) (-638.235) (-635.441) [-637.064] * (-643.624) (-642.517) [-637.062] (-625.113) -- 0:00:00
10000 -- (-636.834) (-644.992) (-640.475) [-636.764] * (-640.805) (-638.089) [-633.873] (-630.417) -- 0:00:00
Average standard deviation of split frequencies: 0.073657
10500 -- (-645.792) [-635.956] (-635.145) (-638.105) * (-633.681) [-634.661] (-631.816) (-629.046) -- 0:00:00
11000 -- (-640.058) (-635.196) (-632.673) [-635.449] * [-630.943] (-643.581) (-644.801) (-630.529) -- 0:00:00
11500 -- (-632.291) (-638.191) [-636.695] (-635.476) * (-638.176) (-631.966) (-635.397) [-628.719] -- 0:00:00
12000 -- (-632.360) (-640.889) (-639.139) [-634.078] * (-637.429) [-638.544] (-640.074) (-626.628) -- 0:01:22
12500 -- (-640.028) [-640.751] (-647.087) (-636.335) * (-646.609) (-634.128) [-632.759] (-627.105) -- 0:01:19
13000 -- (-634.064) [-638.361] (-628.538) (-645.287) * (-643.599) [-634.654] (-640.016) (-631.009) -- 0:01:15
13500 -- (-640.341) [-640.891] (-627.991) (-636.791) * (-637.082) [-637.388] (-632.793) (-631.163) -- 0:01:13
14000 -- [-634.127] (-641.551) (-628.120) (-630.667) * (-641.694) [-630.203] (-638.017) (-633.630) -- 0:01:10
14500 -- (-635.889) [-631.962] (-627.866) (-626.627) * (-629.943) (-640.116) (-637.589) [-628.207] -- 0:01:07
15000 -- (-632.761) (-630.177) (-625.819) [-627.279] * [-630.017] (-637.047) (-641.523) (-627.385) -- 0:01:05
Average standard deviation of split frequencies: 0.070149
15500 -- [-638.926] (-639.683) (-626.507) (-626.923) * (-627.233) (-643.048) (-633.964) [-626.490] -- 0:01:03
16000 -- [-639.747] (-635.710) (-626.823) (-624.671) * (-626.414) (-642.254) (-638.240) [-625.049] -- 0:01:01
16500 -- (-638.504) (-637.471) (-626.139) [-627.163] * [-627.254] (-635.756) (-635.653) (-627.401) -- 0:00:59
17000 -- [-633.504] (-636.831) (-625.723) (-625.160) * (-626.676) [-635.519] (-633.318) (-626.871) -- 0:00:57
17500 -- [-632.696] (-644.972) (-624.920) (-625.763) * (-626.187) (-632.546) [-637.123] (-626.129) -- 0:00:56
18000 -- (-634.592) (-641.668) (-626.738) [-626.042] * [-625.581] (-642.279) (-634.792) (-627.823) -- 0:00:54
18500 -- [-634.170] (-639.636) (-625.611) (-628.262) * (-625.763) (-634.879) [-635.006] (-629.440) -- 0:00:53
19000 -- (-635.165) [-639.289] (-626.233) (-628.058) * (-627.108) (-635.862) (-632.972) [-629.219] -- 0:00:51
19500 -- (-636.923) (-637.119) [-627.612] (-626.949) * [-626.128] (-637.621) (-633.910) (-625.993) -- 0:00:50
20000 -- (-644.274) (-644.645) [-627.635] (-629.684) * (-625.495) (-634.136) [-634.802] (-628.549) -- 0:00:49
Average standard deviation of split frequencies: 0.046962
20500 -- (-637.113) (-644.337) (-626.180) [-626.757] * (-627.150) (-640.474) [-637.838] (-627.211) -- 0:00:47
21000 -- [-637.755] (-636.756) (-628.912) (-626.924) * [-626.501] (-633.621) (-632.877) (-627.721) -- 0:00:46
21500 -- (-638.976) (-646.103) (-626.745) [-626.432] * [-626.047] (-634.846) (-634.064) (-628.937) -- 0:00:45
22000 -- (-643.769) (-638.250) [-629.613] (-629.590) * (-625.184) (-634.778) [-638.519] (-627.927) -- 0:00:44
22500 -- (-634.772) (-633.104) (-628.885) [-630.186] * (-626.806) [-631.671] (-636.777) (-627.111) -- 0:00:43
23000 -- (-633.141) (-640.708) [-629.298] (-625.637) * (-625.654) (-632.125) (-634.593) [-631.177] -- 0:00:42
23500 -- (-633.865) (-637.615) (-626.397) [-626.691] * (-626.419) [-634.279] (-636.180) (-628.038) -- 0:00:41
24000 -- (-636.590) (-636.846) [-626.367] (-627.242) * [-627.001] (-637.206) (-633.191) (-626.827) -- 0:00:40
24500 -- (-634.397) (-648.854) (-625.372) [-626.617] * [-625.476] (-639.519) (-641.824) (-630.845) -- 0:00:39
25000 -- (-641.151) [-641.065] (-625.687) (-625.164) * (-628.996) (-632.561) [-637.274] (-625.281) -- 0:00:39
Average standard deviation of split frequencies: 0.046976
25500 -- (-636.144) (-636.021) [-627.862] (-627.657) * (-626.387) (-639.660) [-629.122] (-625.713) -- 0:00:38
26000 -- [-634.287] (-627.662) (-630.264) (-631.567) * (-627.006) [-634.335] (-640.238) (-626.081) -- 0:01:14
26500 -- (-637.711) (-625.387) (-630.703) [-627.642] * (-629.100) (-637.696) (-643.957) [-627.933] -- 0:01:13
27000 -- (-645.229) (-625.966) (-628.550) [-628.688] * [-626.690] (-635.594) (-635.994) (-634.364) -- 0:01:12
27500 -- (-641.174) (-626.918) [-626.891] (-628.834) * [-627.724] (-632.678) (-635.989) (-630.704) -- 0:01:10
28000 -- (-642.613) [-626.976] (-626.828) (-625.167) * (-628.131) (-638.988) [-635.671] (-631.155) -- 0:01:09
28500 -- (-640.445) [-626.200] (-627.604) (-627.656) * (-625.597) (-634.494) [-630.903] (-628.316) -- 0:01:08
29000 -- (-641.247) (-628.398) [-627.588] (-626.759) * (-624.823) (-640.701) [-634.454] (-627.862) -- 0:01:06
29500 -- (-633.446) (-628.421) (-627.111) [-625.438] * (-627.483) [-633.353] (-637.125) (-625.976) -- 0:01:05
30000 -- (-637.415) [-629.520] (-629.420) (-627.554) * (-628.401) (-640.940) (-636.824) [-626.239] -- 0:01:04
Average standard deviation of split frequencies: 0.048421
30500 -- (-648.297) (-626.855) [-626.161] (-627.369) * (-626.660) (-635.271) (-634.839) [-626.018] -- 0:01:03
31000 -- (-652.385) (-632.445) (-625.956) [-625.523] * (-625.742) (-639.340) (-640.531) [-629.901] -- 0:01:02
31500 -- (-640.281) (-632.493) [-630.278] (-625.787) * (-628.010) (-636.494) (-635.659) [-628.474] -- 0:01:01
32000 -- (-653.648) (-629.680) (-627.624) [-625.370] * (-631.017) [-641.315] (-634.988) (-630.463) -- 0:01:00
32500 -- (-634.603) (-627.507) (-627.106) [-626.448] * (-626.602) (-633.873) [-634.786] (-630.523) -- 0:00:59
33000 -- (-645.790) (-625.503) [-627.075] (-628.549) * [-629.767] (-630.078) (-641.847) (-626.653) -- 0:00:58
33500 -- (-635.385) (-626.887) [-625.434] (-630.804) * [-625.841] (-634.663) (-634.082) (-629.148) -- 0:00:57
34000 -- (-630.196) (-627.519) [-624.734] (-631.252) * (-625.794) (-631.893) (-632.563) [-628.084] -- 0:00:56
34500 -- [-627.105] (-629.274) (-625.202) (-633.034) * (-628.731) [-632.098] (-639.652) (-625.890) -- 0:00:55
35000 -- [-627.566] (-628.791) (-625.466) (-628.324) * [-628.395] (-634.321) (-634.508) (-626.805) -- 0:00:55
Average standard deviation of split frequencies: 0.039284
35500 -- [-627.804] (-629.149) (-625.010) (-626.392) * [-629.866] (-637.172) (-635.242) (-626.637) -- 0:00:54
36000 -- [-626.446] (-626.020) (-624.766) (-627.441) * [-628.320] (-635.549) (-641.143) (-627.347) -- 0:00:53
36500 -- [-626.408] (-627.118) (-627.216) (-629.490) * (-626.847) (-646.960) [-637.450] (-627.272) -- 0:00:52
37000 -- [-626.823] (-626.623) (-624.801) (-629.296) * [-628.872] (-644.014) (-635.836) (-626.166) -- 0:00:52
37500 -- [-626.204] (-630.310) (-625.470) (-627.118) * (-629.204) [-633.806] (-635.717) (-627.146) -- 0:00:51
38000 -- (-629.174) [-627.585] (-625.805) (-626.854) * (-631.182) (-634.116) [-639.438] (-625.956) -- 0:00:50
38500 -- (-626.372) (-625.884) [-625.458] (-627.614) * (-627.079) (-633.961) (-636.989) [-625.820] -- 0:00:49
39000 -- (-628.105) (-628.837) [-625.392] (-628.241) * (-627.062) (-636.291) [-635.594] (-627.208) -- 0:00:49
39500 -- (-625.825) (-634.714) (-627.822) [-628.788] * (-626.146) (-635.751) [-630.085] (-633.742) -- 0:00:48
40000 -- [-625.679] (-632.850) (-627.574) (-629.803) * (-625.929) [-641.954] (-640.638) (-628.455) -- 0:00:48
Average standard deviation of split frequencies: 0.040572
40500 -- (-630.800) (-627.628) [-628.108] (-626.326) * (-629.337) (-632.695) [-633.486] (-628.853) -- 0:00:47
41000 -- (-625.577) (-626.227) [-628.259] (-626.162) * (-627.773) [-633.108] (-630.555) (-627.188) -- 0:00:46
41500 -- (-629.300) (-628.948) (-626.563) [-627.953] * [-627.095] (-644.911) (-633.427) (-628.404) -- 0:00:46
42000 -- [-625.470] (-626.145) (-625.297) (-628.660) * (-627.766) (-638.727) [-630.600] (-626.015) -- 0:01:08
42500 -- [-625.925] (-625.708) (-632.509) (-627.268) * (-625.849) (-651.108) [-629.374] (-626.398) -- 0:01:07
43000 -- (-629.373) (-626.707) [-630.472] (-632.749) * (-630.396) (-635.587) [-634.105] (-625.735) -- 0:01:06
43500 -- (-629.431) [-626.937] (-630.465) (-626.499) * (-627.684) [-626.660] (-644.147) (-626.056) -- 0:01:05
44000 -- (-625.632) (-626.362) (-626.777) [-625.318] * [-626.555] (-626.963) (-638.862) (-625.204) -- 0:01:05
44500 -- (-625.078) (-627.085) (-626.209) [-625.784] * (-626.255) [-624.939] (-643.031) (-625.922) -- 0:01:04
45000 -- (-627.597) (-628.272) [-627.472] (-625.725) * (-626.038) (-630.429) (-632.355) [-625.808] -- 0:01:03
Average standard deviation of split frequencies: 0.037405
45500 -- (-625.462) (-625.533) (-630.004) [-626.184] * (-625.025) (-627.681) (-626.833) [-627.242] -- 0:01:02
46000 -- (-628.287) (-627.032) [-626.975] (-626.254) * (-624.932) (-629.132) [-627.402] (-625.017) -- 0:01:02
46500 -- [-626.685] (-626.333) (-626.905) (-627.240) * [-625.708] (-627.864) (-627.957) (-626.359) -- 0:01:01
47000 -- [-626.161] (-629.122) (-628.619) (-628.905) * (-626.270) (-629.109) (-629.662) [-628.313] -- 0:01:00
47500 -- (-629.077) (-626.302) (-627.379) [-628.034] * (-630.620) [-625.538] (-625.545) (-627.766) -- 0:01:00
48000 -- [-629.059] (-625.520) (-627.051) (-629.703) * [-625.929] (-625.542) (-625.193) (-625.471) -- 0:00:59
48500 -- (-627.632) [-625.101] (-626.189) (-626.743) * (-627.778) [-626.266] (-629.454) (-628.459) -- 0:00:58
49000 -- (-629.875) (-626.741) [-625.619] (-628.490) * (-627.635) [-626.014] (-626.907) (-629.666) -- 0:00:58
49500 -- (-626.564) (-634.999) [-629.856] (-631.866) * (-626.598) (-626.292) (-626.418) [-630.012] -- 0:00:57
50000 -- (-625.469) [-627.953] (-629.079) (-629.354) * (-625.460) (-627.367) [-627.648] (-629.604) -- 0:00:57
Average standard deviation of split frequencies: 0.032099
50500 -- (-626.349) (-626.026) (-625.848) [-628.754] * (-625.262) (-628.461) (-627.092) [-626.477] -- 0:00:56
51000 -- (-625.626) [-628.563] (-626.830) (-625.853) * (-626.384) (-625.637) [-629.849] (-625.821) -- 0:00:55
51500 -- (-625.872) (-625.672) (-627.491) [-626.255] * (-628.384) (-625.543) (-625.454) [-625.483] -- 0:00:55
52000 -- (-630.049) (-626.659) (-627.040) [-624.820] * (-627.385) (-626.321) (-625.885) [-625.598] -- 0:00:54
52500 -- (-627.201) [-628.208] (-628.452) (-631.138) * (-625.632) (-628.621) (-627.566) [-627.806] -- 0:00:54
53000 -- (-627.916) (-629.273) [-631.320] (-626.683) * [-626.718] (-627.506) (-629.534) (-627.586) -- 0:00:53
53500 -- (-631.621) (-627.492) [-625.220] (-625.536) * (-627.851) [-629.133] (-625.390) (-630.248) -- 0:00:53
54000 -- (-629.449) (-627.107) (-625.684) [-625.018] * (-627.291) (-628.209) [-625.212] (-628.435) -- 0:00:52
54500 -- [-628.537] (-626.603) (-625.717) (-625.389) * [-625.775] (-626.305) (-626.762) (-625.775) -- 0:00:52
55000 -- (-629.514) (-625.993) (-626.279) [-625.508] * (-627.688) (-626.114) [-626.574] (-629.475) -- 0:00:51
Average standard deviation of split frequencies: 0.030866
55500 -- (-626.602) (-626.797) [-625.637] (-625.851) * [-628.390] (-626.710) (-625.671) (-625.038) -- 0:00:51
56000 -- [-626.694] (-627.314) (-624.991) (-626.260) * (-624.866) (-627.025) (-626.715) [-629.350] -- 0:01:07
56500 -- (-625.761) (-625.523) [-627.612] (-626.367) * (-627.279) [-627.072] (-625.970) (-628.601) -- 0:01:06
57000 -- (-628.753) (-628.125) (-631.398) [-626.314] * [-625.149] (-630.744) (-627.300) (-626.900) -- 0:01:06
57500 -- (-625.716) (-631.524) [-625.289] (-626.038) * (-625.396) (-631.257) (-626.228) [-629.665] -- 0:01:05
58000 -- (-628.438) (-628.071) [-625.264] (-625.415) * (-625.624) (-631.259) [-628.503] (-626.754) -- 0:01:04
58500 -- (-624.893) (-628.338) (-628.318) [-627.396] * (-626.695) (-629.752) (-628.282) [-626.449] -- 0:01:04
59000 -- [-626.981] (-627.454) (-626.979) (-626.691) * (-629.482) (-627.707) (-626.179) [-627.952] -- 0:01:03
59500 -- [-628.506] (-629.155) (-627.647) (-625.790) * (-627.880) [-626.966] (-626.179) (-626.695) -- 0:01:03
60000 -- [-626.820] (-629.567) (-625.858) (-632.763) * [-627.931] (-626.066) (-625.461) (-625.977) -- 0:01:02
Average standard deviation of split frequencies: 0.028339
60500 -- [-627.042] (-629.159) (-626.294) (-626.186) * (-626.070) (-624.962) (-625.188) [-626.620] -- 0:01:02
61000 -- (-629.530) (-625.335) (-625.252) [-626.409] * (-628.433) (-626.341) [-627.162] (-626.764) -- 0:01:01
61500 -- (-628.365) (-627.551) (-626.336) [-627.548] * (-625.063) (-625.354) [-630.476] (-629.065) -- 0:01:01
62000 -- [-626.588] (-625.710) (-626.839) (-626.009) * (-626.832) (-625.760) (-629.155) [-627.440] -- 0:01:00
62500 -- (-625.652) (-626.054) (-627.316) [-625.987] * [-626.884] (-624.659) (-628.638) (-632.169) -- 0:01:00
63000 -- [-626.606] (-627.526) (-627.260) (-627.730) * (-628.232) (-625.324) (-627.021) [-625.392] -- 0:00:59
63500 -- (-625.954) (-625.266) (-627.157) [-628.291] * (-628.137) [-625.331] (-627.635) (-625.234) -- 0:00:58
64000 -- [-630.658] (-626.685) (-627.022) (-628.237) * [-628.264] (-629.047) (-627.476) (-627.682) -- 0:00:58
64500 -- (-625.913) [-630.577] (-629.313) (-628.069) * (-628.083) [-625.656] (-625.913) (-625.449) -- 0:00:58
65000 -- (-626.031) (-629.355) (-627.152) [-626.697] * [-627.125] (-626.938) (-627.679) (-627.017) -- 0:00:57
Average standard deviation of split frequencies: 0.021427
65500 -- (-626.650) [-629.545] (-625.768) (-626.298) * [-627.270] (-625.212) (-625.826) (-624.998) -- 0:00:57
66000 -- (-626.158) (-627.445) [-628.161] (-627.728) * (-628.238) (-628.827) (-628.149) [-627.380] -- 0:00:56
66500 -- [-624.975] (-627.606) (-628.167) (-625.936) * [-626.364] (-626.333) (-628.549) (-625.702) -- 0:00:56
67000 -- (-627.043) [-627.829] (-624.993) (-626.864) * (-626.261) (-624.757) [-627.295] (-627.540) -- 0:00:55
67500 -- (-625.218) (-629.320) [-625.876] (-627.331) * [-626.106] (-628.424) (-627.730) (-627.550) -- 0:00:55
68000 -- (-625.302) [-627.130] (-628.166) (-630.174) * (-625.389) (-625.916) [-626.972] (-628.830) -- 0:00:54
68500 -- [-626.387] (-625.806) (-626.065) (-625.236) * [-628.178] (-630.702) (-626.310) (-626.695) -- 0:00:54
69000 -- (-626.182) [-627.096] (-629.294) (-627.328) * (-630.246) (-626.617) [-627.662] (-626.723) -- 0:00:53
69500 -- (-626.701) (-627.236) (-626.256) [-626.456] * (-630.603) (-627.113) [-627.065] (-628.444) -- 0:01:06
70000 -- (-627.873) [-628.554] (-627.062) (-626.203) * [-626.384] (-626.479) (-626.119) (-626.937) -- 0:01:06
Average standard deviation of split frequencies: 0.020012
70500 -- (-627.660) (-627.872) [-628.207] (-625.378) * (-627.217) (-627.153) (-624.883) [-624.975] -- 0:01:05
71000 -- (-625.126) [-626.807] (-629.936) (-627.161) * (-627.891) [-626.077] (-627.906) (-625.052) -- 0:01:05
71500 -- (-627.403) (-632.987) (-629.789) [-625.136] * (-626.121) (-625.785) (-625.377) [-627.260] -- 0:01:04
72000 -- [-625.145] (-625.535) (-628.507) (-629.468) * (-626.932) (-627.257) [-627.420] (-625.639) -- 0:01:04
72500 -- [-627.348] (-627.784) (-625.816) (-630.153) * (-631.196) (-625.001) (-627.168) [-624.881] -- 0:01:03
73000 -- (-629.354) (-626.292) [-626.061] (-626.440) * [-628.400] (-626.457) (-627.914) (-627.191) -- 0:01:03
73500 -- (-626.922) (-627.720) [-626.264] (-626.234) * [-628.338] (-625.221) (-625.158) (-627.660) -- 0:01:03
74000 -- (-626.308) [-625.747] (-627.201) (-625.568) * (-626.489) (-628.227) (-625.393) [-625.877] -- 0:01:02
74500 -- (-626.037) (-625.024) (-627.909) [-625.507] * (-628.376) (-626.004) (-625.620) [-627.235] -- 0:01:02
75000 -- [-625.845] (-625.658) (-634.927) (-625.216) * [-625.435] (-626.204) (-625.420) (-626.902) -- 0:01:01
Average standard deviation of split frequencies: 0.020469
75500 -- (-627.207) (-625.927) (-625.308) [-625.469] * (-625.656) [-625.545] (-625.442) (-629.524) -- 0:01:01
76000 -- (-627.210) (-625.457) (-626.724) [-624.745] * (-625.447) (-626.764) [-627.366] (-627.193) -- 0:01:00
76500 -- (-628.489) (-625.620) (-626.363) [-626.485] * (-625.890) (-627.759) [-628.548] (-632.568) -- 0:01:00
77000 -- (-628.498) [-626.078] (-630.386) (-627.782) * [-625.678] (-628.107) (-627.837) (-627.234) -- 0:00:59
77500 -- (-630.224) [-626.969] (-627.813) (-626.562) * (-627.714) [-630.778] (-628.885) (-627.191) -- 0:00:59
78000 -- (-630.415) [-627.635] (-627.926) (-626.940) * [-625.247] (-627.667) (-625.839) (-625.931) -- 0:00:59
78500 -- (-625.288) [-625.222] (-627.138) (-627.252) * [-626.427] (-626.651) (-625.736) (-625.409) -- 0:00:58
79000 -- [-627.436] (-626.934) (-626.147) (-626.439) * (-625.181) (-630.723) (-625.606) [-627.212] -- 0:00:58
79500 -- (-625.774) (-628.568) (-627.784) [-626.917] * [-629.962] (-627.621) (-626.159) (-629.632) -- 0:00:57
80000 -- (-627.006) [-634.109] (-628.694) (-627.693) * (-624.834) (-626.582) (-627.961) [-626.120] -- 0:00:57
Average standard deviation of split frequencies: 0.026947
80500 -- [-625.555] (-626.754) (-628.160) (-628.528) * [-626.609] (-625.162) (-626.701) (-626.375) -- 0:00:57
81000 -- (-625.689) (-626.255) (-625.800) [-626.347] * [-627.730] (-624.915) (-627.375) (-625.212) -- 0:00:56
81500 -- (-629.847) [-628.252] (-626.729) (-628.974) * [-625.604] (-626.364) (-626.756) (-625.744) -- 0:00:56
82000 -- (-625.601) (-629.369) (-627.935) [-629.232] * [-628.724] (-627.045) (-626.658) (-626.062) -- 0:00:55
82500 -- [-626.190] (-626.764) (-627.560) (-625.823) * [-627.037] (-630.755) (-626.900) (-626.841) -- 0:00:55
83000 -- (-628.671) (-627.248) [-627.733] (-628.240) * (-628.166) (-627.674) (-625.677) [-626.939] -- 0:00:55
83500 -- (-631.332) (-627.261) (-627.654) [-628.113] * (-632.834) [-625.646] (-627.009) (-628.378) -- 0:00:54
84000 -- (-632.876) (-626.210) (-627.005) [-627.693] * (-631.014) (-627.700) (-627.716) [-627.218] -- 0:00:54
84500 -- (-629.945) [-626.813] (-627.675) (-629.900) * (-628.195) (-633.842) [-627.796] (-627.662) -- 0:00:54
85000 -- (-628.128) (-628.196) (-628.995) [-626.693] * (-625.978) (-628.181) (-626.576) [-626.291] -- 0:00:53
Average standard deviation of split frequencies: 0.023657
85500 -- (-625.549) (-626.945) [-625.224] (-626.512) * (-626.581) (-631.535) (-626.378) [-627.839] -- 0:01:04
86000 -- (-627.187) [-626.716] (-630.009) (-630.786) * (-626.167) [-628.084] (-627.712) (-627.657) -- 0:01:03
86500 -- (-625.438) (-628.478) [-625.913] (-626.393) * (-628.910) (-627.067) [-629.399] (-627.280) -- 0:01:03
87000 -- [-625.927] (-628.993) (-626.612) (-625.893) * (-625.220) (-629.800) [-628.643] (-630.318) -- 0:01:02
87500 -- (-631.494) (-624.765) (-624.919) [-625.014] * (-627.466) (-627.479) [-626.007] (-626.223) -- 0:01:02
88000 -- (-625.834) (-625.782) [-625.885] (-627.487) * (-627.360) [-625.578] (-627.631) (-627.015) -- 0:01:02
88500 -- (-626.019) [-626.522] (-626.849) (-628.406) * (-628.452) [-624.880] (-626.519) (-627.395) -- 0:01:01
89000 -- (-626.765) (-630.388) [-625.119] (-625.497) * (-626.504) (-625.873) (-626.238) [-628.966] -- 0:01:01
89500 -- (-630.597) (-626.226) (-628.528) [-626.716] * [-626.588] (-624.746) (-626.771) (-638.035) -- 0:01:01
90000 -- (-625.560) [-625.813] (-626.884) (-628.010) * (-626.899) [-627.123] (-629.766) (-627.898) -- 0:01:00
Average standard deviation of split frequencies: 0.020797
90500 -- (-626.738) (-626.588) [-628.711] (-628.816) * (-627.686) (-626.350) [-629.406] (-627.278) -- 0:01:00
91000 -- [-625.325] (-626.495) (-626.695) (-627.113) * (-627.280) (-627.005) (-626.822) [-625.725] -- 0:00:59
91500 -- (-628.545) (-627.285) (-627.662) [-632.023] * (-629.047) [-625.899] (-627.979) (-630.918) -- 0:00:59
92000 -- (-627.102) (-627.698) [-626.769] (-628.371) * (-627.082) (-626.273) (-627.776) [-628.897] -- 0:00:59
92500 -- (-626.993) [-628.806] (-629.791) (-630.246) * (-625.652) [-625.099] (-627.080) (-627.513) -- 0:00:58
93000 -- (-628.308) (-627.566) (-626.738) [-628.693] * (-625.560) (-625.152) (-626.080) [-625.684] -- 0:00:58
93500 -- (-627.932) [-625.020] (-628.467) (-629.160) * [-627.001] (-625.629) (-629.000) (-625.557) -- 0:00:58
94000 -- (-628.840) [-625.402] (-631.495) (-627.745) * [-628.244] (-627.296) (-626.607) (-626.171) -- 0:00:57
94500 -- [-627.293] (-625.707) (-626.937) (-626.346) * (-626.997) (-627.794) (-628.686) [-625.024] -- 0:00:57
95000 -- (-629.339) (-629.701) (-629.184) [-631.074] * (-627.372) (-627.772) (-629.359) [-626.224] -- 0:00:57
Average standard deviation of split frequencies: 0.022097
95500 -- (-629.756) (-630.035) (-627.467) [-626.592] * (-626.423) (-625.597) (-627.764) [-626.201] -- 0:00:56
96000 -- (-626.104) [-628.074] (-629.957) (-628.092) * (-630.415) [-627.232] (-628.866) (-626.084) -- 0:00:56
96500 -- (-627.373) [-628.635] (-625.771) (-630.272) * [-626.409] (-625.780) (-629.255) (-625.984) -- 0:00:56
97000 -- (-626.133) (-625.132) (-626.914) [-626.562] * (-627.350) (-628.089) [-626.134] (-626.520) -- 0:00:55
97500 -- (-625.110) (-625.137) [-630.471] (-626.160) * [-624.983] (-625.290) (-626.438) (-626.838) -- 0:00:55
98000 -- [-627.289] (-626.865) (-630.968) (-628.045) * (-625.094) [-626.433] (-626.064) (-627.029) -- 0:00:55
98500 -- (-629.689) (-625.890) (-627.330) [-626.078] * (-627.017) (-626.112) [-626.015] (-627.902) -- 0:00:54
99000 -- (-627.901) (-627.939) (-625.909) [-626.146] * (-628.348) (-627.468) [-628.842] (-627.134) -- 0:00:54
99500 -- (-625.998) (-632.284) (-627.584) [-628.538] * [-626.710] (-626.655) (-625.032) (-628.289) -- 0:00:54
100000 -- (-626.483) (-630.421) (-626.283) [-629.049] * (-625.681) [-626.887] (-625.924) (-629.507) -- 0:00:54
Average standard deviation of split frequencies: 0.020032
100500 -- (-627.120) [-626.833] (-627.444) (-629.567) * (-625.348) [-629.094] (-624.934) (-627.628) -- 0:00:53
101000 -- (-628.000) [-625.480] (-625.342) (-626.800) * (-625.530) (-629.752) (-626.674) [-627.384] -- 0:00:53
101500 -- (-626.043) (-634.802) (-625.551) [-627.506] * (-625.509) (-626.647) (-625.352) [-627.999] -- 0:01:01
102000 -- (-625.601) (-633.816) [-625.822] (-626.324) * [-626.604] (-628.516) (-626.654) (-626.386) -- 0:01:01
102500 -- (-625.988) [-628.328] (-629.402) (-628.243) * (-627.407) (-628.457) (-625.352) [-626.832] -- 0:01:01
103000 -- [-625.807] (-626.776) (-627.925) (-626.863) * [-626.075] (-627.808) (-626.711) (-626.611) -- 0:01:00
103500 -- (-626.634) (-626.841) (-627.894) [-628.117] * [-626.359] (-626.476) (-625.177) (-632.268) -- 0:01:00
104000 -- (-626.611) (-625.010) [-626.159] (-628.487) * (-628.375) (-625.919) (-625.837) [-628.075] -- 0:01:00
104500 -- (-626.207) [-626.637] (-627.012) (-628.242) * (-627.912) (-627.140) [-626.754] (-626.942) -- 0:00:59
105000 -- (-629.227) (-627.946) (-632.136) [-626.918] * (-626.911) [-627.687] (-626.403) (-628.914) -- 0:00:59
Average standard deviation of split frequencies: 0.018959
105500 -- (-625.734) [-627.584] (-628.467) (-631.153) * (-629.318) [-625.485] (-633.180) (-628.187) -- 0:00:59
106000 -- (-626.746) (-626.275) (-627.196) [-627.686] * (-634.489) (-625.855) (-629.698) [-627.082] -- 0:00:59
106500 -- (-631.330) (-627.430) (-626.155) [-627.737] * (-626.824) [-626.637] (-627.895) (-626.741) -- 0:00:58
107000 -- [-627.031] (-625.509) (-627.699) (-627.347) * (-625.904) [-626.697] (-629.718) (-627.969) -- 0:00:58
107500 -- (-624.940) (-626.216) [-629.965] (-629.368) * (-625.054) (-625.489) (-626.044) [-626.724] -- 0:00:58
108000 -- (-625.434) [-628.070] (-627.637) (-629.797) * [-624.857] (-626.735) (-629.355) (-626.702) -- 0:00:57
108500 -- (-626.587) (-625.700) (-627.245) [-626.466] * [-627.378] (-627.266) (-626.915) (-625.497) -- 0:00:57
109000 -- [-627.696] (-625.533) (-625.854) (-627.478) * (-626.011) [-626.788] (-629.896) (-625.812) -- 0:00:57
109500 -- (-629.034) (-626.561) [-625.280] (-626.495) * (-633.283) (-625.316) (-627.846) [-626.473] -- 0:00:56
110000 -- (-629.811) [-627.709] (-624.801) (-625.369) * (-628.887) (-629.242) (-625.663) [-626.932] -- 0:00:56
Average standard deviation of split frequencies: 0.018542
110500 -- (-626.186) [-626.536] (-627.395) (-627.834) * (-625.977) [-627.161] (-625.192) (-626.792) -- 0:00:56
111000 -- [-626.092] (-629.354) (-627.542) (-625.552) * (-632.271) (-625.910) [-627.685] (-628.119) -- 0:00:56
111500 -- (-627.632) (-629.016) (-629.528) [-626.041] * (-627.667) (-626.563) (-629.843) [-626.081] -- 0:00:55
112000 -- (-630.433) (-626.080) (-627.528) [-626.275] * (-627.903) [-626.296] (-625.437) (-626.120) -- 0:00:55
112500 -- (-627.313) (-625.454) (-628.132) [-625.461] * (-626.785) (-626.313) (-625.896) [-625.363] -- 0:00:55
113000 -- (-626.867) [-627.783] (-630.843) (-626.045) * (-625.235) (-630.400) (-627.533) [-624.801] -- 0:00:54
113500 -- (-626.424) [-625.094] (-627.935) (-626.542) * (-629.118) (-626.649) (-625.253) [-625.951] -- 0:00:54
114000 -- (-625.818) [-627.151] (-626.688) (-625.977) * (-628.762) (-626.735) (-628.807) [-625.624] -- 0:00:54
114500 -- [-626.026] (-626.940) (-627.005) (-626.465) * (-627.224) (-625.971) (-628.613) [-626.173] -- 0:00:54
115000 -- [-624.795] (-625.935) (-626.964) (-626.195) * (-630.103) [-628.275] (-626.357) (-625.836) -- 0:00:53
Average standard deviation of split frequencies: 0.018608
115500 -- (-627.490) [-626.467] (-625.930) (-626.304) * [-625.943] (-629.691) (-625.083) (-630.865) -- 0:00:53
116000 -- (-628.505) [-626.625] (-626.447) (-630.000) * [-626.309] (-627.856) (-627.749) (-625.679) -- 0:00:53
116500 -- (-629.492) [-626.957] (-629.284) (-625.818) * (-626.977) (-629.680) (-627.502) [-625.187] -- 0:00:53
117000 -- [-630.215] (-626.399) (-627.957) (-626.285) * [-627.017] (-631.892) (-630.126) (-627.009) -- 0:00:52
117500 -- (-632.049) (-628.420) [-627.290] (-628.098) * (-627.335) (-627.982) (-628.430) [-627.809] -- 0:00:52
118000 -- (-631.157) [-627.105] (-627.279) (-630.046) * (-629.022) (-630.474) [-627.753] (-627.192) -- 0:00:59
118500 -- (-633.765) (-625.150) (-627.559) [-631.956] * [-625.640] (-632.173) (-627.029) (-627.711) -- 0:00:59
119000 -- (-630.876) (-625.158) (-625.259) [-630.961] * [-629.719] (-629.185) (-632.489) (-625.959) -- 0:00:59
119500 -- (-633.302) (-625.691) [-625.711] (-631.421) * (-626.379) [-627.378] (-631.192) (-629.315) -- 0:00:58
120000 -- (-633.076) (-628.857) [-625.939] (-628.787) * [-625.368] (-628.584) (-625.175) (-628.528) -- 0:00:58
Average standard deviation of split frequencies: 0.018231
120500 -- [-627.484] (-627.521) (-627.761) (-627.989) * (-626.358) (-626.340) (-629.287) [-626.703] -- 0:00:58
121000 -- (-626.185) (-630.889) (-626.313) [-625.987] * (-626.883) [-626.391] (-627.679) (-628.932) -- 0:00:58
121500 -- (-628.176) (-631.730) [-625.050] (-630.070) * (-627.889) (-625.503) (-625.230) [-626.346] -- 0:00:57
122000 -- (-627.625) [-626.000] (-627.128) (-626.266) * [-629.885] (-629.308) (-626.603) (-628.326) -- 0:00:57
122500 -- (-626.956) (-627.221) (-625.897) [-626.692] * [-626.189] (-627.010) (-626.825) (-628.736) -- 0:00:57
123000 -- (-628.386) [-626.699] (-628.371) (-633.935) * (-627.363) [-628.808] (-629.842) (-627.178) -- 0:00:57
123500 -- [-626.865] (-628.039) (-628.841) (-631.227) * (-626.501) (-628.440) (-629.674) [-628.957] -- 0:00:56
124000 -- (-630.752) (-626.142) [-626.248] (-627.025) * [-627.134] (-628.837) (-627.210) (-628.956) -- 0:00:56
124500 -- (-628.096) [-633.322] (-628.914) (-628.106) * (-626.550) [-628.885] (-625.755) (-627.687) -- 0:00:56
125000 -- (-626.543) (-630.699) (-627.233) [-627.107] * (-631.234) [-626.435] (-627.972) (-627.054) -- 0:00:56
Average standard deviation of split frequencies: 0.017459
125500 -- (-628.506) (-631.880) [-626.696] (-627.414) * (-630.033) [-626.859] (-627.337) (-625.549) -- 0:00:55
126000 -- (-625.832) [-626.130] (-625.955) (-627.068) * [-627.767] (-630.273) (-628.282) (-625.786) -- 0:00:55
126500 -- [-630.655] (-627.799) (-630.251) (-626.107) * (-628.610) (-625.444) (-630.243) [-628.120] -- 0:00:55
127000 -- (-629.478) (-628.721) [-628.371] (-627.207) * (-627.010) [-628.393] (-631.057) (-626.662) -- 0:00:54
127500 -- (-627.339) [-625.447] (-628.352) (-629.461) * (-627.214) [-625.936] (-628.112) (-629.081) -- 0:00:54
128000 -- (-624.999) (-627.599) [-628.022] (-626.984) * (-630.161) [-627.243] (-625.386) (-628.401) -- 0:00:54
128500 -- (-625.556) (-625.599) [-626.301] (-626.946) * (-628.075) [-631.887] (-625.797) (-625.677) -- 0:00:54
129000 -- (-629.768) [-627.857] (-626.799) (-627.145) * (-626.594) [-628.243] (-627.178) (-625.237) -- 0:00:54
129500 -- (-627.377) [-628.354] (-631.527) (-626.726) * (-627.109) (-627.703) [-626.726] (-626.189) -- 0:00:53
130000 -- (-627.992) (-629.265) [-626.698] (-629.487) * (-625.933) [-628.643] (-628.185) (-626.245) -- 0:00:53
Average standard deviation of split frequencies: 0.016595
130500 -- [-626.392] (-628.891) (-625.046) (-632.414) * (-625.193) (-629.965) (-630.512) [-627.391] -- 0:00:53
131000 -- (-628.555) (-626.611) (-625.089) [-628.239] * (-625.206) (-629.999) [-627.841] (-626.064) -- 0:00:53
131500 -- (-626.887) (-628.270) [-627.264] (-625.073) * (-625.154) [-626.487] (-627.080) (-627.058) -- 0:00:52
132000 -- [-625.004] (-630.891) (-626.004) (-624.979) * (-626.377) [-627.344] (-627.991) (-630.174) -- 0:00:52
132500 -- (-625.962) (-627.930) (-626.912) [-626.349] * (-625.684) (-627.428) (-629.753) [-627.134] -- 0:00:52
133000 -- (-627.969) [-625.215] (-626.426) (-625.855) * [-625.874] (-627.388) (-624.990) (-631.517) -- 0:00:52
133500 -- (-625.617) (-626.648) [-626.263] (-624.971) * (-632.756) [-625.966] (-625.757) (-627.513) -- 0:00:51
134000 -- (-625.333) [-625.759] (-629.916) (-634.351) * (-626.720) [-625.377] (-626.727) (-630.105) -- 0:00:58
134500 -- (-627.521) (-625.384) [-628.137] (-627.683) * (-627.969) [-625.576] (-627.483) (-628.305) -- 0:00:57
135000 -- (-625.954) (-630.387) [-625.608] (-626.915) * (-625.191) [-629.207] (-627.358) (-628.569) -- 0:00:57
Average standard deviation of split frequencies: 0.017851
135500 -- (-627.972) (-628.098) (-631.707) [-626.360] * [-625.206] (-629.082) (-626.142) (-625.906) -- 0:00:57
136000 -- (-629.580) (-629.250) (-627.426) [-627.972] * [-630.880] (-626.967) (-629.246) (-625.418) -- 0:00:57
136500 -- (-627.901) (-627.145) (-628.062) [-629.105] * (-627.500) (-626.651) [-625.320] (-627.378) -- 0:00:56
137000 -- (-627.519) [-626.753] (-626.912) (-627.705) * (-626.676) [-625.642] (-626.308) (-629.886) -- 0:00:56
137500 -- [-628.631] (-626.734) (-630.991) (-627.595) * (-627.126) (-625.430) (-624.821) [-628.619] -- 0:00:56
138000 -- (-625.422) (-626.960) [-626.271] (-625.982) * (-632.717) (-627.886) (-624.663) [-625.979] -- 0:00:56
138500 -- (-625.992) (-626.722) (-625.858) [-626.442] * (-630.187) (-627.790) [-626.276] (-627.253) -- 0:00:55
139000 -- [-628.404] (-626.755) (-625.137) (-631.683) * [-626.772] (-626.832) (-628.080) (-626.488) -- 0:00:55
139500 -- (-626.332) [-629.136] (-626.361) (-628.734) * (-629.437) (-627.269) (-626.118) [-625.737] -- 0:00:55
140000 -- (-625.165) (-627.546) [-627.546] (-628.631) * [-626.200] (-625.723) (-630.835) (-625.736) -- 0:00:55
Average standard deviation of split frequencies: 0.015453
140500 -- (-629.811) [-625.226] (-627.357) (-626.068) * (-628.116) (-627.561) [-626.294] (-626.877) -- 0:00:55
141000 -- (-625.175) (-626.934) [-625.166] (-625.456) * (-625.586) (-627.859) [-624.903] (-627.108) -- 0:00:54
141500 -- [-625.102] (-630.086) (-630.620) (-625.759) * (-625.354) (-625.782) [-626.425] (-625.781) -- 0:00:54
142000 -- [-626.630] (-628.399) (-627.083) (-625.570) * (-628.220) (-625.119) [-629.281] (-626.622) -- 0:00:54
142500 -- (-629.521) (-629.168) [-627.749] (-626.859) * (-626.533) (-625.226) (-629.718) [-626.345] -- 0:00:54
143000 -- (-626.715) (-625.747) [-626.732] (-626.688) * (-625.726) (-629.326) [-626.719] (-629.179) -- 0:00:53
143500 -- (-626.285) (-624.970) (-631.269) [-627.266] * (-625.735) (-626.274) (-630.478) [-627.691] -- 0:00:53
144000 -- (-625.999) [-630.786] (-625.958) (-628.697) * (-625.410) [-627.394] (-629.887) (-628.528) -- 0:00:53
144500 -- (-626.126) [-625.743] (-627.914) (-629.911) * (-625.369) (-629.614) (-631.403) [-630.352] -- 0:00:53
145000 -- [-625.330] (-626.794) (-627.559) (-628.346) * [-629.007] (-627.929) (-628.174) (-628.859) -- 0:00:53
Average standard deviation of split frequencies: 0.016484
145500 -- [-626.363] (-629.363) (-627.884) (-626.604) * (-628.275) (-626.788) (-626.455) [-627.723] -- 0:00:52
146000 -- [-626.978] (-632.082) (-632.435) (-627.735) * (-628.694) (-630.167) [-626.551] (-625.696) -- 0:00:52
146500 -- (-630.175) [-627.351] (-629.698) (-627.087) * (-630.612) (-627.590) (-628.557) [-626.434] -- 0:00:52
147000 -- [-625.792] (-627.165) (-630.527) (-627.145) * (-627.442) (-627.003) [-627.936] (-625.561) -- 0:00:52
147500 -- [-629.395] (-627.898) (-626.431) (-629.014) * (-627.852) (-627.852) (-627.733) [-632.030] -- 0:00:52
148000 -- (-627.027) (-628.912) (-625.707) [-628.448] * (-627.198) (-627.076) (-628.340) [-627.539] -- 0:00:51
148500 -- (-628.796) (-626.122) [-626.775] (-626.382) * (-630.405) [-626.323] (-627.503) (-624.989) -- 0:00:51
149000 -- (-625.937) (-629.429) (-626.254) [-627.468] * [-628.082] (-626.773) (-630.087) (-626.543) -- 0:00:51
149500 -- [-625.234] (-627.195) (-628.945) (-628.670) * (-629.702) [-626.840] (-626.652) (-627.890) -- 0:00:51
150000 -- [-625.759] (-625.402) (-626.343) (-627.765) * (-629.086) [-626.463] (-626.487) (-625.288) -- 0:00:51
Average standard deviation of split frequencies: 0.015644
150500 -- [-627.225] (-628.760) (-627.684) (-625.683) * [-625.851] (-625.599) (-631.442) (-629.039) -- 0:00:56
151000 -- (-625.073) (-625.397) [-627.209] (-630.857) * (-627.845) (-631.560) [-627.472] (-626.842) -- 0:00:56
151500 -- (-629.559) [-626.390] (-627.265) (-628.522) * (-627.123) [-627.718] (-624.729) (-626.186) -- 0:00:56
152000 -- (-628.027) [-626.839] (-627.148) (-627.711) * [-627.571] (-631.904) (-625.646) (-625.937) -- 0:00:55
152500 -- (-628.694) (-626.167) [-628.678] (-629.557) * [-626.758] (-627.697) (-626.138) (-626.866) -- 0:00:55
153000 -- (-630.462) (-626.164) [-627.580] (-626.613) * (-627.561) (-629.255) [-626.969] (-629.635) -- 0:00:55
153500 -- [-634.507] (-627.535) (-628.336) (-627.007) * [-625.995] (-630.747) (-627.985) (-628.199) -- 0:00:55
154000 -- (-627.884) (-625.519) [-626.862] (-627.204) * (-625.779) (-627.428) [-629.898] (-626.889) -- 0:00:54
154500 -- (-627.187) (-627.207) [-625.565] (-628.045) * [-628.092] (-627.315) (-627.820) (-627.372) -- 0:00:54
155000 -- (-626.919) [-627.274] (-627.389) (-628.828) * [-628.648] (-627.026) (-625.410) (-626.684) -- 0:00:54
Average standard deviation of split frequencies: 0.016381
155500 -- (-626.116) [-625.856] (-627.230) (-626.099) * (-628.339) (-626.846) (-627.736) [-626.581] -- 0:00:54
156000 -- (-626.211) [-629.101] (-626.930) (-625.764) * [-626.040] (-628.278) (-625.792) (-625.674) -- 0:00:54
156500 -- (-625.794) [-627.725] (-625.939) (-628.410) * (-626.794) (-626.183) [-625.231] (-629.165) -- 0:00:53
157000 -- (-624.928) (-628.229) (-629.529) [-627.458] * (-628.175) (-626.957) (-625.841) [-625.798] -- 0:00:53
157500 -- (-624.589) (-628.367) [-627.022] (-628.162) * [-630.108] (-627.556) (-625.834) (-625.752) -- 0:00:53
158000 -- (-627.408) (-628.161) [-626.059] (-626.002) * (-625.508) (-626.948) [-628.182] (-625.722) -- 0:00:53
158500 -- [-627.456] (-627.908) (-626.288) (-625.814) * [-627.922] (-625.811) (-627.268) (-626.199) -- 0:00:53
159000 -- (-627.379) (-626.881) [-628.476] (-628.095) * (-625.815) [-627.397] (-629.077) (-628.934) -- 0:00:52
159500 -- (-628.803) [-625.869] (-632.463) (-626.621) * [-625.934] (-626.763) (-632.731) (-632.773) -- 0:00:52
160000 -- [-625.630] (-626.562) (-631.939) (-626.160) * [-625.307] (-628.267) (-624.922) (-628.034) -- 0:00:52
Average standard deviation of split frequencies: 0.016626
160500 -- (-625.656) [-625.224] (-627.265) (-627.383) * (-624.772) [-625.699] (-629.190) (-628.675) -- 0:00:52
161000 -- (-625.744) (-628.630) (-627.643) [-627.530] * (-625.932) [-625.124] (-626.940) (-625.896) -- 0:00:52
161500 -- (-626.967) [-629.626] (-626.870) (-626.032) * (-625.933) (-628.659) (-625.899) [-625.710] -- 0:00:51
162000 -- (-626.698) [-624.854] (-626.695) (-628.764) * [-625.987] (-630.769) (-625.039) (-631.428) -- 0:00:51
162500 -- (-632.386) (-626.478) [-626.830] (-627.366) * [-626.125] (-626.863) (-625.636) (-628.277) -- 0:00:51
163000 -- (-628.683) (-628.122) (-626.426) [-626.158] * [-625.954] (-625.419) (-625.077) (-627.126) -- 0:00:51
163500 -- [-625.549] (-633.413) (-631.848) (-626.959) * (-627.171) (-625.983) [-627.094] (-626.827) -- 0:00:51
164000 -- [-627.077] (-628.159) (-627.089) (-627.161) * (-629.773) (-630.480) [-625.777] (-626.537) -- 0:00:50
164500 -- [-627.234] (-625.509) (-627.532) (-629.112) * (-627.565) [-628.656] (-626.426) (-628.101) -- 0:00:50
165000 -- (-627.355) [-626.005] (-628.492) (-627.592) * (-626.457) [-626.676] (-627.382) (-627.193) -- 0:00:50
Average standard deviation of split frequencies: 0.017637
165500 -- (-627.342) (-629.718) (-628.316) [-626.310] * [-626.232] (-624.808) (-626.990) (-626.642) -- 0:00:50
166000 -- (-626.597) (-628.315) (-627.424) [-631.769] * (-628.535) (-626.532) (-626.234) [-626.097] -- 0:00:50
166500 -- [-626.721] (-628.137) (-630.217) (-627.104) * [-631.026] (-625.191) (-626.822) (-626.359) -- 0:00:55
167000 -- [-627.580] (-626.368) (-626.951) (-627.870) * (-629.154) [-626.303] (-628.773) (-628.561) -- 0:00:54
167500 -- (-627.402) (-626.159) [-627.063] (-628.512) * [-626.914] (-624.824) (-625.406) (-630.877) -- 0:00:54
168000 -- (-625.242) (-625.078) (-632.445) [-625.206] * (-628.133) (-632.551) [-625.923] (-630.754) -- 0:00:54
168500 -- (-633.295) (-627.315) [-630.007] (-625.582) * (-629.178) (-630.809) (-629.698) [-627.647] -- 0:00:54
169000 -- (-631.047) (-628.714) (-631.169) [-626.646] * (-625.850) [-627.880] (-629.116) (-627.936) -- 0:00:54
169500 -- (-636.741) (-628.118) [-629.450] (-626.909) * [-624.751] (-628.103) (-625.694) (-625.724) -- 0:00:53
170000 -- (-627.969) (-632.955) (-625.894) [-627.128] * [-626.315] (-628.494) (-626.526) (-625.486) -- 0:00:53
Average standard deviation of split frequencies: 0.015499
170500 -- (-628.445) (-626.708) [-626.006] (-627.495) * [-626.359] (-634.118) (-625.158) (-626.782) -- 0:00:53
171000 -- [-627.584] (-628.866) (-626.929) (-629.064) * (-626.585) (-629.008) (-624.964) [-626.693] -- 0:00:53
171500 -- [-627.501] (-628.486) (-625.436) (-631.353) * (-625.869) [-627.888] (-625.333) (-627.249) -- 0:00:53
172000 -- (-628.786) (-628.157) [-629.364] (-626.266) * [-625.987] (-626.794) (-625.049) (-626.039) -- 0:00:52
172500 -- (-625.838) (-632.583) [-630.381] (-626.534) * (-625.735) (-626.151) [-628.280] (-631.434) -- 0:00:52
173000 -- [-628.174] (-631.139) (-627.457) (-629.008) * [-626.019] (-628.707) (-625.697) (-628.487) -- 0:00:52
173500 -- (-629.003) (-632.648) [-627.793] (-627.898) * (-625.786) (-630.580) [-628.943] (-626.174) -- 0:00:52
174000 -- (-626.590) (-627.862) (-628.325) [-624.752] * (-628.485) (-628.848) [-630.750] (-626.864) -- 0:00:52
174500 -- (-626.747) (-630.029) (-629.680) [-627.210] * (-624.874) (-628.812) (-631.047) [-627.300] -- 0:00:52
175000 -- (-625.870) [-627.601] (-627.951) (-626.470) * (-631.129) (-627.239) [-628.703] (-625.144) -- 0:00:51
Average standard deviation of split frequencies: 0.016071
175500 -- (-627.911) [-626.151] (-625.976) (-625.404) * (-632.612) [-626.751] (-627.110) (-625.307) -- 0:00:51
176000 -- (-628.101) (-626.000) (-624.869) [-627.243] * (-632.420) (-628.111) (-630.047) [-627.146] -- 0:00:51
176500 -- (-629.569) [-626.293] (-628.428) (-629.522) * (-631.370) (-627.391) (-628.646) [-625.470] -- 0:00:51
177000 -- (-626.463) (-625.883) [-626.054] (-628.992) * (-628.060) (-633.745) [-627.253] (-625.581) -- 0:00:51
177500 -- (-626.623) [-626.310] (-625.736) (-627.617) * (-627.595) [-627.772] (-628.106) (-626.174) -- 0:00:50
178000 -- (-627.776) (-628.885) (-626.245) [-628.717] * (-629.163) (-626.789) (-628.410) [-628.378] -- 0:00:50
178500 -- (-625.416) [-628.122] (-626.443) (-628.271) * (-630.212) (-625.989) [-625.743] (-627.415) -- 0:00:50
179000 -- (-626.244) [-629.971] (-624.929) (-627.298) * (-630.672) (-632.405) [-626.194] (-627.426) -- 0:00:50
179500 -- (-627.789) (-626.814) [-628.149] (-628.348) * (-630.763) (-630.193) (-628.853) [-626.081] -- 0:00:50
180000 -- (-626.831) [-625.292] (-627.021) (-630.487) * (-635.287) (-626.366) [-628.587] (-626.114) -- 0:00:50
Average standard deviation of split frequencies: 0.013046
180500 -- [-627.339] (-627.737) (-633.914) (-627.714) * (-627.518) (-625.244) [-629.396] (-625.860) -- 0:00:49
181000 -- (-627.141) (-632.006) [-627.763] (-627.806) * (-630.954) (-625.002) (-627.533) [-625.148] -- 0:00:49
181500 -- [-624.763] (-631.549) (-626.188) (-624.939) * (-630.253) [-625.723] (-627.873) (-626.058) -- 0:00:49
182000 -- (-624.863) (-625.750) (-628.726) [-625.175] * (-631.879) (-627.204) (-629.058) [-627.155] -- 0:00:49
182500 -- (-633.156) [-629.589] (-627.175) (-627.478) * [-632.190] (-627.299) (-630.324) (-627.655) -- 0:00:49
183000 -- (-630.151) (-628.806) [-626.387] (-626.382) * [-627.945] (-628.671) (-626.403) (-625.922) -- 0:00:53
183500 -- (-628.120) (-626.785) [-624.890] (-625.268) * (-630.451) (-628.409) [-627.494] (-628.785) -- 0:00:53
184000 -- (-627.146) (-627.417) [-625.297] (-625.656) * (-631.919) (-626.392) (-627.092) [-627.979] -- 0:00:53
184500 -- (-627.151) (-627.426) [-626.246] (-626.589) * (-628.649) (-629.298) (-629.991) [-625.979] -- 0:00:53
185000 -- (-625.771) (-628.216) (-625.988) [-625.366] * (-625.331) [-625.886] (-629.829) (-626.270) -- 0:00:52
Average standard deviation of split frequencies: 0.014362
185500 -- (-626.703) (-629.332) [-624.882] (-625.074) * (-627.431) (-625.653) [-632.077] (-629.593) -- 0:00:52
186000 -- [-625.982] (-627.373) (-629.961) (-629.616) * (-626.144) (-627.994) [-626.707] (-629.085) -- 0:00:52
186500 -- [-626.021] (-625.802) (-627.098) (-629.309) * (-626.201) [-628.977] (-626.514) (-628.507) -- 0:00:52
187000 -- (-627.661) (-627.222) [-625.852] (-628.321) * (-625.678) (-625.687) [-630.129] (-627.515) -- 0:00:52
187500 -- [-626.662] (-626.422) (-629.209) (-627.980) * (-628.113) (-630.719) (-627.988) [-625.337] -- 0:00:52
188000 -- (-626.661) [-629.004] (-625.572) (-627.926) * [-627.589] (-633.158) (-626.053) (-627.170) -- 0:00:51
188500 -- [-625.943] (-626.651) (-627.956) (-629.017) * (-628.842) [-626.366] (-625.713) (-628.096) -- 0:00:51
189000 -- (-627.685) [-627.590] (-628.743) (-630.902) * (-627.180) (-627.818) [-627.506] (-626.671) -- 0:00:51
189500 -- (-625.748) (-626.973) (-625.279) [-627.231] * (-626.194) [-629.223] (-626.015) (-627.476) -- 0:00:51
190000 -- (-624.863) [-626.127] (-625.447) (-626.344) * [-626.170] (-626.701) (-628.115) (-625.697) -- 0:00:51
Average standard deviation of split frequencies: 0.016580
190500 -- (-629.285) (-626.275) [-625.164] (-625.049) * [-625.735] (-631.385) (-626.319) (-626.074) -- 0:00:50
191000 -- (-628.906) (-625.776) (-628.736) [-627.114] * [-625.618] (-625.562) (-627.217) (-625.647) -- 0:00:50
191500 -- (-626.421) [-630.419] (-627.827) (-626.396) * (-626.115) (-628.590) [-627.934] (-626.380) -- 0:00:50
192000 -- (-627.260) (-629.823) (-633.539) [-628.467] * [-626.570] (-626.632) (-627.626) (-625.157) -- 0:00:50
192500 -- (-625.764) (-628.130) [-625.191] (-626.271) * (-629.988) (-631.229) (-625.765) [-626.943] -- 0:00:50
193000 -- (-627.755) [-625.419] (-625.999) (-632.928) * (-628.648) [-627.113] (-627.999) (-626.415) -- 0:00:50
193500 -- (-626.828) (-626.419) [-625.379] (-626.701) * (-627.129) (-625.867) (-624.828) [-626.454] -- 0:00:50
194000 -- (-627.231) (-627.137) [-628.392] (-625.311) * (-629.361) [-626.655] (-624.942) (-626.296) -- 0:00:49
194500 -- (-628.121) [-626.549] (-625.434) (-632.259) * (-626.194) (-625.772) [-624.822] (-627.015) -- 0:00:49
195000 -- (-626.701) (-627.701) [-626.584] (-626.658) * (-626.803) (-627.665) (-627.007) [-626.275] -- 0:00:49
Average standard deviation of split frequencies: 0.015704
195500 -- (-628.695) [-629.228] (-626.024) (-631.180) * (-628.123) [-628.727] (-628.939) (-627.445) -- 0:00:49
196000 -- (-628.171) (-628.707) [-626.412] (-628.909) * (-627.884) [-634.859] (-627.236) (-624.912) -- 0:00:49
196500 -- [-627.821] (-625.816) (-626.604) (-625.613) * (-625.459) (-630.178) (-627.080) [-624.912] -- 0:00:49
197000 -- (-627.485) [-626.476] (-625.648) (-626.331) * [-626.031] (-627.473) (-629.814) (-625.991) -- 0:00:48
197500 -- (-625.928) [-626.138] (-625.573) (-626.674) * (-628.338) (-626.263) (-627.059) [-624.781] -- 0:00:48
198000 -- [-626.168] (-629.442) (-626.059) (-625.315) * [-626.909] (-625.287) (-627.149) (-626.091) -- 0:00:48
198500 -- (-626.739) [-628.196] (-625.453) (-625.153) * (-626.355) (-626.277) [-628.200] (-632.703) -- 0:00:48
199000 -- (-627.323) (-625.910) [-627.585] (-625.541) * [-627.227] (-625.642) (-627.505) (-631.368) -- 0:00:48
199500 -- [-625.867] (-628.790) (-627.500) (-625.871) * (-624.757) (-626.504) (-628.606) [-628.936] -- 0:00:52
200000 -- (-625.201) (-626.184) [-625.944] (-625.935) * (-626.454) (-625.695) [-626.385] (-627.231) -- 0:00:51
Average standard deviation of split frequencies: 0.014372
200500 -- (-626.799) (-626.627) (-626.790) [-625.198] * (-628.420) (-627.405) [-625.170] (-627.456) -- 0:00:51
201000 -- (-629.428) (-626.452) (-627.150) [-626.606] * (-627.794) (-632.591) (-625.560) [-628.191] -- 0:00:51
201500 -- (-629.712) [-626.441] (-625.186) (-627.742) * [-626.552] (-626.904) (-630.376) (-626.100) -- 0:00:51
202000 -- (-628.972) (-630.678) (-627.326) [-628.726] * (-626.406) (-625.210) (-627.003) [-627.021] -- 0:00:51
202500 -- (-626.600) [-626.267] (-626.830) (-625.971) * [-625.716] (-626.517) (-626.505) (-629.163) -- 0:00:51
203000 -- (-626.645) (-626.593) (-626.791) [-625.676] * (-625.584) [-628.046] (-626.618) (-625.738) -- 0:00:51
203500 -- (-625.467) (-626.288) [-629.729] (-627.570) * [-626.157] (-625.382) (-627.601) (-626.319) -- 0:00:50
204000 -- (-629.298) [-630.103] (-625.015) (-626.795) * (-626.212) [-625.744] (-625.952) (-627.931) -- 0:00:50
204500 -- (-625.079) (-626.065) (-627.481) [-627.710] * (-629.566) (-625.925) (-628.316) [-630.602] -- 0:00:50
205000 -- (-628.659) (-625.609) [-626.829] (-626.899) * (-630.507) (-627.891) [-627.598] (-626.682) -- 0:00:50
Average standard deviation of split frequencies: 0.015510
205500 -- (-625.562) (-626.954) (-630.332) [-625.648] * (-627.665) (-625.833) [-628.335] (-627.341) -- 0:00:50
206000 -- [-625.694] (-628.625) (-625.119) (-625.232) * (-628.383) [-626.806] (-626.513) (-626.163) -- 0:00:50
206500 -- [-626.939] (-631.627) (-627.992) (-629.789) * (-626.970) (-628.708) (-625.945) [-627.545] -- 0:00:49
207000 -- (-625.409) [-626.804] (-628.910) (-627.400) * [-629.567] (-626.565) (-627.958) (-627.836) -- 0:00:49
207500 -- (-625.686) (-626.697) [-626.881] (-628.944) * (-629.912) (-625.980) [-625.401] (-626.768) -- 0:00:49
208000 -- (-626.283) [-625.261] (-628.203) (-628.668) * [-626.940] (-630.591) (-629.435) (-626.960) -- 0:00:49
208500 -- (-627.295) (-627.502) [-625.712] (-628.158) * (-626.023) (-633.161) [-626.426] (-629.076) -- 0:00:49
209000 -- (-625.801) (-625.796) [-625.190] (-625.878) * (-625.986) (-628.587) [-625.352] (-626.473) -- 0:00:49
209500 -- (-625.729) (-626.283) (-625.421) [-627.166] * (-630.271) (-627.975) (-627.424) [-625.411] -- 0:00:49
210000 -- (-627.059) [-626.732] (-629.297) (-628.272) * [-626.616] (-626.313) (-629.140) (-626.159) -- 0:00:48
Average standard deviation of split frequencies: 0.014794
210500 -- (-627.291) (-626.629) [-628.305] (-635.028) * (-625.849) [-626.520] (-627.645) (-629.082) -- 0:00:48
211000 -- (-626.598) [-627.315] (-626.962) (-631.179) * [-626.749] (-625.877) (-626.089) (-630.317) -- 0:00:48
211500 -- [-625.551] (-626.085) (-627.099) (-631.018) * (-626.825) [-625.256] (-626.202) (-629.738) -- 0:00:48
212000 -- (-626.030) (-627.843) [-628.226] (-629.133) * (-628.522) [-627.572] (-625.657) (-625.456) -- 0:00:48
212500 -- (-627.738) (-629.625) (-625.366) [-625.930] * (-627.115) (-625.611) (-624.709) [-624.762] -- 0:00:48
213000 -- (-628.606) [-627.711] (-625.057) (-625.509) * (-626.374) [-627.365] (-625.199) (-626.533) -- 0:00:48
213500 -- [-627.341] (-627.567) (-624.832) (-624.872) * (-625.431) [-626.258] (-627.591) (-626.232) -- 0:00:47
214000 -- (-626.520) (-625.684) (-627.557) [-626.479] * (-626.963) [-625.037] (-626.008) (-625.578) -- 0:00:47
214500 -- (-625.620) [-629.051] (-626.340) (-626.509) * (-626.246) (-626.842) [-625.656] (-624.936) -- 0:00:47
215000 -- (-626.446) (-627.046) (-628.818) [-627.831] * (-626.604) (-626.695) [-627.066] (-624.929) -- 0:00:47
Average standard deviation of split frequencies: 0.016004
215500 -- (-625.747) [-628.770] (-629.590) (-624.995) * (-625.455) (-626.664) [-625.814] (-625.470) -- 0:00:47
216000 -- (-626.229) (-626.169) (-625.904) [-624.760] * [-626.418] (-625.928) (-627.890) (-625.383) -- 0:00:47
216500 -- (-630.637) (-625.793) [-625.973] (-624.758) * (-626.706) (-627.655) (-628.324) [-627.315] -- 0:00:50
217000 -- (-631.710) [-627.736] (-625.007) (-627.965) * (-627.604) (-627.118) [-626.885] (-627.905) -- 0:00:50
217500 -- (-627.858) (-628.482) (-625.441) [-627.958] * (-627.565) (-628.094) [-629.056] (-627.386) -- 0:00:50
218000 -- (-626.460) (-628.473) (-625.233) [-626.406] * [-627.003] (-628.093) (-628.611) (-627.354) -- 0:00:50
218500 -- (-626.453) (-628.686) [-631.916] (-626.855) * [-625.161] (-627.364) (-626.530) (-629.220) -- 0:00:50
219000 -- [-626.498] (-628.906) (-626.665) (-625.437) * (-625.862) (-625.962) [-626.574] (-625.959) -- 0:00:49
219500 -- (-627.619) [-629.691] (-626.755) (-632.046) * (-625.191) (-627.913) (-624.914) [-625.319] -- 0:00:49
220000 -- (-625.393) (-627.210) [-626.584] (-629.040) * [-626.231] (-630.042) (-629.139) (-627.118) -- 0:00:49
Average standard deviation of split frequencies: 0.013648
220500 -- (-629.342) (-625.951) [-627.376] (-627.926) * (-625.964) (-628.177) (-625.743) [-627.626] -- 0:00:49
221000 -- (-626.471) (-625.763) (-626.001) [-629.125] * (-625.973) (-626.835) (-628.555) [-626.531] -- 0:00:49
221500 -- (-625.418) (-629.311) [-625.999] (-625.563) * (-627.870) (-629.070) (-626.391) [-625.844] -- 0:00:49
222000 -- [-631.240] (-626.823) (-624.667) (-626.432) * (-625.691) [-626.988] (-626.748) (-627.354) -- 0:00:49
222500 -- (-629.364) (-625.443) [-626.221] (-626.939) * (-626.709) (-626.228) [-625.657] (-628.825) -- 0:00:48
223000 -- [-632.857] (-628.402) (-626.629) (-628.715) * (-629.761) (-628.908) (-625.911) [-626.355] -- 0:00:48
223500 -- [-630.446] (-627.589) (-629.056) (-628.125) * (-625.378) (-628.047) (-628.441) [-626.072] -- 0:00:48
224000 -- (-625.339) (-628.080) [-626.735] (-628.744) * (-625.229) (-629.799) (-628.561) [-627.502] -- 0:00:48
224500 -- (-629.398) (-626.297) [-626.821] (-627.283) * [-626.978] (-627.646) (-629.701) (-628.848) -- 0:00:48
225000 -- [-629.603] (-625.877) (-628.432) (-628.139) * (-628.880) (-624.945) (-631.583) [-627.561] -- 0:00:48
Average standard deviation of split frequencies: 0.014717
225500 -- [-626.151] (-627.575) (-633.445) (-627.844) * [-629.417] (-626.193) (-628.299) (-627.176) -- 0:00:48
226000 -- (-625.680) (-627.655) (-627.847) [-629.079] * (-627.042) (-627.427) [-627.396] (-630.976) -- 0:00:47
226500 -- [-624.736] (-632.828) (-628.519) (-628.692) * (-630.556) [-627.843] (-628.873) (-627.624) -- 0:00:47
227000 -- (-626.674) [-628.731] (-626.015) (-629.752) * (-627.252) (-627.911) [-626.899] (-626.949) -- 0:00:47
227500 -- (-626.994) [-632.245] (-626.189) (-626.733) * [-626.239] (-629.355) (-626.079) (-624.792) -- 0:00:47
228000 -- (-630.341) [-627.379] (-627.798) (-626.706) * [-627.069] (-627.316) (-626.098) (-627.198) -- 0:00:47
228500 -- (-630.334) (-629.459) [-627.096] (-627.841) * (-627.979) (-626.307) [-625.880] (-627.391) -- 0:00:47
229000 -- (-626.192) (-628.893) [-626.247] (-627.931) * (-628.418) [-626.870] (-627.907) (-628.909) -- 0:00:47
229500 -- (-625.721) (-627.368) [-625.126] (-628.497) * (-627.373) (-626.890) [-629.269] (-631.018) -- 0:00:47
230000 -- (-626.117) (-626.230) (-629.477) [-625.744] * (-628.659) (-627.296) [-626.543] (-627.591) -- 0:00:46
Average standard deviation of split frequencies: 0.013851
230500 -- (-632.370) (-627.364) (-628.653) [-625.473] * (-629.038) (-626.787) (-627.377) [-625.214] -- 0:00:46
231000 -- (-626.581) [-625.480] (-629.075) (-625.136) * (-628.582) (-628.850) (-626.504) [-625.539] -- 0:00:46
231500 -- (-627.947) (-630.004) (-626.580) [-626.970] * (-627.320) [-630.331] (-628.988) (-626.846) -- 0:00:46
232000 -- [-627.804] (-628.245) (-626.644) (-625.635) * [-626.758] (-628.970) (-628.061) (-627.065) -- 0:00:46
232500 -- (-626.160) [-628.359] (-626.937) (-630.289) * (-626.198) (-626.122) [-625.927] (-628.646) -- 0:00:46
233000 -- [-625.952] (-629.690) (-625.567) (-626.833) * [-625.599] (-625.401) (-629.028) (-626.839) -- 0:00:49
233500 -- [-628.498] (-626.898) (-625.511) (-626.225) * [-627.235] (-625.967) (-629.024) (-627.687) -- 0:00:49
234000 -- (-632.563) [-626.734] (-626.906) (-628.757) * (-625.387) (-626.370) [-627.581] (-632.545) -- 0:00:49
234500 -- (-626.274) [-628.951] (-625.998) (-628.531) * (-625.633) (-625.495) [-631.068] (-627.599) -- 0:00:48
235000 -- (-626.551) [-627.939] (-627.481) (-626.679) * [-625.205] (-625.578) (-625.617) (-628.475) -- 0:00:48
Average standard deviation of split frequencies: 0.013982
235500 -- (-627.949) [-625.497] (-625.497) (-627.779) * (-625.487) (-625.483) [-626.830] (-627.585) -- 0:00:48
236000 -- [-626.470] (-625.275) (-627.225) (-626.703) * (-625.546) [-626.304] (-626.484) (-625.506) -- 0:00:48
236500 -- [-629.009] (-625.166) (-625.514) (-626.442) * (-627.625) (-625.481) [-633.348] (-625.356) -- 0:00:48
237000 -- [-626.264] (-626.388) (-627.246) (-626.939) * (-626.165) [-625.293] (-625.934) (-626.825) -- 0:00:48
237500 -- (-627.352) (-626.412) [-626.528] (-629.652) * (-625.523) (-629.409) (-629.358) [-626.630] -- 0:00:48
238000 -- (-626.394) (-628.756) [-627.104] (-627.854) * (-627.295) (-626.801) [-627.954] (-626.152) -- 0:00:48
238500 -- [-625.317] (-626.807) (-628.609) (-627.464) * (-626.050) (-625.403) [-626.233] (-627.343) -- 0:00:47
239000 -- (-627.855) (-628.708) (-627.723) [-625.033] * (-626.104) (-629.875) (-626.999) [-626.066] -- 0:00:47
239500 -- (-627.793) (-628.512) (-629.668) [-625.524] * (-626.152) (-627.901) [-626.066] (-627.022) -- 0:00:47
240000 -- (-627.891) [-629.420] (-627.452) (-624.649) * [-627.734] (-630.119) (-626.101) (-631.746) -- 0:00:47
Average standard deviation of split frequencies: 0.015235
240500 -- (-629.017) (-625.779) (-629.870) [-624.850] * (-628.234) [-625.354] (-626.503) (-627.098) -- 0:00:47
241000 -- (-629.677) (-625.279) (-627.147) [-626.074] * (-631.000) (-626.875) (-626.741) [-628.264] -- 0:00:47
241500 -- [-627.078] (-625.867) (-626.703) (-627.039) * (-630.795) (-629.280) (-624.728) [-626.413] -- 0:00:47
242000 -- (-624.668) (-625.261) [-625.273] (-625.345) * (-626.948) (-634.434) (-624.906) [-625.237] -- 0:00:46
242500 -- (-628.169) (-626.727) (-625.777) [-625.557] * (-628.113) (-627.303) [-626.201] (-626.487) -- 0:00:46
243000 -- (-631.314) [-626.908] (-626.817) (-628.975) * (-625.426) (-627.172) [-626.520] (-625.230) -- 0:00:46
243500 -- [-628.688] (-628.594) (-626.755) (-624.973) * (-627.988) [-626.862] (-629.062) (-625.566) -- 0:00:46
244000 -- [-626.098] (-626.867) (-626.012) (-628.838) * (-627.764) [-626.821] (-626.818) (-628.150) -- 0:00:46
244500 -- (-626.570) [-626.051] (-629.873) (-626.647) * [-625.587] (-631.499) (-626.978) (-632.425) -- 0:00:46
245000 -- [-626.719] (-624.618) (-626.501) (-628.123) * (-626.489) [-625.834] (-628.905) (-626.269) -- 0:00:46
Average standard deviation of split frequencies: 0.016182
245500 -- [-626.034] (-625.341) (-626.330) (-625.915) * (-626.736) (-626.921) [-626.601] (-628.052) -- 0:00:46
246000 -- (-627.910) (-628.664) [-628.306] (-625.417) * (-628.018) (-628.552) (-625.995) [-625.032] -- 0:00:45
246500 -- (-626.197) [-627.651] (-633.713) (-629.181) * [-627.969] (-625.626) (-626.718) (-638.581) -- 0:00:45
247000 -- [-627.402] (-626.297) (-631.173) (-633.162) * (-627.962) (-625.716) (-625.174) [-626.139] -- 0:00:45
247500 -- (-630.702) (-626.092) (-625.215) [-625.916] * (-628.598) [-625.547] (-625.678) (-625.600) -- 0:00:45
248000 -- (-626.650) [-626.445] (-627.781) (-625.131) * (-628.073) [-628.239] (-626.589) (-627.656) -- 0:00:45
248500 -- (-627.182) (-627.984) (-628.433) [-625.101] * [-626.202] (-629.277) (-627.778) (-630.976) -- 0:00:45
249000 -- (-625.774) (-627.314) (-626.308) [-628.416] * (-627.877) (-628.222) [-625.041] (-630.447) -- 0:00:45
249500 -- [-625.330] (-625.631) (-625.652) (-628.289) * [-628.389] (-626.914) (-624.747) (-625.101) -- 0:00:45
250000 -- [-624.805] (-626.102) (-629.472) (-626.636) * (-626.460) [-628.652] (-625.972) (-625.774) -- 0:00:48
Average standard deviation of split frequencies: 0.016612
250500 -- (-626.126) (-624.956) (-627.527) [-626.770] * (-631.448) (-627.272) (-626.245) [-625.158] -- 0:00:47
251000 -- (-626.953) [-627.091] (-631.901) (-629.184) * (-631.498) (-627.636) [-626.114] (-629.257) -- 0:00:47
251500 -- (-626.883) (-626.236) (-626.598) [-626.926] * (-628.222) (-626.776) [-626.367] (-630.005) -- 0:00:47
252000 -- [-628.231] (-627.036) (-625.798) (-628.263) * (-626.793) (-626.453) [-626.158] (-629.273) -- 0:00:47
252500 -- (-627.294) (-626.812) [-627.876] (-628.730) * [-626.329] (-626.372) (-628.182) (-626.529) -- 0:00:47
253000 -- [-627.515] (-626.659) (-628.365) (-627.555) * (-628.931) (-626.423) (-628.728) [-626.703] -- 0:00:47
253500 -- (-625.057) (-627.474) [-625.140] (-627.823) * [-629.904] (-625.474) (-629.611) (-630.489) -- 0:00:47
254000 -- [-625.294] (-627.228) (-625.996) (-629.784) * [-626.809] (-626.805) (-628.210) (-626.820) -- 0:00:46
254500 -- (-627.648) (-627.411) [-627.480] (-628.237) * (-626.337) (-629.090) (-628.519) [-625.740] -- 0:00:46
255000 -- (-631.123) (-625.169) [-627.422] (-627.039) * (-625.418) [-628.703] (-631.532) (-625.306) -- 0:00:46
Average standard deviation of split frequencies: 0.016031
255500 -- (-628.420) (-625.252) (-629.806) [-626.781] * (-625.197) [-628.260] (-632.019) (-626.785) -- 0:00:46
256000 -- (-630.007) (-625.002) (-626.284) [-626.020] * (-625.898) (-627.361) (-627.271) [-629.069] -- 0:00:46
256500 -- (-630.278) (-628.186) (-627.361) [-626.388] * (-625.460) (-631.322) [-626.645] (-629.804) -- 0:00:46
257000 -- (-629.059) (-628.879) (-625.935) [-625.522] * (-626.885) [-625.246] (-627.222) (-628.252) -- 0:00:46
257500 -- (-626.519) [-625.187] (-628.298) (-627.787) * (-626.669) (-626.453) [-626.986] (-626.514) -- 0:00:46
258000 -- [-626.624] (-626.726) (-627.876) (-627.331) * (-627.769) (-626.644) [-628.581] (-624.678) -- 0:00:46
258500 -- (-627.474) [-625.254] (-632.770) (-626.518) * (-632.458) [-625.636] (-625.874) (-626.608) -- 0:00:45
259000 -- (-625.336) (-627.792) (-632.342) [-625.094] * [-628.228] (-626.522) (-626.243) (-630.156) -- 0:00:45
259500 -- (-628.714) [-627.258] (-629.570) (-626.774) * [-626.260] (-627.583) (-627.770) (-627.468) -- 0:00:45
260000 -- [-624.837] (-626.786) (-628.362) (-625.010) * (-629.411) (-627.455) [-628.098] (-627.459) -- 0:00:45
Average standard deviation of split frequencies: 0.016276
260500 -- (-625.717) [-626.576] (-625.006) (-625.176) * (-627.923) (-625.673) (-627.768) [-626.706] -- 0:00:45
261000 -- (-626.474) (-627.842) [-624.588] (-626.956) * (-624.897) [-625.957] (-627.561) (-626.904) -- 0:00:45
261500 -- (-626.370) [-627.383] (-629.389) (-626.930) * (-627.236) (-625.672) [-626.897] (-633.633) -- 0:00:45
262000 -- (-627.283) (-627.957) (-625.826) [-625.725] * (-625.434) (-628.737) (-628.034) [-633.687] -- 0:00:45
262500 -- (-629.389) (-627.174) (-627.805) [-629.361] * (-627.785) (-626.292) [-627.656] (-628.393) -- 0:00:44
263000 -- (-627.443) (-628.154) [-628.068] (-627.168) * (-629.444) (-625.822) [-625.334] (-627.575) -- 0:00:44
263500 -- [-627.802] (-631.036) (-629.159) (-629.854) * (-626.227) (-629.176) (-627.639) [-627.579] -- 0:00:44
264000 -- (-626.027) (-628.618) [-625.816] (-626.782) * (-629.426) [-625.701] (-626.599) (-625.386) -- 0:00:44
264500 -- [-625.267] (-630.254) (-625.212) (-628.861) * (-632.633) (-627.707) (-626.748) [-627.133] -- 0:00:44
265000 -- (-628.394) (-628.618) (-625.633) [-625.769] * (-625.609) (-627.901) (-632.479) [-625.577] -- 0:00:44
Average standard deviation of split frequencies: 0.016888
265500 -- (-628.457) [-626.577] (-631.540) (-625.643) * (-625.188) [-627.855] (-628.094) (-626.547) -- 0:00:44
266000 -- (-630.692) (-627.737) [-627.045] (-626.455) * (-626.270) (-628.642) [-628.534] (-628.277) -- 0:00:44
266500 -- (-629.179) (-629.646) [-626.033] (-629.482) * (-625.856) [-630.047] (-624.812) (-630.156) -- 0:00:46
267000 -- (-626.264) (-631.917) [-627.478] (-630.115) * (-626.734) (-632.972) [-625.893] (-627.322) -- 0:00:46
267500 -- (-625.330) (-628.325) (-625.850) [-628.789] * (-629.585) (-626.611) [-627.318] (-628.331) -- 0:00:46
268000 -- [-626.263] (-629.993) (-627.304) (-625.019) * [-625.420] (-626.587) (-626.791) (-629.160) -- 0:00:46
268500 -- [-626.304] (-631.793) (-624.776) (-625.745) * [-626.514] (-628.016) (-626.868) (-627.256) -- 0:00:46
269000 -- (-627.261) (-631.122) (-626.789) [-630.049] * (-627.055) (-627.033) [-626.150] (-627.992) -- 0:00:46
269500 -- [-625.491] (-634.586) (-628.319) (-627.648) * (-625.440) (-627.703) [-626.062] (-627.544) -- 0:00:46
270000 -- (-628.452) [-627.135] (-627.624) (-626.946) * (-626.076) (-625.774) [-625.698] (-628.218) -- 0:00:45
Average standard deviation of split frequencies: 0.016392
270500 -- (-628.220) (-627.014) [-627.045] (-627.653) * (-626.083) (-628.009) [-632.667] (-628.028) -- 0:00:45
271000 -- [-626.936] (-633.690) (-626.093) (-626.203) * (-626.630) (-630.346) [-627.969] (-629.638) -- 0:00:45
271500 -- [-626.914] (-632.998) (-627.300) (-625.758) * (-626.314) [-625.666] (-631.037) (-626.299) -- 0:00:45
272000 -- (-626.411) (-629.743) [-627.365] (-628.037) * [-627.156] (-625.634) (-632.336) (-625.284) -- 0:00:45
272500 -- (-626.234) [-627.185] (-625.129) (-626.367) * (-628.530) [-624.884] (-628.269) (-625.646) -- 0:00:45
273000 -- (-625.109) (-635.257) [-626.190] (-627.784) * (-629.002) [-626.274] (-629.142) (-625.228) -- 0:00:45
273500 -- (-626.745) (-629.909) [-625.890] (-627.990) * (-626.759) [-625.348] (-626.016) (-631.473) -- 0:00:45
274000 -- [-626.818] (-629.691) (-626.933) (-631.293) * (-629.866) (-625.562) (-626.671) [-625.605] -- 0:00:45
274500 -- (-627.010) (-625.392) [-626.204] (-630.747) * [-629.541] (-629.353) (-626.423) (-627.514) -- 0:00:44
275000 -- (-627.713) (-626.951) (-627.197) [-630.272] * [-626.377] (-626.754) (-626.074) (-626.056) -- 0:00:44
Average standard deviation of split frequencies: 0.016979
275500 -- (-625.330) (-630.870) (-633.533) [-625.533] * (-625.763) [-625.876] (-626.498) (-627.189) -- 0:00:44
276000 -- (-627.180) (-634.539) [-633.373] (-625.818) * (-625.382) (-627.293) (-630.139) [-625.914] -- 0:00:44
276500 -- [-630.288] (-626.766) (-634.285) (-626.044) * [-627.062] (-627.921) (-626.150) (-625.791) -- 0:00:44
277000 -- (-625.953) [-626.909] (-627.680) (-628.483) * [-629.514] (-628.698) (-625.999) (-625.109) -- 0:00:44
277500 -- [-626.035] (-626.265) (-625.768) (-626.580) * (-626.373) [-629.590] (-625.573) (-627.121) -- 0:00:44
278000 -- (-626.617) (-627.658) [-628.163] (-628.105) * (-625.466) (-626.687) [-627.011] (-625.845) -- 0:00:44
278500 -- (-624.787) [-626.476] (-628.117) (-627.431) * (-627.157) (-626.443) (-628.212) [-631.296] -- 0:00:44
279000 -- (-625.637) (-630.724) (-627.123) [-625.531] * (-628.798) (-625.194) [-626.650] (-625.978) -- 0:00:43
279500 -- (-628.689) (-625.817) (-625.338) [-625.194] * (-628.031) (-626.109) (-627.533) [-625.296] -- 0:00:43
280000 -- (-625.393) (-624.821) (-626.267) [-624.982] * (-626.513) [-627.669] (-630.606) (-626.750) -- 0:00:43
Average standard deviation of split frequencies: 0.016697
280500 -- [-625.269] (-624.703) (-626.928) (-627.107) * (-625.187) (-626.661) (-627.831) [-625.628] -- 0:00:43
281000 -- [-627.422] (-626.161) (-629.373) (-627.111) * (-626.145) (-626.303) (-626.238) [-625.067] -- 0:00:43
281500 -- (-625.775) [-626.393] (-629.430) (-625.375) * (-627.988) (-626.014) [-626.328] (-630.265) -- 0:00:43
282000 -- [-625.356] (-625.504) (-626.898) (-626.383) * (-629.799) (-626.990) (-629.882) [-625.765] -- 0:00:43
282500 -- (-632.986) (-633.450) [-626.588] (-625.730) * [-625.444] (-625.947) (-626.572) (-626.232) -- 0:00:43
283000 -- (-627.130) [-625.037] (-624.912) (-630.889) * (-632.004) (-626.502) (-625.514) [-625.607] -- 0:00:43
283500 -- (-625.939) (-625.423) (-629.728) [-625.816] * [-627.817] (-625.222) (-626.071) (-626.210) -- 0:00:45
284000 -- (-625.738) (-626.612) (-628.433) [-625.692] * (-625.376) [-628.113] (-628.667) (-625.638) -- 0:00:45
284500 -- (-626.087) (-629.900) [-629.808] (-627.883) * (-627.973) [-627.576] (-629.684) (-625.225) -- 0:00:45
285000 -- (-626.602) [-626.195] (-630.700) (-627.974) * (-628.710) (-625.551) [-627.494] (-626.189) -- 0:00:45
Average standard deviation of split frequencies: 0.014926
285500 -- (-630.808) (-627.690) [-630.111] (-628.221) * (-626.575) (-628.405) (-627.475) [-625.913] -- 0:00:45
286000 -- (-626.108) [-629.671] (-627.265) (-628.035) * [-628.811] (-628.369) (-625.669) (-626.586) -- 0:00:44
286500 -- [-625.842] (-627.849) (-627.143) (-626.285) * (-626.338) (-626.548) [-626.382] (-627.115) -- 0:00:44
287000 -- (-625.220) (-625.810) [-626.802] (-627.762) * (-631.823) (-625.833) [-625.626] (-628.302) -- 0:00:44
287500 -- [-628.723] (-625.021) (-625.917) (-628.818) * (-626.824) [-625.688] (-624.881) (-628.747) -- 0:00:44
288000 -- (-628.443) (-625.836) [-626.348] (-629.267) * [-624.789] (-627.365) (-632.197) (-628.604) -- 0:00:44
288500 -- (-625.634) (-626.045) [-625.260] (-629.288) * (-626.662) (-625.318) [-625.401] (-630.108) -- 0:00:44
289000 -- (-627.702) [-625.380] (-633.794) (-630.916) * (-630.247) [-627.064] (-628.680) (-627.631) -- 0:00:44
289500 -- (-625.969) [-626.057] (-627.364) (-629.247) * (-627.150) (-627.377) [-625.724] (-626.020) -- 0:00:44
290000 -- (-628.944) (-626.177) [-624.780] (-629.586) * (-627.876) [-631.319] (-625.572) (-625.479) -- 0:00:44
Average standard deviation of split frequencies: 0.016826
290500 -- [-629.913] (-625.413) (-626.344) (-628.234) * (-629.416) (-630.037) [-627.417] (-626.013) -- 0:00:43
291000 -- (-626.915) [-626.031] (-627.970) (-626.864) * (-627.251) (-625.943) [-627.951] (-626.517) -- 0:00:43
291500 -- (-625.310) (-630.294) [-629.020] (-626.528) * (-626.288) (-627.508) [-626.994] (-631.052) -- 0:00:43
292000 -- (-625.334) (-630.292) (-630.255) [-626.048] * [-626.601] (-626.792) (-630.200) (-631.095) -- 0:00:43
292500 -- (-628.057) (-628.212) [-629.260] (-628.996) * [-632.643] (-627.017) (-626.662) (-628.789) -- 0:00:43
293000 -- (-628.687) [-626.256] (-626.987) (-625.763) * (-629.315) (-627.104) (-627.714) [-626.653] -- 0:00:43
293500 -- (-626.471) (-627.232) (-625.741) [-629.326] * (-626.503) (-626.035) (-626.458) [-625.712] -- 0:00:43
294000 -- [-625.138] (-627.670) (-627.790) (-626.105) * [-628.662] (-625.640) (-626.600) (-624.835) -- 0:00:43
294500 -- (-626.113) [-627.264] (-626.916) (-625.378) * (-627.085) (-625.485) (-627.006) [-625.922] -- 0:00:43
295000 -- (-626.360) [-626.531] (-627.716) (-625.727) * (-626.517) (-629.421) [-630.600] (-627.548) -- 0:00:43
Average standard deviation of split frequencies: 0.017120
295500 -- [-627.722] (-626.048) (-629.500) (-627.163) * [-626.526] (-630.546) (-627.797) (-627.789) -- 0:00:42
296000 -- (-626.824) (-627.243) (-628.355) [-626.391] * (-626.298) (-631.414) (-626.641) [-626.635] -- 0:00:42
296500 -- (-627.249) (-627.095) (-632.522) [-627.533] * [-629.966] (-626.499) (-630.810) (-627.433) -- 0:00:42
297000 -- [-626.681] (-627.022) (-627.961) (-625.778) * (-627.236) [-624.929] (-626.872) (-625.627) -- 0:00:42
297500 -- [-625.968] (-626.195) (-626.029) (-628.071) * (-627.463) [-628.722] (-630.013) (-628.886) -- 0:00:42
298000 -- (-626.845) (-628.240) [-627.996] (-631.529) * (-626.626) (-628.558) (-627.837) [-629.431] -- 0:00:42
298500 -- (-625.078) (-631.034) (-625.191) [-626.721] * (-628.624) [-626.079] (-630.309) (-626.818) -- 0:00:42
299000 -- [-629.245] (-626.388) (-625.718) (-626.733) * (-631.050) (-631.171) [-628.145] (-626.604) -- 0:00:42
299500 -- (-626.878) (-629.318) (-629.544) [-626.206] * (-625.564) [-626.080] (-628.646) (-625.894) -- 0:00:42
300000 -- [-625.331] (-626.067) (-628.015) (-627.828) * (-625.798) (-625.651) [-627.061] (-628.493) -- 0:00:44
Average standard deviation of split frequencies: 0.016463
300500 -- (-626.647) (-629.054) (-626.571) [-628.935] * (-627.743) (-627.416) [-626.915] (-627.302) -- 0:00:44
301000 -- (-628.558) [-626.916] (-627.061) (-627.278) * (-626.371) [-627.946] (-628.042) (-626.098) -- 0:00:44
301500 -- (-627.535) (-627.969) (-627.203) [-629.638] * (-625.249) (-626.822) (-626.433) [-631.090] -- 0:00:44
302000 -- (-626.551) (-625.203) (-626.439) [-626.912] * [-625.252] (-627.309) (-626.079) (-629.037) -- 0:00:43
302500 -- (-628.197) (-626.153) (-630.133) [-631.056] * (-625.940) [-627.589] (-625.489) (-627.503) -- 0:00:43
303000 -- (-627.894) [-626.692] (-628.261) (-626.515) * (-625.763) (-626.183) (-625.807) [-632.935] -- 0:00:43
303500 -- (-626.565) [-626.223] (-625.926) (-628.495) * (-628.911) (-629.074) [-626.675] (-626.052) -- 0:00:43
304000 -- (-625.843) (-627.231) [-628.655] (-626.808) * (-628.054) (-627.282) [-628.616] (-628.133) -- 0:00:43
304500 -- [-625.699] (-626.963) (-631.522) (-625.057) * (-628.138) (-627.347) [-625.010] (-628.571) -- 0:00:43
305000 -- [-627.083] (-632.211) (-626.251) (-627.919) * (-629.258) [-626.361] (-629.600) (-627.129) -- 0:00:43
Average standard deviation of split frequencies: 0.015598
305500 -- [-627.040] (-624.593) (-625.776) (-627.094) * (-629.191) [-627.192] (-628.593) (-625.845) -- 0:00:43
306000 -- (-626.980) (-626.745) [-626.032] (-625.654) * (-634.282) (-630.182) (-626.169) [-628.668] -- 0:00:43
306500 -- (-631.620) [-629.277] (-627.589) (-626.594) * [-631.439] (-629.313) (-625.503) (-635.424) -- 0:00:42
307000 -- [-629.647] (-627.544) (-628.645) (-626.522) * (-630.983) (-632.484) [-625.613] (-627.672) -- 0:00:42
307500 -- (-628.357) [-626.024] (-630.632) (-625.622) * (-630.539) (-629.173) (-626.620) [-627.160] -- 0:00:42
308000 -- (-625.985) [-627.185] (-627.083) (-626.122) * [-627.558] (-628.116) (-626.397) (-625.965) -- 0:00:42
308500 -- [-626.160] (-627.499) (-625.547) (-627.508) * (-629.329) [-626.965] (-626.516) (-627.173) -- 0:00:42
309000 -- (-627.042) (-627.710) (-625.111) [-627.047] * (-629.330) [-626.461] (-629.723) (-625.723) -- 0:00:42
309500 -- [-627.546] (-627.863) (-626.041) (-626.434) * (-626.253) (-630.065) (-626.177) [-628.502] -- 0:00:42
310000 -- (-628.316) (-625.637) (-626.629) [-624.946] * (-630.142) (-627.638) [-625.497] (-629.217) -- 0:00:42
Average standard deviation of split frequencies: 0.015458
310500 -- (-625.711) (-634.303) (-625.981) [-625.561] * (-627.135) (-626.328) (-626.056) [-626.796] -- 0:00:42
311000 -- (-629.887) (-628.072) (-629.426) [-629.326] * [-627.980] (-631.070) (-625.717) (-626.794) -- 0:00:42
311500 -- (-625.788) (-627.397) (-626.668) [-625.934] * (-625.876) (-625.881) [-628.452] (-627.049) -- 0:00:41
312000 -- [-628.433] (-628.429) (-625.977) (-625.488) * (-629.865) (-629.036) [-626.601] (-628.165) -- 0:00:41
312500 -- [-627.740] (-626.981) (-626.774) (-626.271) * (-626.715) (-626.643) [-625.015] (-625.846) -- 0:00:41
313000 -- (-627.830) (-628.473) (-627.727) [-629.320] * [-626.418] (-628.149) (-627.304) (-625.789) -- 0:00:41
313500 -- (-627.015) (-627.936) [-627.945] (-627.840) * (-626.116) (-631.539) (-628.214) [-625.704] -- 0:00:41
314000 -- (-629.840) (-625.156) [-626.910] (-630.162) * (-631.669) (-625.886) [-626.031] (-625.738) -- 0:00:41
314500 -- (-627.293) (-626.531) [-628.742] (-629.522) * (-632.242) (-629.509) (-627.739) [-628.138] -- 0:00:41
315000 -- (-626.633) (-626.190) [-626.007] (-627.238) * (-631.014) (-628.536) (-629.140) [-627.385] -- 0:00:41
Average standard deviation of split frequencies: 0.014265
315500 -- (-624.874) (-628.890) (-625.487) [-628.634] * [-625.907] (-627.800) (-626.354) (-628.447) -- 0:00:41
316000 -- [-626.049] (-626.776) (-626.336) (-625.996) * (-629.409) (-628.437) [-628.445] (-630.139) -- 0:00:41
316500 -- [-625.692] (-627.250) (-626.726) (-630.266) * [-626.438] (-627.842) (-626.903) (-628.919) -- 0:00:43
317000 -- [-627.196] (-627.018) (-625.868) (-627.550) * (-625.514) (-626.026) [-625.492] (-629.939) -- 0:00:43
317500 -- (-625.496) (-628.203) [-627.969] (-625.876) * [-627.569] (-626.125) (-626.037) (-626.801) -- 0:00:42
318000 -- (-626.335) (-631.265) [-626.529] (-626.211) * [-626.509] (-629.243) (-628.134) (-626.937) -- 0:00:42
318500 -- (-625.671) (-632.878) [-625.772] (-631.298) * [-625.559] (-632.901) (-626.080) (-628.334) -- 0:00:42
319000 -- (-626.913) [-629.993] (-625.490) (-627.985) * (-629.004) (-632.651) [-628.870] (-628.210) -- 0:00:42
319500 -- (-630.536) (-626.078) [-629.630] (-626.997) * (-626.976) [-627.600] (-627.434) (-626.183) -- 0:00:42
320000 -- [-632.796] (-625.618) (-629.869) (-630.227) * (-627.303) [-627.694] (-628.697) (-627.272) -- 0:00:42
Average standard deviation of split frequencies: 0.014241
320500 -- (-628.110) (-624.973) [-627.638] (-626.377) * (-627.244) (-628.384) [-629.031] (-625.451) -- 0:00:42
321000 -- (-625.727) (-630.599) [-625.806] (-629.371) * (-627.176) [-626.437] (-627.611) (-627.619) -- 0:00:42
321500 -- (-625.943) [-627.231] (-630.780) (-627.322) * (-626.856) (-626.272) (-627.286) [-626.103] -- 0:00:42
322000 -- [-625.345] (-627.398) (-627.860) (-627.861) * [-627.322] (-627.388) (-628.534) (-625.491) -- 0:00:42
322500 -- (-627.679) (-627.298) [-628.467] (-627.217) * [-627.584] (-628.020) (-629.886) (-625.515) -- 0:00:42
323000 -- (-626.610) (-625.544) [-628.831] (-628.421) * (-627.670) [-625.898] (-629.956) (-630.694) -- 0:00:41
323500 -- (-626.334) [-626.676] (-627.806) (-626.395) * (-626.345) (-628.088) (-626.732) [-626.088] -- 0:00:41
324000 -- [-626.378] (-626.106) (-629.814) (-626.257) * (-626.545) (-628.673) [-625.502] (-625.530) -- 0:00:41
324500 -- (-628.167) (-624.775) (-626.998) [-625.920] * (-625.601) (-632.413) [-628.148] (-625.514) -- 0:00:41
325000 -- (-629.696) (-629.712) (-625.850) [-626.184] * (-625.795) (-630.911) (-630.670) [-630.124] -- 0:00:41
Average standard deviation of split frequencies: 0.013737
325500 -- (-627.033) [-628.757] (-626.594) (-632.222) * (-626.785) (-626.062) (-631.709) [-628.202] -- 0:00:41
326000 -- (-629.092) (-626.965) (-627.115) [-626.237] * (-627.088) (-630.520) [-626.680] (-626.396) -- 0:00:41
326500 -- (-629.656) [-628.907] (-629.928) (-628.369) * (-626.278) (-626.953) [-627.168] (-630.847) -- 0:00:41
327000 -- (-625.205) [-627.079] (-627.177) (-629.014) * [-625.965] (-625.307) (-626.894) (-630.248) -- 0:00:41
327500 -- (-625.114) (-628.625) (-628.805) [-624.945] * [-625.503] (-629.801) (-625.797) (-626.679) -- 0:00:41
328000 -- (-625.099) (-625.248) (-629.671) [-627.299] * (-629.566) (-626.244) [-626.475] (-626.259) -- 0:00:40
328500 -- (-627.236) (-628.958) (-625.202) [-626.212] * (-629.285) (-629.083) [-624.978] (-628.942) -- 0:00:40
329000 -- (-628.330) [-626.884] (-624.690) (-628.424) * (-625.776) [-627.172] (-626.444) (-629.975) -- 0:00:40
329500 -- [-625.254] (-626.703) (-627.174) (-631.136) * [-625.970] (-626.610) (-625.612) (-628.394) -- 0:00:40
330000 -- [-625.665] (-633.577) (-627.479) (-625.573) * (-631.927) (-625.854) [-628.702] (-628.591) -- 0:00:40
Average standard deviation of split frequencies: 0.013989
330500 -- (-626.770) (-626.698) (-625.518) [-627.275] * (-631.661) (-625.889) [-626.408] (-625.157) -- 0:00:40
331000 -- [-626.784] (-627.205) (-627.776) (-626.346) * (-628.002) (-626.726) [-625.947] (-624.910) -- 0:00:40
331500 -- (-629.313) [-627.738] (-625.765) (-625.703) * (-627.024) (-626.615) [-625.969] (-626.367) -- 0:00:40
332000 -- [-626.403] (-625.800) (-627.620) (-626.923) * (-627.773) (-627.364) [-625.535] (-629.158) -- 0:00:40
332500 -- (-630.031) (-625.033) (-625.843) [-625.521] * (-627.269) (-627.713) [-625.172] (-628.913) -- 0:00:40
333000 -- [-629.972] (-626.414) (-625.930) (-625.186) * [-627.028] (-626.324) (-628.055) (-629.028) -- 0:00:40
333500 -- (-626.589) (-626.569) [-627.905] (-629.321) * (-626.702) (-626.237) [-628.286] (-627.012) -- 0:00:41
334000 -- (-625.098) [-625.610] (-627.713) (-628.036) * (-626.949) (-629.923) [-626.335] (-628.103) -- 0:00:41
334500 -- [-626.595] (-625.045) (-625.959) (-626.580) * (-625.842) (-627.604) [-627.012] (-627.318) -- 0:00:41
335000 -- (-628.336) (-628.729) (-625.478) [-628.343] * (-626.369) (-631.094) [-628.838] (-628.462) -- 0:00:41
Average standard deviation of split frequencies: 0.012978
335500 -- (-629.429) [-626.723] (-625.362) (-626.518) * (-627.142) (-627.889) (-629.680) [-629.343] -- 0:00:41
336000 -- [-629.626] (-624.923) (-627.167) (-631.957) * (-628.722) (-627.119) [-628.480] (-625.831) -- 0:00:41
336500 -- (-628.182) [-625.384] (-626.281) (-628.656) * (-625.418) (-626.687) (-625.595) [-627.629] -- 0:00:41
337000 -- (-627.823) (-624.648) (-626.933) [-629.685] * (-624.873) [-626.776] (-626.821) (-625.629) -- 0:00:41
337500 -- (-625.428) [-625.249] (-626.725) (-630.882) * [-626.207] (-628.535) (-628.823) (-628.400) -- 0:00:41
338000 -- [-628.892] (-626.023) (-626.017) (-627.704) * (-626.167) (-627.950) (-626.687) [-629.010] -- 0:00:41
338500 -- [-627.590] (-626.548) (-625.932) (-627.094) * (-625.894) (-626.040) (-626.411) [-625.440] -- 0:00:41
339000 -- (-626.588) (-628.905) (-625.137) [-626.751] * (-625.046) [-625.688] (-625.577) (-625.439) -- 0:00:40
339500 -- [-624.690] (-628.267) (-626.553) (-634.298) * (-626.925) (-627.772) [-625.622] (-627.746) -- 0:00:40
340000 -- (-625.762) (-628.289) [-628.540] (-627.894) * [-626.750] (-625.873) (-627.256) (-628.223) -- 0:00:40
Average standard deviation of split frequencies: 0.013232
340500 -- [-625.853] (-628.033) (-628.187) (-627.870) * [-627.035] (-624.887) (-629.463) (-629.492) -- 0:00:40
341000 -- (-628.921) [-629.344] (-626.455) (-628.467) * (-627.276) (-625.272) (-629.076) [-627.291] -- 0:00:40
341500 -- (-628.873) [-636.572] (-628.384) (-627.267) * (-626.604) [-626.514] (-625.878) (-629.642) -- 0:00:40
342000 -- (-630.560) [-629.305] (-626.885) (-627.046) * (-629.333) (-625.552) (-626.802) [-625.331] -- 0:00:40
342500 -- (-625.575) (-628.110) [-625.217] (-629.761) * (-626.752) [-628.708] (-625.975) (-625.083) -- 0:00:40
343000 -- (-626.745) (-627.640) (-626.445) [-630.398] * [-628.821] (-629.185) (-628.217) (-625.418) -- 0:00:40
343500 -- [-625.441] (-626.433) (-626.796) (-626.098) * (-632.652) (-625.569) (-626.544) [-629.363] -- 0:00:40
344000 -- (-629.225) (-625.887) (-626.565) [-625.345] * (-626.099) (-625.765) [-625.751] (-625.489) -- 0:00:40
344500 -- (-625.276) (-625.627) (-629.103) [-626.155] * (-625.184) (-628.001) [-625.631] (-625.760) -- 0:00:39
345000 -- (-625.875) (-626.075) (-627.111) [-625.934] * (-625.963) (-627.215) (-627.941) [-625.341] -- 0:00:39
Average standard deviation of split frequencies: 0.013710
345500 -- [-626.163] (-629.411) (-627.789) (-626.012) * (-629.300) (-628.412) (-628.314) [-625.528] -- 0:00:39
346000 -- (-626.271) [-625.250] (-627.195) (-626.471) * (-629.870) (-625.299) [-627.240] (-626.801) -- 0:00:39
346500 -- (-627.990) (-625.052) (-627.789) [-627.839] * (-631.806) [-624.986] (-625.021) (-627.075) -- 0:00:39
347000 -- (-629.097) (-627.169) [-626.173] (-630.659) * (-630.198) (-625.727) (-625.007) [-625.626] -- 0:00:39
347500 -- [-628.199] (-627.157) (-625.272) (-629.366) * (-631.597) (-626.590) [-627.282] (-624.977) -- 0:00:39
348000 -- [-625.684] (-629.963) (-626.370) (-629.194) * (-627.061) [-624.998] (-625.323) (-626.396) -- 0:00:39
348500 -- (-627.486) (-625.763) [-626.881] (-628.380) * [-626.089] (-631.968) (-627.387) (-627.135) -- 0:00:39
349000 -- (-626.963) [-627.312] (-629.777) (-626.827) * (-625.676) [-628.938] (-625.715) (-626.535) -- 0:00:39
349500 -- (-628.589) (-625.926) [-627.731] (-625.824) * (-624.933) [-625.835] (-627.633) (-638.264) -- 0:00:40
350000 -- [-625.453] (-627.134) (-626.340) (-625.871) * [-626.135] (-627.574) (-627.299) (-627.757) -- 0:00:40
Average standard deviation of split frequencies: 0.013359
350500 -- (-629.367) (-626.626) [-626.457] (-627.275) * [-626.628] (-626.396) (-625.632) (-628.849) -- 0:00:40
351000 -- [-628.005] (-627.462) (-627.424) (-628.649) * (-627.492) [-626.413] (-626.076) (-631.574) -- 0:00:40
351500 -- (-626.565) (-630.091) [-626.303] (-627.400) * (-627.514) [-625.783] (-624.667) (-626.628) -- 0:00:40
352000 -- (-626.157) [-625.814] (-628.845) (-625.138) * [-628.139] (-626.581) (-628.373) (-627.543) -- 0:00:40
352500 -- (-629.038) (-626.212) (-626.998) [-628.809] * (-627.296) (-627.115) (-633.067) [-629.736] -- 0:00:40
353000 -- [-626.141] (-625.447) (-625.800) (-632.092) * [-625.425] (-625.389) (-628.609) (-625.482) -- 0:00:40
353500 -- [-625.283] (-626.571) (-625.839) (-628.094) * (-624.963) (-635.525) [-626.535] (-628.096) -- 0:00:40
354000 -- (-625.554) (-627.771) [-627.566] (-628.833) * [-626.092] (-631.797) (-626.048) (-628.727) -- 0:00:40
354500 -- [-626.682] (-626.957) (-625.137) (-629.421) * [-627.263] (-627.564) (-628.701) (-628.019) -- 0:00:40
355000 -- (-629.415) (-627.989) (-627.054) [-625.418] * (-626.477) [-626.836] (-626.535) (-626.879) -- 0:00:39
Average standard deviation of split frequencies: 0.012497
355500 -- (-625.852) (-627.741) (-629.800) [-625.048] * (-627.309) [-627.855] (-626.976) (-627.557) -- 0:00:39
356000 -- (-628.478) [-629.023] (-629.529) (-628.704) * (-625.978) (-627.113) [-627.421] (-626.075) -- 0:00:39
356500 -- (-627.545) [-624.800] (-626.238) (-625.762) * (-626.630) [-626.478] (-632.194) (-626.590) -- 0:00:39
357000 -- (-627.500) [-626.373] (-625.648) (-625.619) * (-626.300) [-625.704] (-629.401) (-628.669) -- 0:00:39
357500 -- [-625.589] (-628.495) (-624.838) (-626.342) * (-628.047) [-626.305] (-626.458) (-626.174) -- 0:00:39
358000 -- [-625.627] (-629.055) (-627.042) (-627.299) * (-628.288) (-626.054) [-625.788] (-626.240) -- 0:00:39
358500 -- (-626.611) (-633.860) [-626.426] (-628.598) * (-628.797) (-625.848) [-626.043] (-626.378) -- 0:00:39
359000 -- (-632.407) (-626.945) (-629.471) [-627.560] * (-628.610) (-626.679) (-626.014) [-625.925] -- 0:00:39
359500 -- (-626.966) (-627.118) [-628.832] (-628.067) * [-627.907] (-627.466) (-625.722) (-625.241) -- 0:00:39
360000 -- [-625.317] (-628.161) (-627.616) (-631.444) * (-626.981) [-627.271] (-625.603) (-625.311) -- 0:00:39
Average standard deviation of split frequencies: 0.011927
360500 -- (-629.469) (-629.412) (-625.973) [-625.975] * (-626.857) (-628.393) (-626.978) [-626.505] -- 0:00:39
361000 -- (-627.073) (-626.789) [-624.956] (-627.553) * (-627.721) (-626.618) [-625.490] (-631.359) -- 0:00:38
361500 -- [-627.593] (-625.808) (-625.082) (-630.334) * (-628.776) (-625.029) [-625.929] (-627.889) -- 0:00:38
362000 -- [-626.312] (-628.424) (-626.204) (-631.464) * (-636.576) [-625.209] (-625.256) (-627.364) -- 0:00:38
362500 -- [-624.998] (-629.118) (-626.189) (-627.032) * (-627.560) [-628.251] (-627.455) (-626.361) -- 0:00:38
363000 -- (-628.777) (-626.512) (-628.271) [-629.631] * [-627.139] (-635.118) (-626.812) (-627.477) -- 0:00:38
363500 -- (-627.395) (-628.296) (-627.286) [-628.348] * (-627.733) (-632.823) (-629.148) [-627.477] -- 0:00:38
364000 -- (-627.804) [-628.420] (-625.991) (-626.325) * (-630.292) [-628.470] (-629.617) (-627.309) -- 0:00:38
364500 -- (-627.607) (-629.932) [-624.962] (-625.379) * (-634.219) (-625.654) (-626.325) [-630.541] -- 0:00:38
365000 -- (-627.954) (-628.532) [-624.870] (-625.913) * (-633.442) (-627.198) (-625.401) [-631.008] -- 0:00:38
Average standard deviation of split frequencies: 0.011672
365500 -- (-629.429) (-625.370) (-625.696) [-626.006] * (-628.892) (-627.056) [-627.158] (-626.793) -- 0:00:39
366000 -- (-627.871) (-630.777) (-626.663) [-628.152] * (-626.497) (-626.100) (-625.577) [-626.789] -- 0:00:39
366500 -- (-629.190) [-628.203] (-630.637) (-626.800) * (-625.453) (-626.741) [-626.880] (-625.635) -- 0:00:39
367000 -- (-630.066) (-627.235) (-629.060) [-625.565] * [-627.510] (-629.117) (-626.920) (-624.811) -- 0:00:39
367500 -- (-630.059) (-628.565) [-631.157] (-632.280) * (-625.583) (-626.408) [-629.524] (-625.395) -- 0:00:39
368000 -- (-626.674) (-628.374) [-627.660] (-633.628) * (-630.131) [-628.194] (-627.501) (-628.144) -- 0:00:39
368500 -- (-627.515) (-627.217) (-629.044) [-627.648] * (-628.530) [-628.118] (-626.087) (-626.168) -- 0:00:39
369000 -- (-627.999) (-625.279) (-625.713) [-628.757] * [-627.825] (-634.193) (-626.922) (-624.757) -- 0:00:39
369500 -- (-630.680) [-627.650] (-634.421) (-627.780) * (-627.164) (-626.170) (-626.871) [-626.775] -- 0:00:39
370000 -- (-626.132) (-628.375) (-635.263) [-625.611] * [-626.927] (-627.837) (-631.737) (-627.005) -- 0:00:39
Average standard deviation of split frequencies: 0.011970
370500 -- (-626.880) (-626.698) [-626.267] (-626.556) * [-627.220] (-628.234) (-626.666) (-625.549) -- 0:00:39
371000 -- (-624.746) (-625.728) (-627.745) [-627.158] * (-626.163) (-627.227) (-626.362) [-626.487] -- 0:00:38
371500 -- (-627.261) (-625.290) (-626.520) [-626.999] * (-627.356) (-624.868) (-627.346) [-626.050] -- 0:00:38
372000 -- (-628.093) (-625.726) (-626.762) [-625.374] * (-629.984) (-627.324) [-626.233] (-626.310) -- 0:00:38
372500 -- (-628.390) (-625.402) [-629.259] (-627.457) * (-627.023) [-625.412] (-626.850) (-626.198) -- 0:00:38
373000 -- [-627.140] (-627.974) (-631.213) (-627.783) * (-624.879) [-625.231] (-629.496) (-624.880) -- 0:00:38
373500 -- (-632.064) [-625.585] (-625.142) (-625.704) * (-625.966) (-626.013) (-637.882) [-624.687] -- 0:00:38
374000 -- (-629.274) [-625.560] (-625.184) (-630.893) * (-629.529) (-628.177) (-628.552) [-625.421] -- 0:00:38
374500 -- (-626.409) (-628.279) [-628.090] (-628.847) * (-628.346) (-626.884) [-628.164] (-626.696) -- 0:00:38
375000 -- [-625.875] (-626.685) (-629.092) (-625.690) * (-625.946) (-629.276) (-630.374) [-627.375] -- 0:00:38
Average standard deviation of split frequencies: 0.012537
375500 -- (-625.357) (-626.732) [-625.375] (-626.227) * (-625.080) (-626.694) [-627.554] (-626.143) -- 0:00:38
376000 -- [-626.217] (-631.310) (-630.862) (-625.570) * (-625.016) [-625.203] (-628.425) (-627.136) -- 0:00:38
376500 -- (-626.688) (-628.004) [-626.406] (-631.394) * (-627.904) (-625.053) (-625.977) [-626.403] -- 0:00:38
377000 -- [-626.404] (-626.932) (-627.440) (-629.525) * (-627.551) (-626.171) [-627.048] (-626.605) -- 0:00:38
377500 -- [-629.377] (-628.785) (-627.209) (-627.153) * [-626.672] (-626.891) (-625.755) (-626.456) -- 0:00:37
378000 -- [-627.948] (-631.357) (-628.149) (-627.031) * [-625.157] (-625.776) (-625.083) (-625.992) -- 0:00:37
378500 -- [-625.729] (-629.174) (-633.386) (-626.308) * (-626.467) [-626.876] (-627.569) (-626.944) -- 0:00:37
379000 -- (-629.180) (-624.925) (-633.470) [-625.694] * (-627.111) [-626.605] (-625.343) (-627.939) -- 0:00:37
379500 -- (-630.962) (-625.814) [-629.038] (-625.669) * [-627.047] (-625.646) (-625.312) (-625.548) -- 0:00:37
380000 -- [-626.742] (-628.789) (-628.452) (-630.919) * [-625.105] (-626.472) (-627.181) (-625.894) -- 0:00:37
Average standard deviation of split frequencies: 0.011510
380500 -- (-625.764) (-632.429) (-627.131) [-625.670] * (-626.624) [-625.853] (-627.339) (-626.258) -- 0:00:37
381000 -- (-627.237) (-627.364) (-630.340) [-629.575] * [-631.301] (-627.631) (-626.098) (-625.893) -- 0:00:37
381500 -- (-629.299) (-625.245) [-626.585] (-627.420) * (-629.208) [-626.386] (-627.942) (-627.176) -- 0:00:37
382000 -- [-627.550] (-625.457) (-629.556) (-627.568) * (-626.822) [-628.168] (-626.495) (-625.663) -- 0:00:37
382500 -- (-625.767) (-630.835) (-634.496) [-626.584] * [-625.391] (-630.663) (-626.574) (-629.300) -- 0:00:38
383000 -- (-626.471) (-627.293) (-626.837) [-626.788] * (-626.514) (-624.882) [-625.584] (-629.097) -- 0:00:38
383500 -- (-626.831) (-629.025) [-627.490] (-627.971) * [-625.900] (-625.256) (-627.657) (-626.210) -- 0:00:38
384000 -- (-627.400) (-628.912) (-627.713) [-626.341] * (-624.974) (-626.215) (-627.668) [-625.116] -- 0:00:38
384500 -- (-627.172) (-630.614) (-626.601) [-625.526] * (-626.637) [-625.846] (-628.222) (-627.467) -- 0:00:38
385000 -- [-625.691] (-629.800) (-626.185) (-626.519) * (-624.565) (-627.354) [-625.540] (-627.578) -- 0:00:38
Average standard deviation of split frequencies: 0.011494
385500 -- [-626.809] (-627.216) (-630.074) (-627.825) * (-625.338) [-627.453] (-627.424) (-628.933) -- 0:00:38
386000 -- (-625.139) [-628.615] (-625.963) (-631.646) * (-625.719) (-626.556) [-631.613] (-626.079) -- 0:00:38
386500 -- [-625.771] (-632.136) (-627.736) (-628.815) * (-628.439) (-626.948) [-628.672] (-630.667) -- 0:00:38
387000 -- (-626.081) [-630.774] (-628.101) (-626.728) * [-626.326] (-625.725) (-627.903) (-627.019) -- 0:00:38
387500 -- (-625.234) (-627.247) [-626.794] (-630.668) * [-625.464] (-627.311) (-631.466) (-626.011) -- 0:00:37
388000 -- [-626.956] (-626.242) (-626.595) (-626.487) * (-626.775) [-626.267] (-631.597) (-630.366) -- 0:00:37
388500 -- (-626.365) [-626.818] (-625.683) (-627.476) * (-629.297) (-627.938) [-624.949] (-628.648) -- 0:00:37
389000 -- (-625.828) (-625.763) (-625.052) [-625.332] * (-627.920) (-626.984) [-624.743] (-631.298) -- 0:00:37
389500 -- (-625.885) (-630.530) (-628.200) [-625.272] * (-625.155) (-626.500) [-625.680] (-632.496) -- 0:00:37
390000 -- (-626.307) [-627.073] (-627.562) (-625.127) * [-626.612] (-628.418) (-625.908) (-629.549) -- 0:00:37
Average standard deviation of split frequencies: 0.010789
390500 -- [-626.627] (-626.662) (-626.201) (-626.836) * (-627.368) (-626.951) (-628.256) [-625.891] -- 0:00:37
391000 -- (-628.580) (-628.328) [-625.435] (-625.744) * (-627.027) (-624.775) [-625.652] (-626.345) -- 0:00:37
391500 -- (-625.375) (-628.542) [-625.471] (-625.830) * [-627.119] (-626.501) (-628.516) (-625.589) -- 0:00:37
392000 -- (-626.230) (-629.099) (-626.884) [-627.377] * (-626.002) (-627.371) (-625.312) [-625.440] -- 0:00:37
392500 -- (-626.928) [-630.034] (-625.510) (-628.354) * (-632.090) [-626.002] (-626.918) (-627.432) -- 0:00:37
393000 -- (-625.495) [-630.118] (-625.814) (-626.654) * (-627.550) [-625.905] (-624.748) (-626.635) -- 0:00:37
393500 -- (-629.546) (-627.732) [-625.570] (-625.725) * (-625.859) (-625.906) [-627.635] (-628.012) -- 0:00:36
394000 -- (-626.906) (-627.133) [-629.963] (-626.872) * [-627.397] (-625.708) (-627.206) (-626.404) -- 0:00:36
394500 -- (-627.895) (-627.657) (-628.345) [-628.803] * [-630.002] (-625.447) (-627.536) (-626.182) -- 0:00:36
395000 -- (-626.780) [-625.977] (-630.048) (-628.518) * (-626.792) (-625.687) (-626.337) [-626.445] -- 0:00:36
Average standard deviation of split frequencies: 0.011554
395500 -- (-626.133) (-631.104) [-627.229] (-626.310) * (-626.593) (-629.572) [-625.470] (-628.471) -- 0:00:36
396000 -- (-626.434) (-626.257) (-629.087) [-626.526] * (-627.310) [-626.393] (-627.082) (-629.930) -- 0:00:36
396500 -- (-626.286) (-625.125) (-626.916) [-626.045] * (-625.648) (-631.512) [-628.947] (-630.174) -- 0:00:36
397000 -- (-625.614) (-626.168) [-624.921] (-629.070) * (-625.553) [-625.741] (-630.338) (-629.110) -- 0:00:36
397500 -- (-625.801) (-627.742) (-627.075) [-625.694] * (-624.678) (-626.212) (-628.009) [-625.134] -- 0:00:36
398000 -- (-626.511) (-626.445) (-626.057) [-628.759] * (-624.667) (-629.359) [-626.802] (-625.727) -- 0:00:36
398500 -- [-626.512] (-627.661) (-626.936) (-627.644) * [-625.805] (-625.820) (-626.167) (-626.014) -- 0:00:36
399000 -- [-627.745] (-630.797) (-625.514) (-628.961) * (-625.829) [-625.594] (-627.621) (-627.193) -- 0:00:36
399500 -- (-629.046) [-627.745] (-630.836) (-628.257) * (-626.109) [-627.439] (-627.144) (-629.034) -- 0:00:37
400000 -- (-627.793) (-626.093) (-627.109) [-624.844] * (-625.792) (-628.599) [-627.178] (-628.965) -- 0:00:37
Average standard deviation of split frequencies: 0.011835
400500 -- (-625.877) (-626.500) [-628.056] (-625.485) * (-630.633) (-627.152) [-625.939] (-629.756) -- 0:00:37
401000 -- (-628.505) (-625.859) (-629.345) [-627.187] * (-629.160) (-630.178) [-626.658] (-627.050) -- 0:00:37
401500 -- [-628.043] (-627.408) (-628.568) (-627.365) * [-626.283] (-627.041) (-626.537) (-625.078) -- 0:00:37
402000 -- (-625.733) (-626.223) (-629.577) [-626.050] * (-626.618) [-628.172] (-630.381) (-625.393) -- 0:00:37
402500 -- (-631.456) [-625.177] (-627.884) (-627.153) * [-626.648] (-627.971) (-631.780) (-626.058) -- 0:00:37
403000 -- (-629.739) (-626.292) [-625.480] (-625.954) * (-628.171) [-630.507] (-631.387) (-627.087) -- 0:00:37
403500 -- (-624.990) [-625.992] (-624.831) (-627.504) * (-626.047) (-626.728) [-629.394] (-625.340) -- 0:00:36
404000 -- (-626.766) [-628.158] (-628.622) (-627.158) * (-627.132) (-629.008) (-625.190) [-625.458] -- 0:00:36
404500 -- (-625.733) (-633.225) [-626.308] (-626.042) * (-628.995) (-625.420) (-629.318) [-625.169] -- 0:00:36
405000 -- (-627.443) (-628.947) [-626.468] (-626.159) * (-631.609) (-630.117) (-630.734) [-626.864] -- 0:00:36
Average standard deviation of split frequencies: 0.012837
405500 -- (-626.907) [-629.350] (-627.352) (-626.833) * [-625.648] (-625.782) (-625.935) (-627.441) -- 0:00:36
406000 -- (-626.291) (-629.217) (-625.428) [-626.238] * (-626.925) (-626.301) (-630.889) [-626.477] -- 0:00:36
406500 -- (-624.863) [-627.364] (-627.630) (-626.997) * (-627.049) (-626.282) [-625.743] (-628.848) -- 0:00:36
407000 -- (-625.569) (-626.800) (-631.203) [-629.054] * [-626.170] (-628.514) (-627.534) (-628.104) -- 0:00:36
407500 -- [-629.603] (-627.751) (-629.971) (-629.545) * (-626.103) [-625.790] (-626.849) (-625.930) -- 0:00:36
408000 -- (-631.192) (-629.421) (-626.403) [-627.449] * (-625.369) (-628.354) [-626.933] (-632.595) -- 0:00:36
408500 -- (-627.574) (-626.050) [-626.144] (-626.420) * (-628.858) (-626.110) (-626.535) [-626.473] -- 0:00:36
409000 -- (-630.875) [-630.697] (-625.484) (-624.865) * (-627.267) (-625.907) (-625.569) [-629.211] -- 0:00:36
409500 -- (-626.577) (-625.874) [-626.674] (-625.391) * (-627.351) (-625.856) [-626.742] (-631.708) -- 0:00:36
410000 -- (-626.822) (-625.708) (-625.458) [-625.349] * (-625.818) (-626.818) (-626.894) [-626.158] -- 0:00:35
Average standard deviation of split frequencies: 0.012372
410500 -- (-627.331) (-625.917) [-627.169] (-624.974) * (-625.019) [-627.950] (-625.894) (-626.913) -- 0:00:35
411000 -- (-626.324) [-631.044] (-625.476) (-627.549) * (-628.399) [-626.084] (-626.752) (-625.490) -- 0:00:35
411500 -- [-628.808] (-627.310) (-625.105) (-627.606) * (-631.792) (-625.836) (-631.011) [-628.991] -- 0:00:35
412000 -- (-628.164) (-628.788) [-627.016] (-627.347) * [-626.414] (-631.369) (-626.281) (-626.988) -- 0:00:35
412500 -- (-626.534) [-627.846] (-625.611) (-627.780) * (-625.200) (-629.393) (-626.007) [-627.061] -- 0:00:35
413000 -- (-628.112) (-629.793) [-628.931] (-627.501) * (-627.692) (-626.213) (-627.280) [-625.971] -- 0:00:35
413500 -- (-626.887) (-628.812) [-626.506] (-626.607) * (-625.110) [-625.253] (-625.399) (-628.578) -- 0:00:35
414000 -- (-625.348) (-626.673) (-628.345) [-626.255] * [-625.836] (-627.180) (-625.869) (-628.468) -- 0:00:35
414500 -- (-627.256) [-625.489] (-628.451) (-625.891) * (-628.824) (-631.304) (-625.804) [-627.731] -- 0:00:35
415000 -- (-625.537) [-630.724] (-630.000) (-627.425) * (-625.562) [-625.864] (-631.420) (-626.693) -- 0:00:35
Average standard deviation of split frequencies: 0.012402
415500 -- (-626.918) (-635.358) [-627.448] (-626.585) * (-625.996) (-627.809) [-628.868] (-626.451) -- 0:00:36
416000 -- (-627.556) (-624.732) (-625.656) [-627.104] * [-628.173] (-629.069) (-629.832) (-625.427) -- 0:00:36
416500 -- (-628.198) (-626.641) [-628.223] (-625.937) * (-630.082) (-629.912) [-627.802] (-628.008) -- 0:00:36
417000 -- (-625.567) [-627.099] (-630.601) (-625.532) * (-627.429) (-627.083) [-626.786] (-631.898) -- 0:00:36
417500 -- (-627.375) (-629.491) [-626.396] (-626.663) * [-625.584] (-627.875) (-628.952) (-627.499) -- 0:00:36
418000 -- (-625.711) (-629.067) [-628.821] (-627.035) * (-628.455) (-631.621) [-628.295] (-625.811) -- 0:00:36
418500 -- [-626.761] (-625.823) (-630.919) (-626.795) * (-639.001) (-627.711) (-628.744) [-626.244] -- 0:00:36
419000 -- (-625.373) [-625.080] (-628.158) (-626.790) * (-630.551) (-626.024) [-626.197] (-625.059) -- 0:00:36
419500 -- (-625.078) [-625.502] (-629.138) (-626.677) * (-625.089) [-625.365] (-627.674) (-629.490) -- 0:00:35
420000 -- (-631.213) (-625.751) [-628.879] (-628.065) * (-624.909) (-630.885) (-626.305) [-625.694] -- 0:00:35
Average standard deviation of split frequencies: 0.011891
420500 -- [-625.886] (-626.553) (-628.305) (-625.818) * [-625.975] (-631.439) (-635.177) (-627.735) -- 0:00:35
421000 -- [-629.079] (-626.164) (-626.218) (-625.770) * [-628.024] (-626.304) (-629.006) (-627.285) -- 0:00:35
421500 -- (-628.238) (-627.177) (-625.607) [-625.811] * (-628.781) [-628.318] (-627.867) (-625.777) -- 0:00:35
422000 -- [-626.186] (-625.391) (-624.896) (-627.440) * (-625.785) [-635.268] (-628.274) (-630.452) -- 0:00:35
422500 -- [-627.401] (-626.769) (-626.503) (-624.945) * (-625.011) [-626.726] (-627.598) (-630.824) -- 0:00:35
423000 -- (-627.727) (-625.115) (-625.949) [-628.409] * [-626.710] (-625.154) (-626.458) (-630.440) -- 0:00:35
423500 -- [-627.008] (-625.047) (-631.176) (-630.563) * (-626.002) [-626.789] (-628.415) (-630.955) -- 0:00:35
424000 -- (-626.290) (-626.890) (-627.124) [-629.465] * (-629.079) [-626.701] (-627.194) (-627.702) -- 0:00:35
424500 -- [-628.509] (-627.111) (-628.233) (-626.816) * (-626.091) (-630.340) (-629.350) [-625.165] -- 0:00:35
425000 -- [-628.792] (-626.775) (-626.698) (-627.903) * [-624.959] (-626.946) (-631.347) (-625.518) -- 0:00:35
Average standard deviation of split frequencies: 0.011004
425500 -- (-627.507) [-625.861] (-626.788) (-626.684) * (-626.569) (-626.168) (-627.326) [-626.290] -- 0:00:35
426000 -- (-626.481) [-626.349] (-626.639) (-626.474) * (-626.144) (-627.381) [-629.256] (-627.892) -- 0:00:35
426500 -- (-629.655) (-627.629) (-630.657) [-626.054] * (-630.909) [-627.465] (-626.793) (-629.479) -- 0:00:34
427000 -- (-627.221) (-627.300) (-628.512) [-625.588] * (-628.111) (-629.748) [-627.307] (-628.830) -- 0:00:34
427500 -- (-627.491) (-629.941) (-630.515) [-626.875] * (-626.913) [-629.483] (-625.217) (-627.527) -- 0:00:34
428000 -- (-626.386) (-627.109) [-628.400] (-626.674) * (-625.917) [-632.753] (-626.038) (-628.508) -- 0:00:34
428500 -- (-627.209) [-625.861] (-626.967) (-626.445) * [-625.195] (-626.980) (-626.126) (-625.175) -- 0:00:34
429000 -- [-627.139] (-628.699) (-630.260) (-628.443) * [-624.793] (-632.166) (-626.319) (-626.228) -- 0:00:34
429500 -- (-627.197) (-627.074) [-625.714] (-626.948) * (-626.675) [-626.003] (-625.328) (-624.831) -- 0:00:34
430000 -- (-628.195) (-626.448) (-625.743) [-629.850] * [-627.160] (-631.756) (-626.198) (-625.407) -- 0:00:34
Average standard deviation of split frequencies: 0.010520
430500 -- (-627.016) (-628.866) [-624.675] (-631.797) * (-626.403) (-626.966) [-626.272] (-627.614) -- 0:00:34
431000 -- (-626.923) (-628.026) [-627.798] (-626.563) * [-625.158] (-625.819) (-624.925) (-626.268) -- 0:00:34
431500 -- (-625.950) (-631.967) [-628.534] (-627.962) * (-625.830) [-626.989] (-625.223) (-626.568) -- 0:00:34
432000 -- [-628.595] (-626.154) (-626.509) (-625.844) * [-628.073] (-627.671) (-624.845) (-626.429) -- 0:00:34
432500 -- (-626.681) [-625.333] (-625.117) (-626.397) * [-628.150] (-626.752) (-626.440) (-626.255) -- 0:00:35
433000 -- [-627.772] (-629.651) (-626.423) (-626.824) * (-627.595) (-625.204) [-628.353] (-626.029) -- 0:00:35
433500 -- (-629.314) (-627.001) [-626.745] (-626.072) * (-626.753) [-625.810] (-633.580) (-627.642) -- 0:00:35
434000 -- (-627.444) (-627.670) [-627.043] (-628.532) * (-631.359) [-627.228] (-627.678) (-627.459) -- 0:00:35
434500 -- (-628.199) (-625.001) [-625.795] (-631.298) * (-625.682) (-625.846) (-626.658) [-625.769] -- 0:00:35
435000 -- [-626.772] (-625.907) (-627.741) (-628.176) * (-626.576) (-627.460) (-626.471) [-628.126] -- 0:00:35
Average standard deviation of split frequencies: 0.010812
435500 -- (-628.624) (-624.986) [-629.461] (-627.665) * [-625.625] (-627.631) (-629.046) (-628.438) -- 0:00:34
436000 -- (-625.806) (-624.809) [-628.105] (-628.772) * [-625.864] (-625.843) (-630.261) (-625.576) -- 0:00:34
436500 -- (-625.693) [-625.640] (-628.593) (-624.907) * (-626.431) [-631.137] (-626.897) (-625.733) -- 0:00:34
437000 -- (-625.888) (-625.121) (-628.380) [-632.588] * (-629.856) (-630.505) [-626.130] (-628.049) -- 0:00:34
437500 -- [-628.862] (-625.700) (-628.756) (-627.549) * (-628.300) (-628.319) [-625.372] (-625.972) -- 0:00:34
438000 -- (-626.429) [-626.573] (-631.611) (-628.776) * (-625.425) (-625.796) [-626.037] (-630.365) -- 0:00:34
438500 -- (-625.656) (-626.214) [-625.663] (-627.440) * (-629.997) [-627.321] (-629.126) (-627.265) -- 0:00:34
439000 -- (-627.357) (-625.221) (-627.416) [-625.047] * [-635.252] (-627.472) (-628.763) (-626.416) -- 0:00:34
439500 -- [-628.351] (-629.082) (-626.739) (-625.060) * (-629.823) (-626.252) [-628.957] (-626.881) -- 0:00:34
440000 -- (-628.452) [-628.342] (-627.123) (-629.172) * (-626.794) (-628.332) [-626.535] (-628.109) -- 0:00:34
Average standard deviation of split frequencies: 0.011327
440500 -- (-627.757) (-626.279) (-628.455) [-626.079] * (-626.470) (-627.340) [-628.768] (-626.702) -- 0:00:34
441000 -- (-625.368) (-629.307) (-628.170) [-626.046] * (-630.429) [-627.375] (-630.469) (-627.016) -- 0:00:34
441500 -- (-625.589) (-629.581) (-627.572) [-627.307] * (-625.843) (-626.142) [-626.835] (-626.115) -- 0:00:34
442000 -- (-626.114) (-625.812) [-626.346] (-629.330) * [-629.820] (-627.700) (-626.921) (-628.505) -- 0:00:34
442500 -- (-629.804) (-627.495) [-626.161] (-626.092) * [-626.688] (-629.287) (-627.890) (-625.230) -- 0:00:34
443000 -- [-625.302] (-625.514) (-627.095) (-625.657) * (-629.435) (-627.028) [-626.939] (-627.574) -- 0:00:33
443500 -- (-625.546) (-625.250) [-625.676] (-627.727) * (-625.945) (-633.744) [-626.159] (-625.673) -- 0:00:33
444000 -- (-629.461) [-626.487] (-628.204) (-628.008) * (-625.661) (-627.138) [-627.385] (-628.680) -- 0:00:33
444500 -- [-628.556] (-627.955) (-627.018) (-632.737) * (-627.829) (-632.325) [-628.034] (-626.663) -- 0:00:33
445000 -- (-629.334) (-631.711) [-625.547] (-632.624) * (-629.461) (-627.204) (-625.507) [-625.382] -- 0:00:33
Average standard deviation of split frequencies: 0.011440
445500 -- [-624.731] (-631.712) (-628.144) (-627.066) * (-627.281) (-630.096) (-625.929) [-625.461] -- 0:00:33
446000 -- [-625.632] (-627.178) (-626.056) (-632.887) * (-624.972) [-629.065] (-625.649) (-625.504) -- 0:00:33
446500 -- (-626.390) (-628.584) [-627.528] (-626.732) * (-626.592) [-627.644] (-625.431) (-627.405) -- 0:00:33
447000 -- (-625.844) (-630.454) (-629.599) [-626.544] * (-628.901) (-624.941) (-627.266) [-625.979] -- 0:00:33
447500 -- (-626.684) [-627.867] (-625.957) (-627.259) * (-625.579) [-627.037] (-625.651) (-626.226) -- 0:00:33
448000 -- (-628.467) (-626.156) (-630.448) [-629.221] * (-625.492) (-626.577) (-625.709) [-630.072] -- 0:00:33
448500 -- [-626.879] (-626.675) (-626.256) (-634.001) * (-632.071) (-626.175) [-626.597] (-629.862) -- 0:00:33
449000 -- (-627.935) [-627.472] (-626.970) (-631.863) * [-629.380] (-625.189) (-625.942) (-625.618) -- 0:00:33
449500 -- (-628.704) (-628.179) [-627.401] (-626.313) * (-629.442) (-628.460) (-630.102) [-626.305] -- 0:00:34
450000 -- (-626.819) (-625.250) (-626.248) [-625.823] * (-626.397) (-630.296) [-625.172] (-627.774) -- 0:00:34
Average standard deviation of split frequencies: 0.011445
450500 -- (-627.269) [-629.271] (-626.175) (-626.619) * (-626.947) [-626.489] (-626.091) (-626.718) -- 0:00:34
451000 -- (-626.195) (-630.927) [-626.129] (-628.704) * (-625.009) (-627.461) (-625.690) [-629.833] -- 0:00:34
451500 -- [-626.258] (-625.732) (-627.688) (-627.403) * (-626.953) [-626.586] (-629.458) (-628.143) -- 0:00:34
452000 -- (-629.845) (-631.760) (-629.471) [-624.840] * [-626.113] (-627.548) (-626.854) (-628.525) -- 0:00:33
452500 -- (-631.416) [-628.670] (-626.327) (-630.064) * (-628.719) [-625.631] (-626.981) (-626.470) -- 0:00:33
453000 -- [-625.929] (-626.674) (-626.458) (-626.342) * (-627.614) (-625.638) [-626.664] (-629.131) -- 0:00:33
453500 -- [-627.045] (-626.533) (-629.501) (-627.314) * (-626.177) (-624.763) (-626.547) [-628.555] -- 0:00:33
454000 -- (-626.756) (-625.418) [-626.818] (-627.612) * [-627.779] (-627.907) (-629.896) (-630.443) -- 0:00:33
454500 -- (-625.203) (-627.197) [-625.696] (-628.181) * (-625.259) (-627.498) [-628.150] (-631.160) -- 0:00:33
455000 -- [-628.320] (-625.968) (-626.846) (-630.486) * (-625.328) (-628.183) (-629.601) [-628.785] -- 0:00:33
Average standard deviation of split frequencies: 0.011007
455500 -- (-629.027) [-626.125] (-627.576) (-628.637) * (-624.858) (-626.987) [-625.933] (-626.772) -- 0:00:33
456000 -- (-626.413) (-626.713) [-628.512] (-629.352) * (-625.136) (-626.728) [-629.536] (-625.406) -- 0:00:33
456500 -- (-625.954) [-626.150] (-626.541) (-626.723) * (-626.854) [-625.748] (-628.249) (-625.840) -- 0:00:33
457000 -- (-629.586) (-629.160) (-626.934) [-627.737] * [-629.587] (-627.614) (-628.574) (-627.226) -- 0:00:33
457500 -- (-628.445) (-632.300) [-627.140] (-626.484) * (-627.187) [-625.556] (-628.240) (-626.734) -- 0:00:33
458000 -- [-628.020] (-630.841) (-630.374) (-627.179) * (-632.529) (-624.842) (-626.222) [-627.160] -- 0:00:33
458500 -- [-625.369] (-628.725) (-625.972) (-625.775) * [-630.194] (-625.255) (-624.700) (-624.733) -- 0:00:33
459000 -- (-629.284) [-626.419] (-628.227) (-624.886) * (-628.783) (-629.915) (-626.663) [-625.067] -- 0:00:33
459500 -- (-627.623) (-625.589) [-626.945] (-626.400) * (-629.458) (-629.658) (-626.314) [-626.606] -- 0:00:32
460000 -- (-628.198) (-625.269) [-627.551] (-627.335) * [-627.958] (-629.231) (-626.673) (-626.280) -- 0:00:32
Average standard deviation of split frequencies: 0.010835
460500 -- (-627.810) [-627.069] (-628.679) (-627.436) * (-626.744) (-630.432) (-624.748) [-625.790] -- 0:00:32
461000 -- [-626.137] (-627.491) (-627.439) (-629.561) * (-625.358) (-626.810) (-625.377) [-630.627] -- 0:00:32
461500 -- (-629.532) (-626.596) [-626.762] (-628.825) * (-626.094) (-624.998) (-628.160) [-627.803] -- 0:00:32
462000 -- (-629.537) (-628.274) [-625.837] (-632.799) * [-625.842] (-627.642) (-626.637) (-624.591) -- 0:00:32
462500 -- [-630.597] (-625.913) (-625.602) (-627.048) * (-629.390) (-628.506) (-627.169) [-627.530] -- 0:00:32
463000 -- (-626.926) (-626.046) (-626.023) [-631.498] * (-630.194) (-630.399) (-626.318) [-628.761] -- 0:00:32
463500 -- (-628.783) (-625.311) [-625.459] (-628.384) * (-625.132) (-627.360) [-627.877] (-633.392) -- 0:00:32
464000 -- (-629.874) [-628.411] (-626.697) (-626.587) * (-626.361) (-627.517) [-625.270] (-627.544) -- 0:00:32
464500 -- (-626.736) [-625.566] (-629.056) (-629.023) * (-627.714) (-628.042) [-625.945] (-628.283) -- 0:00:32
465000 -- (-628.230) (-628.403) (-628.473) [-629.196] * (-628.167) (-626.644) (-625.771) [-628.627] -- 0:00:32
Average standard deviation of split frequencies: 0.010771
465500 -- [-627.682] (-625.526) (-625.746) (-626.988) * (-627.234) (-625.471) [-628.921] (-626.871) -- 0:00:32
466000 -- (-628.065) (-625.890) (-628.774) [-627.155] * [-624.907] (-626.134) (-626.193) (-629.276) -- 0:00:33
466500 -- (-626.228) (-625.893) [-625.307] (-627.700) * [-628.852] (-625.898) (-628.035) (-627.890) -- 0:00:33
467000 -- (-625.941) (-625.305) [-626.442] (-626.664) * (-625.753) (-630.885) [-627.176] (-626.970) -- 0:00:33
467500 -- (-627.893) [-625.534] (-626.789) (-627.901) * (-625.786) (-629.412) [-627.103] (-628.218) -- 0:00:33
468000 -- (-627.142) [-630.847] (-624.916) (-628.431) * (-628.733) (-625.345) (-626.345) [-629.225] -- 0:00:32
468500 -- (-629.877) (-627.163) [-628.592] (-629.795) * (-626.711) [-627.955] (-626.067) (-625.878) -- 0:00:32
469000 -- (-628.581) (-625.550) [-625.158] (-627.472) * (-627.170) [-629.885] (-627.805) (-630.604) -- 0:00:32
469500 -- (-626.337) (-626.800) (-627.083) [-629.589] * (-629.275) [-630.573] (-624.875) (-628.206) -- 0:00:32
470000 -- (-624.919) (-627.249) (-630.177) [-626.114] * (-627.605) [-627.144] (-625.004) (-631.180) -- 0:00:32
Average standard deviation of split frequencies: 0.010369
470500 -- (-625.055) (-627.452) [-626.238] (-626.259) * (-626.748) [-628.407] (-627.488) (-633.963) -- 0:00:32
471000 -- (-625.592) [-627.534] (-626.991) (-627.083) * (-626.199) (-629.320) [-626.460] (-628.644) -- 0:00:32
471500 -- (-625.323) [-627.869] (-627.548) (-626.459) * (-624.737) [-626.977] (-625.228) (-632.554) -- 0:00:32
472000 -- (-626.729) (-629.794) (-628.046) [-628.533] * (-626.168) (-625.692) [-625.349] (-628.608) -- 0:00:32
472500 -- (-626.814) [-626.920] (-627.774) (-629.929) * (-624.821) (-625.542) (-627.379) [-631.554] -- 0:00:32
473000 -- (-626.223) [-625.885] (-626.471) (-625.231) * (-625.409) (-627.264) (-624.846) [-628.045] -- 0:00:32
473500 -- [-626.151] (-626.281) (-627.093) (-626.806) * [-628.237] (-628.728) (-628.203) (-629.125) -- 0:00:32
474000 -- [-626.346] (-625.583) (-625.560) (-626.619) * (-628.068) [-624.967] (-626.138) (-627.832) -- 0:00:32
474500 -- (-626.981) (-627.931) (-625.928) [-625.608] * (-626.985) [-629.363] (-625.408) (-630.256) -- 0:00:32
475000 -- [-628.357] (-627.419) (-626.065) (-626.196) * (-626.779) (-628.091) (-625.664) [-625.978] -- 0:00:32
Average standard deviation of split frequencies: 0.010275
475500 -- (-629.678) [-625.102] (-625.553) (-629.990) * (-627.583) (-625.400) [-626.261] (-630.671) -- 0:00:31
476000 -- [-626.432] (-627.860) (-627.407) (-626.776) * (-631.739) (-627.796) (-625.929) [-634.584] -- 0:00:31
476500 -- (-625.616) (-625.693) [-626.836] (-626.601) * (-628.546) (-627.833) (-626.582) [-632.050] -- 0:00:31
477000 -- (-628.853) (-624.928) (-626.296) [-626.498] * [-628.331] (-624.746) (-630.035) (-628.382) -- 0:00:31
477500 -- (-627.330) (-625.528) (-626.319) [-625.971] * (-629.770) (-625.947) (-627.571) [-632.582] -- 0:00:31
478000 -- (-625.969) (-631.305) [-625.749] (-627.993) * (-627.159) (-625.776) [-627.481] (-625.743) -- 0:00:31
478500 -- (-627.447) (-628.796) [-627.214] (-626.186) * (-629.420) (-627.887) [-625.232] (-626.139) -- 0:00:31
479000 -- (-627.045) (-626.340) [-627.217] (-629.187) * (-627.597) (-626.052) (-626.420) [-625.781] -- 0:00:31
479500 -- (-629.449) (-626.563) (-625.160) [-625.889] * (-627.447) (-626.257) [-628.575] (-625.544) -- 0:00:31
480000 -- (-625.794) (-630.446) [-626.509] (-626.238) * (-627.058) [-626.843] (-628.509) (-626.145) -- 0:00:31
Average standard deviation of split frequencies: 0.010557
480500 -- (-625.001) [-629.614] (-628.969) (-630.756) * (-626.096) (-629.814) [-625.299] (-626.583) -- 0:00:31
481000 -- (-625.996) [-627.290] (-629.593) (-628.641) * [-626.751] (-626.204) (-626.132) (-626.730) -- 0:00:31
481500 -- (-631.266) (-625.017) [-626.124] (-624.899) * [-626.657] (-626.034) (-633.824) (-626.510) -- 0:00:31
482000 -- [-626.524] (-626.382) (-626.553) (-625.202) * [-625.789] (-626.141) (-626.918) (-627.122) -- 0:00:31
482500 -- [-626.651] (-626.020) (-625.370) (-628.428) * [-630.477] (-630.282) (-627.666) (-626.050) -- 0:00:31
483000 -- (-628.315) (-626.867) (-626.367) [-626.071] * (-626.364) (-628.007) [-626.068] (-625.619) -- 0:00:32
483500 -- (-625.772) [-626.849] (-626.442) (-626.180) * [-625.974] (-627.327) (-626.803) (-626.101) -- 0:00:32
484000 -- (-631.602) (-628.411) [-629.112] (-630.559) * (-629.230) (-629.697) (-626.494) [-625.917] -- 0:00:31
484500 -- (-628.830) [-626.817] (-627.310) (-631.040) * (-633.858) (-627.275) (-625.257) [-626.571] -- 0:00:31
485000 -- (-631.396) (-626.199) [-626.390] (-626.793) * (-630.937) (-625.892) (-628.751) [-627.743] -- 0:00:31
Average standard deviation of split frequencies: 0.011012
485500 -- (-627.417) [-628.367] (-625.423) (-626.184) * (-627.055) [-625.130] (-628.001) (-626.869) -- 0:00:31
486000 -- (-627.222) [-625.796] (-625.619) (-629.790) * (-629.322) (-628.440) [-627.324] (-631.223) -- 0:00:31
486500 -- (-631.052) (-625.042) (-625.422) [-626.145] * [-627.860] (-628.563) (-626.885) (-628.231) -- 0:00:31
487000 -- (-629.071) (-631.951) [-626.554] (-627.874) * [-625.913] (-628.939) (-627.064) (-627.635) -- 0:00:31
487500 -- (-626.328) (-628.199) (-627.197) [-626.302] * [-628.739] (-626.460) (-629.253) (-627.877) -- 0:00:31
488000 -- (-624.911) (-626.441) [-625.329] (-627.129) * (-626.331) (-625.388) (-629.314) [-626.931] -- 0:00:31
488500 -- [-625.626] (-625.217) (-625.953) (-626.215) * [-625.868] (-627.238) (-625.811) (-630.417) -- 0:00:31
489000 -- (-626.485) (-625.825) [-626.323] (-628.347) * (-626.619) (-626.811) [-629.021] (-630.372) -- 0:00:31
489500 -- (-624.610) [-627.772] (-628.136) (-626.816) * (-627.549) (-627.808) (-636.596) [-629.324] -- 0:00:31
490000 -- (-624.608) (-629.104) [-626.624] (-626.534) * [-627.272] (-625.138) (-626.516) (-627.483) -- 0:00:31
Average standard deviation of split frequencies: 0.010868
490500 -- [-627.245] (-628.378) (-627.388) (-626.958) * (-626.405) [-626.467] (-627.100) (-630.000) -- 0:00:31
491000 -- (-632.220) [-627.757] (-630.088) (-626.308) * (-627.546) (-626.162) (-626.367) [-627.404] -- 0:00:31
491500 -- (-630.822) (-625.602) [-625.473] (-625.180) * (-626.581) [-624.972] (-627.414) (-627.098) -- 0:00:31
492000 -- (-629.823) [-625.549] (-629.067) (-626.302) * (-625.610) (-626.527) (-628.543) [-627.912] -- 0:00:30
492500 -- (-627.062) [-628.603] (-627.157) (-628.503) * [-628.622] (-627.080) (-626.437) (-629.861) -- 0:00:30
493000 -- [-626.666] (-626.723) (-630.349) (-628.342) * (-630.824) (-625.596) (-626.477) [-626.459] -- 0:00:30
493500 -- (-629.431) [-626.405] (-627.144) (-625.801) * (-626.819) [-626.512] (-626.861) (-628.599) -- 0:00:30
494000 -- (-630.101) (-625.527) (-625.364) [-626.333] * [-627.752] (-627.441) (-626.094) (-630.523) -- 0:00:30
494500 -- [-626.078] (-624.745) (-627.725) (-626.135) * (-625.558) (-626.998) (-626.415) [-625.953] -- 0:00:30
495000 -- (-625.354) [-630.696] (-627.452) (-626.421) * (-626.321) [-626.865] (-626.388) (-626.774) -- 0:00:30
Average standard deviation of split frequencies: 0.010930
495500 -- (-626.164) (-626.478) (-629.340) [-626.214] * (-625.660) (-627.628) (-626.233) [-625.678] -- 0:00:30
496000 -- (-627.353) (-627.110) [-627.446] (-627.865) * (-627.787) (-626.445) [-625.205] (-628.462) -- 0:00:30
496500 -- [-626.592] (-628.345) (-627.144) (-629.648) * (-629.036) [-626.576] (-629.273) (-625.703) -- 0:00:30
497000 -- (-629.001) [-626.873] (-631.226) (-627.476) * [-626.494] (-625.414) (-626.058) (-625.216) -- 0:00:30
497500 -- [-631.078] (-626.611) (-629.264) (-624.738) * (-627.702) (-626.028) [-628.763] (-626.246) -- 0:00:30
498000 -- (-629.319) [-627.118] (-635.119) (-625.564) * (-634.026) [-627.420] (-628.727) (-629.088) -- 0:00:30
498500 -- [-626.278] (-634.552) (-629.700) (-624.954) * (-627.902) (-629.845) [-626.619] (-629.366) -- 0:00:30
499000 -- (-627.966) [-626.524] (-626.944) (-626.222) * (-626.607) [-624.608] (-626.942) (-627.383) -- 0:00:30
499500 -- [-627.264] (-626.817) (-625.655) (-626.409) * (-627.801) (-624.593) (-628.455) [-625.268] -- 0:00:30
500000 -- (-626.597) [-625.826] (-627.104) (-626.003) * [-624.727] (-626.333) (-627.444) (-625.397) -- 0:00:31
Average standard deviation of split frequencies: 0.010651
500500 -- (-625.763) [-627.539] (-626.464) (-626.204) * [-625.567] (-626.919) (-632.736) (-628.877) -- 0:00:30
501000 -- (-625.607) (-630.991) (-626.859) [-627.668] * [-625.805] (-627.864) (-633.658) (-627.637) -- 0:00:30
501500 -- (-626.328) (-626.816) [-625.691] (-629.596) * [-625.666] (-626.431) (-631.753) (-630.026) -- 0:00:30
502000 -- (-625.649) (-628.005) (-625.107) [-627.542] * (-625.348) (-627.627) [-627.813] (-628.839) -- 0:00:30
502500 -- [-626.762] (-626.484) (-628.893) (-625.362) * (-629.011) (-625.198) (-628.884) [-626.424] -- 0:00:30
503000 -- (-632.047) (-626.365) [-625.825] (-627.932) * (-626.711) (-624.958) (-626.392) [-630.974] -- 0:00:30
503500 -- (-632.652) (-624.813) (-625.956) [-629.487] * [-625.599] (-625.382) (-627.769) (-633.125) -- 0:00:30
504000 -- (-625.146) [-627.396] (-630.302) (-628.993) * [-625.748] (-626.142) (-626.275) (-625.377) -- 0:00:30
504500 -- (-626.388) [-628.634] (-629.175) (-626.685) * (-627.512) (-629.226) (-625.366) [-629.476] -- 0:00:30
505000 -- [-625.772] (-627.431) (-626.959) (-625.028) * [-627.014] (-626.298) (-627.518) (-625.632) -- 0:00:30
Average standard deviation of split frequencies: 0.011412
505500 -- [-626.180] (-625.658) (-629.135) (-627.776) * (-627.641) [-626.798] (-626.897) (-625.039) -- 0:00:30
506000 -- (-624.957) [-626.572] (-637.036) (-626.663) * [-626.033] (-628.433) (-627.781) (-627.571) -- 0:00:30
506500 -- (-626.753) [-626.019] (-626.527) (-625.687) * (-625.304) [-627.758] (-625.926) (-627.481) -- 0:00:30
507000 -- [-626.578] (-627.764) (-628.705) (-626.940) * (-625.063) (-628.367) (-626.983) [-625.625] -- 0:00:30
507500 -- (-627.610) (-627.121) [-628.864] (-625.447) * (-629.516) [-627.105] (-626.042) (-630.231) -- 0:00:30
508000 -- (-628.344) (-628.065) (-627.320) [-627.890] * (-626.109) [-625.481] (-625.190) (-628.338) -- 0:00:30
508500 -- (-628.209) (-628.371) [-627.947] (-626.347) * (-626.238) (-627.784) [-629.256] (-627.334) -- 0:00:29
509000 -- (-625.966) (-628.376) (-628.343) [-626.963] * [-625.182] (-627.553) (-626.046) (-625.402) -- 0:00:29
509500 -- (-626.334) [-626.706] (-630.603) (-625.244) * (-625.612) (-626.308) (-626.118) [-627.744] -- 0:00:29
510000 -- (-625.060) (-625.979) [-629.044] (-625.107) * [-626.523] (-625.394) (-625.497) (-626.025) -- 0:00:29
Average standard deviation of split frequencies: 0.010847
510500 -- (-628.177) (-625.659) [-626.078] (-626.916) * (-628.344) [-626.362] (-624.879) (-625.821) -- 0:00:29
511000 -- (-628.611) [-628.229] (-628.678) (-625.604) * (-630.180) (-626.925) (-626.243) [-627.620] -- 0:00:29
511500 -- (-626.050) (-626.252) (-626.838) [-625.542] * [-630.714] (-632.241) (-626.542) (-626.265) -- 0:00:29
512000 -- [-626.133] (-630.005) (-629.775) (-626.256) * (-626.885) (-630.172) [-625.623] (-625.325) -- 0:00:29
512500 -- (-629.162) (-626.732) [-625.100] (-629.288) * (-634.251) [-626.344] (-628.682) (-625.711) -- 0:00:30
513000 -- (-629.485) (-626.968) (-628.491) [-625.424] * (-626.368) (-628.834) (-626.576) [-631.472] -- 0:00:30
513500 -- (-631.070) (-624.997) (-628.990) [-625.898] * (-629.406) (-626.063) [-626.344] (-626.925) -- 0:00:30
514000 -- (-629.652) (-625.865) [-625.917] (-627.478) * (-627.009) (-630.967) (-625.592) [-626.438] -- 0:00:30
514500 -- (-627.993) [-627.444] (-626.269) (-626.185) * (-625.981) (-627.452) [-625.199] (-626.339) -- 0:00:30
515000 -- (-628.650) (-626.990) [-625.855] (-625.906) * (-626.333) (-628.066) [-627.192] (-627.628) -- 0:00:30
Average standard deviation of split frequencies: 0.010563
515500 -- (-626.949) (-625.976) [-626.496] (-630.076) * (-625.420) (-625.743) [-628.296] (-628.630) -- 0:00:30
516000 -- (-625.284) (-627.293) (-628.564) [-628.126] * (-627.404) (-626.614) (-628.982) [-629.765] -- 0:00:30
516500 -- (-626.349) (-626.266) [-627.774] (-625.882) * (-625.529) (-626.635) (-627.194) [-627.243] -- 0:00:29
517000 -- (-626.572) (-627.457) (-627.083) [-626.726] * [-626.576] (-626.609) (-629.292) (-626.308) -- 0:00:29
517500 -- [-626.085] (-625.528) (-625.479) (-625.843) * (-626.229) [-627.150] (-627.353) (-630.731) -- 0:00:29
518000 -- (-628.332) [-626.133] (-628.339) (-627.487) * (-627.893) (-630.700) [-628.024] (-632.549) -- 0:00:29
518500 -- (-629.009) (-626.144) (-628.142) [-628.284] * (-627.115) (-632.076) (-627.064) [-626.901] -- 0:00:29
519000 -- (-628.640) (-624.864) [-625.877] (-626.758) * (-625.294) (-626.780) [-629.341] (-626.949) -- 0:00:29
519500 -- (-625.793) (-628.627) [-627.421] (-628.957) * (-628.773) (-627.353) [-626.747] (-627.506) -- 0:00:29
520000 -- [-629.570] (-626.260) (-624.876) (-627.349) * (-626.430) [-628.522] (-625.183) (-625.614) -- 0:00:29
Average standard deviation of split frequencies: 0.010412
520500 -- (-625.902) (-627.305) [-627.382] (-627.322) * (-625.350) (-628.644) [-625.903] (-627.210) -- 0:00:29
521000 -- (-626.257) (-626.396) [-627.747] (-628.734) * [-625.540] (-629.069) (-625.619) (-625.117) -- 0:00:29
521500 -- (-625.136) (-630.090) [-626.002] (-629.661) * (-629.105) (-627.228) [-627.105] (-628.812) -- 0:00:29
522000 -- (-630.868) (-627.028) [-625.848] (-629.491) * [-626.064] (-625.702) (-626.499) (-626.092) -- 0:00:29
522500 -- (-635.247) (-626.048) [-624.796] (-624.895) * (-625.241) (-628.719) [-627.341] (-626.505) -- 0:00:29
523000 -- [-635.340] (-625.562) (-629.031) (-624.794) * (-633.463) (-629.615) [-625.430] (-634.726) -- 0:00:29
523500 -- [-626.461] (-626.837) (-627.941) (-626.417) * (-629.417) [-625.998] (-625.287) (-627.320) -- 0:00:29
524000 -- [-627.772] (-626.870) (-626.212) (-628.774) * (-626.212) (-627.169) (-626.759) [-628.778] -- 0:00:29
524500 -- (-628.084) (-627.484) (-626.877) [-627.900] * (-628.429) (-625.630) (-625.632) [-626.780] -- 0:00:29
525000 -- (-627.183) (-625.666) (-625.364) [-625.725] * (-625.958) [-627.816] (-629.738) (-627.164) -- 0:00:28
Average standard deviation of split frequencies: 0.011176
525500 -- (-632.725) [-627.764] (-631.479) (-627.849) * [-625.539] (-625.716) (-628.548) (-630.071) -- 0:00:28
526000 -- (-631.127) [-627.802] (-627.967) (-627.511) * (-625.605) (-626.563) (-629.930) [-632.876] -- 0:00:28
526500 -- (-626.069) (-634.407) (-625.773) [-625.460] * (-625.296) (-627.382) (-628.334) [-625.849] -- 0:00:28
527000 -- [-628.592] (-629.697) (-629.388) (-625.427) * (-625.639) (-628.404) (-629.515) [-628.905] -- 0:00:28
527500 -- (-625.497) [-627.293] (-627.051) (-625.822) * (-626.573) (-633.474) (-631.363) [-629.257] -- 0:00:28
528000 -- (-630.012) (-628.819) [-624.899] (-624.911) * (-626.106) (-628.869) [-626.129] (-626.476) -- 0:00:28
528500 -- [-625.591] (-627.648) (-625.263) (-625.973) * (-630.029) [-625.742] (-629.426) (-626.240) -- 0:00:29
529000 -- (-625.715) (-634.776) (-626.766) [-627.580] * (-632.358) (-624.958) [-627.439] (-627.631) -- 0:00:29
529500 -- (-627.824) (-626.512) [-627.878] (-628.593) * (-630.562) [-628.230] (-628.883) (-625.902) -- 0:00:29
530000 -- (-628.770) [-625.119] (-628.554) (-629.440) * (-625.207) (-627.563) (-625.745) [-628.353] -- 0:00:29
Average standard deviation of split frequencies: 0.010869
530500 -- (-627.660) (-627.120) [-627.592] (-628.639) * (-627.765) (-626.000) [-625.635] (-627.141) -- 0:00:29
531000 -- (-630.691) (-627.720) [-626.141] (-630.287) * [-627.818] (-628.415) (-626.236) (-628.471) -- 0:00:29
531500 -- [-630.432] (-628.199) (-627.178) (-627.700) * (-631.029) (-626.192) [-625.302] (-630.936) -- 0:00:29
532000 -- (-625.967) (-627.253) (-629.517) [-627.661] * (-627.064) [-626.134] (-625.984) (-632.988) -- 0:00:29
532500 -- (-625.629) (-625.504) (-628.061) [-627.860] * (-630.526) (-626.879) [-626.158] (-626.435) -- 0:00:28
533000 -- (-626.978) (-631.466) [-626.666] (-626.927) * (-632.022) (-625.821) [-628.996] (-629.729) -- 0:00:28
533500 -- (-626.892) (-626.055) [-626.928] (-626.828) * [-628.775] (-631.047) (-628.424) (-626.132) -- 0:00:28
534000 -- (-625.942) (-626.583) [-625.839] (-628.714) * (-627.893) (-628.543) [-626.780] (-628.341) -- 0:00:28
534500 -- (-625.399) (-626.530) (-627.073) [-631.955] * (-630.754) (-626.426) (-627.499) [-625.883] -- 0:00:28
535000 -- (-625.915) (-626.686) (-627.531) [-626.403] * (-631.398) (-632.755) (-630.156) [-624.733] -- 0:00:28
Average standard deviation of split frequencies: 0.010554
535500 -- [-625.527] (-629.683) (-626.469) (-625.278) * [-626.793] (-628.028) (-625.565) (-625.764) -- 0:00:28
536000 -- [-625.426] (-625.769) (-626.771) (-626.725) * [-628.647] (-627.155) (-627.202) (-626.213) -- 0:00:28
536500 -- [-625.335] (-633.677) (-626.142) (-625.623) * (-625.242) (-627.909) [-626.642] (-628.063) -- 0:00:28
537000 -- [-626.282] (-629.006) (-626.749) (-626.094) * [-628.531] (-629.288) (-626.147) (-626.924) -- 0:00:28
537500 -- [-626.652] (-626.662) (-626.064) (-625.357) * (-627.008) [-629.476] (-626.318) (-627.415) -- 0:00:28
538000 -- [-631.384] (-626.875) (-625.595) (-628.782) * [-626.197] (-627.637) (-628.528) (-632.440) -- 0:00:28
538500 -- (-630.104) (-625.581) [-630.572] (-627.142) * (-625.893) (-628.185) [-625.352] (-631.373) -- 0:00:28
539000 -- (-627.959) (-625.607) [-628.273] (-625.823) * [-625.627] (-625.627) (-628.816) (-625.222) -- 0:00:28
539500 -- (-626.155) [-624.810] (-624.886) (-629.423) * (-626.765) (-627.536) (-632.093) [-626.679] -- 0:00:28
540000 -- [-625.764] (-625.410) (-625.290) (-630.462) * (-632.165) (-625.710) (-625.062) [-627.360] -- 0:00:28
Average standard deviation of split frequencies: 0.010873
540500 -- (-626.207) [-625.389] (-626.298) (-627.488) * (-627.028) (-625.892) [-626.344] (-625.951) -- 0:00:28
541000 -- (-627.826) (-629.377) [-626.088] (-626.503) * (-626.275) (-626.220) [-626.363] (-627.526) -- 0:00:27
541500 -- (-627.666) (-628.602) (-625.457) [-633.484] * (-629.267) [-627.025] (-625.201) (-626.807) -- 0:00:27
542000 -- (-626.217) [-627.090] (-624.927) (-628.248) * (-625.849) (-627.191) [-627.929] (-624.824) -- 0:00:27
542500 -- [-630.565] (-627.532) (-626.032) (-626.109) * (-625.299) [-625.586] (-625.026) (-626.245) -- 0:00:27
543000 -- (-628.907) (-624.900) (-627.625) [-626.646] * [-629.973] (-626.734) (-629.087) (-625.732) -- 0:00:27
543500 -- [-625.847] (-625.819) (-628.868) (-630.023) * (-625.932) [-626.315] (-629.151) (-625.630) -- 0:00:27
544000 -- [-624.638] (-626.456) (-630.044) (-628.417) * [-630.498] (-625.634) (-629.155) (-626.306) -- 0:00:27
544500 -- (-628.380) (-626.618) (-626.089) [-625.120] * (-625.494) [-626.145] (-627.028) (-627.563) -- 0:00:27
545000 -- [-625.574] (-628.620) (-626.771) (-629.208) * (-626.134) (-627.198) (-630.547) [-626.680] -- 0:00:28
Average standard deviation of split frequencies: 0.010614
545500 -- (-628.753) (-627.728) (-625.849) [-628.536] * (-629.316) [-627.223] (-625.305) (-626.234) -- 0:00:28
546000 -- [-625.594] (-634.428) (-627.190) (-625.578) * (-629.816) (-629.141) (-629.164) [-625.408] -- 0:00:28
546500 -- (-626.838) (-625.719) [-624.929] (-624.728) * (-634.208) (-625.767) (-629.474) [-624.804] -- 0:00:28
547000 -- (-627.432) [-625.948] (-628.134) (-630.321) * (-627.360) (-626.135) [-630.369] (-625.566) -- 0:00:28
547500 -- (-625.413) [-626.688] (-628.006) (-630.599) * [-626.226] (-627.717) (-625.152) (-626.087) -- 0:00:28
548000 -- (-629.853) (-624.749) (-626.229) [-629.674] * (-626.565) [-626.434] (-625.707) (-629.428) -- 0:00:28
548500 -- [-626.843] (-626.350) (-627.234) (-625.952) * (-625.889) (-628.820) [-625.455] (-629.560) -- 0:00:27
549000 -- [-625.313] (-627.471) (-633.624) (-628.563) * [-627.302] (-631.418) (-625.405) (-629.416) -- 0:00:27
549500 -- (-626.245) (-628.477) [-626.233] (-626.253) * (-625.826) [-625.095] (-626.478) (-625.812) -- 0:00:27
550000 -- (-630.987) (-626.692) (-625.498) [-626.245] * (-625.951) [-627.948] (-626.578) (-626.261) -- 0:00:27
Average standard deviation of split frequencies: 0.010323
550500 -- (-628.399) [-627.595] (-625.607) (-625.404) * (-625.721) (-630.565) [-627.845] (-625.131) -- 0:00:27
551000 -- (-626.005) (-627.974) (-628.514) [-626.661] * (-625.417) (-627.410) [-625.600] (-625.482) -- 0:00:27
551500 -- [-629.448] (-627.777) (-629.891) (-627.136) * [-625.377] (-627.192) (-624.959) (-625.289) -- 0:00:27
552000 -- (-630.051) (-628.994) [-631.778] (-625.392) * (-626.068) (-625.610) (-625.500) [-625.725] -- 0:00:27
552500 -- (-628.980) [-627.131] (-630.148) (-627.629) * (-626.132) (-626.173) (-626.249) [-627.773] -- 0:00:27
553000 -- (-627.271) (-629.780) (-625.536) [-626.284] * (-626.182) (-625.739) [-627.725] (-628.704) -- 0:00:27
553500 -- (-627.637) (-628.292) [-625.165] (-628.225) * (-625.289) (-627.922) (-632.379) [-628.530] -- 0:00:27
554000 -- (-627.595) (-627.288) [-626.122] (-627.591) * (-624.993) (-626.777) (-625.859) [-626.806] -- 0:00:27
554500 -- [-624.872] (-627.689) (-625.689) (-627.676) * [-628.271] (-629.337) (-625.189) (-627.112) -- 0:00:27
555000 -- (-628.373) (-625.075) (-629.619) [-625.721] * (-626.566) [-633.095] (-625.895) (-626.540) -- 0:00:27
Average standard deviation of split frequencies: 0.010074
555500 -- (-625.403) [-625.994] (-631.260) (-625.781) * (-628.159) (-626.535) (-626.530) [-627.343] -- 0:00:27
556000 -- (-626.324) [-625.283] (-624.735) (-625.963) * (-626.761) [-625.976] (-624.949) (-628.130) -- 0:00:27
556500 -- [-625.906] (-628.892) (-625.759) (-627.694) * [-625.277] (-626.270) (-626.008) (-626.644) -- 0:00:27
557000 -- (-628.873) [-628.716] (-625.293) (-630.568) * (-625.585) (-625.183) (-626.193) [-627.066] -- 0:00:27
557500 -- (-626.636) (-627.487) (-627.497) [-628.497] * (-625.829) (-627.541) (-625.280) [-626.522] -- 0:00:26
558000 -- (-633.236) (-628.294) (-628.163) [-628.918] * (-627.806) [-625.485] (-629.864) (-628.011) -- 0:00:26
558500 -- (-626.637) (-628.095) (-629.847) [-625.723] * (-628.199) (-630.227) (-630.971) [-632.318] -- 0:00:26
559000 -- [-626.971] (-629.197) (-634.652) (-626.973) * [-628.158] (-628.197) (-632.211) (-626.479) -- 0:00:26
559500 -- [-629.240] (-626.769) (-630.158) (-627.162) * [-630.032] (-631.398) (-629.551) (-628.401) -- 0:00:26
560000 -- (-629.960) (-634.409) (-630.663) [-627.428] * [-626.648] (-630.843) (-628.728) (-629.208) -- 0:00:26
Average standard deviation of split frequencies: 0.009694
560500 -- [-628.884] (-628.493) (-626.490) (-624.989) * (-625.454) (-628.650) [-626.997] (-627.368) -- 0:00:26
561000 -- (-628.553) (-630.903) (-625.380) [-626.888] * (-629.854) (-627.915) [-627.203] (-627.695) -- 0:00:26
561500 -- (-630.589) (-626.981) [-627.652] (-627.169) * [-625.997] (-627.017) (-626.186) (-627.017) -- 0:00:26
562000 -- (-625.756) [-627.351] (-627.081) (-625.751) * (-631.034) (-626.289) [-629.725] (-629.884) -- 0:00:27
562500 -- [-628.717] (-627.275) (-626.804) (-626.192) * (-633.642) [-630.020] (-629.372) (-629.602) -- 0:00:27
563000 -- (-625.563) (-627.222) (-627.698) [-627.301] * (-628.339) (-624.878) (-632.797) [-626.692] -- 0:00:27
563500 -- (-624.761) (-625.605) (-627.388) [-627.364] * (-628.180) [-626.691] (-629.689) (-626.998) -- 0:00:27
564000 -- [-627.798] (-625.380) (-626.391) (-627.607) * (-627.114) (-627.942) (-626.556) [-626.072] -- 0:00:27
564500 -- (-626.323) (-628.342) (-626.097) [-627.919] * (-626.856) (-629.251) [-626.636] (-625.438) -- 0:00:27
565000 -- (-627.995) (-626.822) [-626.801] (-625.816) * (-629.627) (-629.347) [-627.614] (-626.196) -- 0:00:26
Average standard deviation of split frequencies: 0.009211
565500 -- (-629.630) (-629.334) (-626.227) [-628.703] * (-626.915) (-626.515) [-625.630] (-626.696) -- 0:00:26
566000 -- (-626.479) [-626.814] (-625.461) (-627.984) * [-626.035] (-627.652) (-626.480) (-627.600) -- 0:00:26
566500 -- (-627.964) (-627.341) [-628.579] (-629.831) * (-627.903) (-627.628) (-625.224) [-625.456] -- 0:00:26
567000 -- (-625.102) [-626.170] (-625.782) (-627.923) * (-627.624) [-625.913] (-625.076) (-625.771) -- 0:00:26
567500 -- [-625.817] (-626.217) (-628.908) (-625.929) * (-629.720) (-626.210) (-625.985) [-626.795] -- 0:00:26
568000 -- (-625.571) [-626.991] (-627.193) (-627.122) * (-627.513) (-627.962) [-629.300] (-626.884) -- 0:00:26
568500 -- (-625.085) [-626.149] (-627.395) (-627.658) * (-626.843) (-626.765) (-628.516) [-628.399] -- 0:00:26
569000 -- (-624.860) (-628.310) [-630.015] (-626.292) * [-624.910] (-625.731) (-626.804) (-627.727) -- 0:00:26
569500 -- (-625.675) (-635.140) [-627.393] (-626.774) * [-628.177] (-625.735) (-626.035) (-625.793) -- 0:00:26
570000 -- (-625.718) (-625.486) (-626.816) [-626.328] * (-626.030) (-626.284) (-625.847) [-628.373] -- 0:00:26
Average standard deviation of split frequencies: 0.008941
570500 -- (-625.911) (-625.840) (-628.184) [-625.712] * (-629.355) (-626.273) (-628.475) [-628.064] -- 0:00:26
571000 -- (-625.124) [-626.010] (-625.378) (-629.098) * (-625.909) (-627.391) (-628.826) [-625.854] -- 0:00:26
571500 -- (-628.232) (-626.692) [-627.284] (-629.489) * (-625.456) (-628.324) (-628.442) [-624.965] -- 0:00:26
572000 -- [-627.200] (-626.634) (-627.099) (-627.384) * [-626.008] (-628.500) (-630.603) (-629.961) -- 0:00:26
572500 -- [-626.319] (-630.609) (-630.732) (-626.541) * (-630.544) (-628.929) [-625.505] (-628.280) -- 0:00:26
573000 -- (-625.098) [-628.838] (-630.221) (-627.930) * (-628.996) (-627.182) [-627.924] (-626.609) -- 0:00:26
573500 -- (-625.637) [-626.834] (-628.392) (-628.255) * (-629.440) [-626.448] (-626.776) (-624.960) -- 0:00:26
574000 -- (-626.712) (-629.508) (-628.189) [-626.959] * [-626.020] (-626.238) (-625.610) (-625.257) -- 0:00:25
574500 -- [-626.577] (-628.904) (-625.551) (-628.452) * (-628.888) (-626.762) [-626.889] (-625.908) -- 0:00:25
575000 -- (-627.352) (-626.266) (-626.418) [-626.938] * [-626.800] (-631.380) (-626.121) (-625.191) -- 0:00:25
Average standard deviation of split frequencies: 0.008762
575500 -- (-628.145) [-626.205] (-626.315) (-627.200) * (-628.273) (-628.427) (-626.414) [-627.181] -- 0:00:25
576000 -- (-630.588) (-628.344) (-626.704) [-625.481] * (-628.132) (-628.305) (-627.672) [-627.316] -- 0:00:25
576500 -- [-626.626] (-625.090) (-627.447) (-626.065) * (-628.946) (-628.305) (-627.100) [-626.087] -- 0:00:25
577000 -- [-626.714] (-625.298) (-628.196) (-625.461) * (-627.995) (-626.330) [-626.212] (-625.215) -- 0:00:25
577500 -- (-629.877) [-625.521] (-627.177) (-630.498) * (-626.856) (-625.954) (-627.592) [-626.532] -- 0:00:25
578000 -- (-627.578) [-625.991] (-626.413) (-626.720) * (-625.869) (-625.445) [-630.446] (-629.902) -- 0:00:25
578500 -- (-625.423) [-626.306] (-627.266) (-625.753) * (-625.258) (-627.268) (-627.954) [-626.943] -- 0:00:26
579000 -- (-625.501) [-625.183] (-626.099) (-625.962) * [-626.307] (-626.462) (-625.526) (-626.448) -- 0:00:26
579500 -- (-625.670) (-625.412) (-627.284) [-625.451] * (-625.412) (-630.000) [-625.101] (-625.686) -- 0:00:26
580000 -- [-626.582] (-626.589) (-628.519) (-627.855) * (-627.382) (-632.555) (-634.562) [-625.316] -- 0:00:26
Average standard deviation of split frequencies: 0.008214
580500 -- (-625.948) [-626.613] (-627.564) (-627.105) * [-626.605] (-634.792) (-631.555) (-625.241) -- 0:00:26
581000 -- (-626.104) (-626.799) (-627.854) [-627.754] * (-627.320) (-627.978) [-632.866] (-626.759) -- 0:00:25
581500 -- (-626.330) (-634.047) [-626.404] (-626.916) * [-625.846] (-627.346) (-630.606) (-629.464) -- 0:00:25
582000 -- (-626.983) (-627.278) [-628.147] (-625.834) * (-625.282) (-628.461) (-624.622) [-626.352] -- 0:00:25
582500 -- (-627.146) [-626.184] (-626.175) (-626.679) * [-626.496] (-629.220) (-625.379) (-633.331) -- 0:00:25
583000 -- (-627.184) (-627.061) (-626.728) [-625.572] * (-631.948) (-624.811) [-626.215] (-628.504) -- 0:00:25
583500 -- (-627.211) [-627.471] (-626.666) (-626.983) * [-627.579] (-627.590) (-627.619) (-624.816) -- 0:00:25
584000 -- (-626.949) (-627.294) (-628.847) [-625.491] * (-628.903) (-629.147) (-629.578) [-627.982] -- 0:00:25
584500 -- (-628.903) (-626.037) (-626.909) [-627.898] * [-630.895] (-631.692) (-626.786) (-627.166) -- 0:00:25
585000 -- (-626.178) [-629.693] (-626.220) (-628.565) * (-625.190) (-625.838) (-625.614) [-627.550] -- 0:00:25
Average standard deviation of split frequencies: 0.007855
585500 -- (-630.631) (-626.618) [-626.297] (-627.437) * [-625.940] (-626.475) (-627.898) (-626.879) -- 0:00:25
586000 -- (-625.948) (-626.055) [-627.927] (-628.020) * [-625.452] (-626.164) (-626.288) (-627.522) -- 0:00:25
586500 -- (-626.719) [-625.535] (-626.826) (-624.746) * (-625.451) [-626.136] (-629.224) (-629.306) -- 0:00:25
587000 -- (-628.576) (-626.341) (-627.299) [-625.225] * (-629.061) [-630.248] (-628.063) (-627.708) -- 0:00:25
587500 -- (-627.196) (-626.960) (-626.556) [-629.295] * [-625.692] (-627.099) (-627.553) (-626.902) -- 0:00:25
588000 -- [-626.443] (-626.088) (-627.332) (-624.898) * (-625.392) (-628.548) [-625.935] (-625.831) -- 0:00:25
588500 -- (-626.104) [-626.131] (-629.905) (-629.913) * (-627.039) [-629.644] (-629.158) (-624.638) -- 0:00:25
589000 -- [-626.085] (-625.289) (-626.121) (-627.352) * (-625.304) (-627.503) [-626.291] (-626.335) -- 0:00:25
589500 -- (-626.195) (-627.657) (-629.867) [-625.605] * (-629.536) (-625.140) (-629.281) [-624.628] -- 0:00:25
590000 -- [-626.765] (-627.242) (-625.989) (-625.895) * (-628.799) [-626.952] (-630.586) (-625.518) -- 0:00:25
Average standard deviation of split frequencies: 0.007277
590500 -- (-629.476) [-625.191] (-625.640) (-627.167) * [-626.559] (-627.878) (-628.438) (-627.509) -- 0:00:24
591000 -- [-624.950] (-628.264) (-626.405) (-626.289) * [-628.968] (-626.733) (-628.792) (-626.008) -- 0:00:24
591500 -- [-626.388] (-628.112) (-627.384) (-628.972) * [-624.891] (-625.036) (-629.328) (-627.692) -- 0:00:24
592000 -- (-624.800) (-628.347) (-625.643) [-626.597] * (-624.900) (-625.408) [-628.247] (-626.235) -- 0:00:24
592500 -- (-626.298) [-627.096] (-629.831) (-625.592) * (-626.829) (-625.457) [-625.542] (-626.934) -- 0:00:24
593000 -- (-630.483) (-630.305) [-626.006] (-633.119) * (-627.550) [-627.453] (-633.368) (-628.457) -- 0:00:24
593500 -- (-625.374) [-626.698] (-624.941) (-628.213) * [-627.129] (-624.927) (-634.425) (-626.511) -- 0:00:24
594000 -- (-626.988) [-626.784] (-629.358) (-627.530) * (-627.101) [-628.461] (-628.514) (-630.035) -- 0:00:24
594500 -- [-627.321] (-625.365) (-625.916) (-627.239) * (-626.257) (-631.894) (-627.516) [-625.486] -- 0:00:24
595000 -- (-626.113) (-626.610) (-626.209) [-627.426] * (-626.028) (-628.618) (-629.036) [-626.231] -- 0:00:24
Average standard deviation of split frequencies: 0.006746
595500 -- (-627.965) (-628.998) [-625.146] (-625.185) * (-625.932) [-627.197] (-626.463) (-627.245) -- 0:00:25
596000 -- (-631.196) (-629.515) (-625.188) [-627.663] * (-625.523) [-626.868] (-626.976) (-627.172) -- 0:00:25
596500 -- (-627.204) [-625.168] (-627.253) (-626.888) * [-626.014] (-626.040) (-626.109) (-625.522) -- 0:00:25
597000 -- (-626.068) (-629.161) (-630.043) [-627.202] * (-629.664) [-626.557] (-625.373) (-630.256) -- 0:00:24
597500 -- [-628.800] (-626.432) (-626.206) (-624.904) * (-630.372) (-628.295) (-626.021) [-625.408] -- 0:00:24
598000 -- (-629.792) (-626.489) [-626.733] (-626.080) * [-631.213] (-627.907) (-627.219) (-625.469) -- 0:00:24
598500 -- [-627.175] (-629.829) (-627.043) (-626.393) * (-626.521) [-625.312] (-626.360) (-625.670) -- 0:00:24
599000 -- (-627.117) (-629.773) [-625.107] (-626.904) * (-626.415) [-624.741] (-630.087) (-626.444) -- 0:00:24
599500 -- (-625.932) [-626.013] (-627.115) (-627.983) * [-625.435] (-624.590) (-627.461) (-628.179) -- 0:00:24
600000 -- [-627.200] (-627.453) (-627.308) (-626.373) * [-626.529] (-626.629) (-626.844) (-627.514) -- 0:00:24
Average standard deviation of split frequencies: 0.006555
600500 -- (-625.325) (-626.780) [-626.895] (-628.129) * (-625.519) [-626.675] (-625.622) (-630.191) -- 0:00:24
601000 -- (-628.657) (-627.517) [-625.072] (-627.407) * (-625.214) (-626.688) (-629.832) [-626.249] -- 0:00:24
601500 -- [-629.660] (-626.298) (-626.093) (-626.315) * (-627.955) (-626.780) [-628.223] (-624.934) -- 0:00:24
602000 -- (-628.449) (-626.326) [-628.566] (-626.906) * (-627.297) (-627.295) (-627.344) [-625.790] -- 0:00:24
602500 -- [-625.732] (-625.337) (-628.525) (-625.842) * (-625.414) [-626.200] (-629.997) (-625.036) -- 0:00:24
603000 -- [-626.310] (-628.212) (-625.659) (-626.158) * [-628.681] (-626.517) (-626.693) (-625.893) -- 0:00:24
603500 -- (-631.985) (-627.051) (-626.739) [-625.060] * (-630.332) (-628.573) (-629.694) [-625.398] -- 0:00:24
604000 -- (-625.866) (-626.942) (-626.571) [-628.250] * [-626.297] (-629.328) (-627.255) (-629.537) -- 0:00:24
604500 -- (-627.369) (-629.710) [-625.969] (-626.021) * (-627.280) (-625.768) [-625.118] (-626.148) -- 0:00:24
605000 -- [-625.321] (-625.582) (-624.777) (-625.330) * [-626.734] (-628.430) (-625.250) (-625.352) -- 0:00:24
Average standard deviation of split frequencies: 0.006543
605500 -- [-624.902] (-626.758) (-626.591) (-626.788) * (-627.495) (-627.147) [-628.429] (-628.708) -- 0:00:24
606000 -- (-626.819) [-628.076] (-625.389) (-626.616) * [-626.730] (-628.925) (-628.667) (-625.536) -- 0:00:24
606500 -- [-629.467] (-632.950) (-626.978) (-627.288) * (-626.457) (-627.172) [-627.163] (-627.098) -- 0:00:24
607000 -- (-630.090) (-628.239) (-624.591) [-626.344] * (-626.282) [-627.847] (-630.407) (-628.279) -- 0:00:23
607500 -- (-630.516) (-628.062) (-632.238) [-625.807] * (-626.010) (-625.874) (-626.523) [-629.976] -- 0:00:23
608000 -- (-627.741) [-626.006] (-630.186) (-625.505) * (-626.473) (-627.085) [-626.339] (-630.130) -- 0:00:23
608500 -- (-629.083) (-627.504) (-626.965) [-627.229] * [-626.149] (-626.501) (-626.347) (-626.824) -- 0:00:23
609000 -- (-627.638) [-627.148] (-627.814) (-627.822) * [-629.205] (-626.468) (-628.753) (-625.491) -- 0:00:23
609500 -- [-629.165] (-628.291) (-627.977) (-627.546) * (-625.692) [-627.567] (-625.793) (-627.791) -- 0:00:23
610000 -- (-626.483) [-625.795] (-629.477) (-629.282) * (-626.087) (-626.637) (-627.851) [-625.831] -- 0:00:23
Average standard deviation of split frequencies: 0.006721
610500 -- (-629.280) (-629.947) [-626.419] (-630.342) * (-631.653) [-625.799] (-631.994) (-629.425) -- 0:00:24
611000 -- [-627.969] (-624.999) (-627.604) (-628.608) * (-626.612) (-627.774) (-627.173) [-626.111] -- 0:00:24
611500 -- (-626.476) (-625.664) (-626.743) [-627.914] * [-625.964] (-627.293) (-625.249) (-626.382) -- 0:00:24
612000 -- (-626.357) (-625.769) [-630.964] (-625.312) * [-625.537] (-626.177) (-624.895) (-626.558) -- 0:00:24
612500 -- (-629.462) (-625.212) (-627.981) [-624.843] * (-629.478) (-632.675) [-625.096] (-626.830) -- 0:00:24
613000 -- [-626.241] (-628.748) (-626.618) (-627.625) * (-631.417) (-631.639) [-626.038] (-627.808) -- 0:00:23
613500 -- (-626.422) [-625.930] (-625.221) (-627.753) * (-630.650) (-632.316) [-628.838] (-627.751) -- 0:00:23
614000 -- [-626.252] (-625.692) (-626.343) (-627.319) * [-627.978] (-625.539) (-626.769) (-629.592) -- 0:00:23
614500 -- (-627.134) (-626.098) (-629.427) [-627.199] * (-630.420) [-626.150] (-625.135) (-629.490) -- 0:00:23
615000 -- (-626.595) (-629.011) [-625.020] (-626.550) * (-626.996) (-626.544) [-626.304] (-628.293) -- 0:00:23
Average standard deviation of split frequencies: 0.007022
615500 -- (-629.293) [-626.605] (-633.455) (-625.036) * (-626.070) (-625.344) (-629.060) [-626.165] -- 0:00:23
616000 -- [-626.849] (-627.574) (-626.237) (-625.639) * (-629.794) (-627.393) (-632.938) [-625.840] -- 0:00:23
616500 -- (-624.988) (-626.065) [-626.498] (-625.608) * (-625.918) (-625.395) [-625.740] (-627.127) -- 0:00:23
617000 -- (-626.694) (-628.137) (-625.774) [-626.926] * [-626.163] (-629.520) (-627.597) (-625.778) -- 0:00:23
617500 -- (-625.953) [-626.940] (-626.460) (-628.653) * (-625.962) (-628.008) [-625.289] (-630.376) -- 0:00:23
618000 -- (-625.777) [-625.887] (-625.067) (-629.100) * (-626.017) (-628.420) (-627.657) [-628.507] -- 0:00:23
618500 -- [-626.396] (-627.916) (-624.702) (-631.057) * [-627.322] (-628.072) (-629.229) (-632.157) -- 0:00:23
619000 -- [-625.526] (-626.404) (-624.978) (-628.161) * (-627.058) [-625.562] (-625.447) (-626.679) -- 0:00:23
619500 -- [-626.914] (-626.598) (-626.658) (-625.498) * [-627.558] (-629.186) (-631.916) (-625.255) -- 0:00:23
620000 -- (-629.058) (-628.712) [-624.792] (-626.715) * [-625.500] (-628.408) (-624.999) (-625.523) -- 0:00:23
Average standard deviation of split frequencies: 0.007372
620500 -- [-626.603] (-626.068) (-627.928) (-631.456) * (-628.400) [-632.463] (-625.193) (-629.493) -- 0:00:23
621000 -- (-626.526) (-625.144) (-629.031) [-626.772] * [-625.835] (-626.839) (-625.211) (-626.638) -- 0:00:23
621500 -- (-627.103) (-630.256) (-629.170) [-626.396] * (-626.571) [-628.359] (-624.945) (-627.087) -- 0:00:23
622000 -- [-626.143] (-631.692) (-629.870) (-626.391) * (-632.186) [-627.023] (-625.733) (-627.853) -- 0:00:23
622500 -- [-626.205] (-626.818) (-630.252) (-627.510) * (-627.861) [-627.513] (-628.034) (-626.878) -- 0:00:23
623000 -- (-629.295) (-627.373) (-630.526) [-627.310] * (-626.306) [-624.756] (-630.245) (-625.289) -- 0:00:23
623500 -- (-625.866) [-625.995] (-626.671) (-628.539) * (-626.317) (-624.783) [-628.481] (-627.227) -- 0:00:23
624000 -- (-625.215) [-624.882] (-625.671) (-626.923) * (-626.423) [-626.648] (-625.546) (-625.120) -- 0:00:23
624500 -- (-627.094) (-625.851) [-626.101] (-627.392) * (-634.179) (-628.072) [-625.730] (-626.717) -- 0:00:23
625000 -- [-625.614] (-625.146) (-627.247) (-627.346) * (-627.186) (-627.014) [-628.629] (-625.482) -- 0:00:23
Average standard deviation of split frequencies: 0.007865
625500 -- (-632.549) (-633.464) [-625.486] (-626.713) * (-627.506) (-625.873) (-626.232) [-629.299] -- 0:00:23
626000 -- (-626.994) (-626.994) (-625.877) [-625.755] * [-625.350] (-628.012) (-626.245) (-625.017) -- 0:00:23
626500 -- [-626.296] (-625.487) (-625.188) (-628.036) * [-628.484] (-631.950) (-627.920) (-625.206) -- 0:00:23
627000 -- (-627.337) (-626.276) [-627.035] (-626.255) * (-627.997) (-629.807) [-626.802] (-629.258) -- 0:00:23
627500 -- (-626.077) (-626.552) (-626.369) [-625.027] * [-628.317] (-628.777) (-626.690) (-626.659) -- 0:00:23
628000 -- (-626.557) [-627.516] (-629.319) (-624.665) * (-627.245) (-630.379) (-628.827) [-627.601] -- 0:00:23
628500 -- [-628.890] (-629.094) (-633.759) (-625.102) * [-628.066] (-625.771) (-629.004) (-625.115) -- 0:00:23
629000 -- (-628.283) [-626.146] (-632.702) (-625.761) * (-629.473) (-625.515) (-628.041) [-630.260] -- 0:00:23
629500 -- [-625.555] (-625.920) (-626.974) (-626.850) * (-627.101) [-625.063] (-627.332) (-625.118) -- 0:00:22
630000 -- (-626.996) [-625.515] (-625.603) (-628.985) * (-630.131) (-628.012) (-626.856) [-629.804] -- 0:00:22
Average standard deviation of split frequencies: 0.007641
630500 -- (-626.373) [-628.195] (-628.461) (-629.428) * (-628.028) (-630.201) (-628.593) [-628.039] -- 0:00:22
631000 -- (-630.388) [-625.395] (-627.768) (-628.717) * (-630.643) (-626.721) (-625.898) [-626.662] -- 0:00:22
631500 -- (-633.292) (-626.179) [-626.097] (-626.405) * [-629.595] (-625.456) (-628.368) (-625.219) -- 0:00:22
632000 -- (-630.496) [-627.140] (-626.657) (-627.910) * (-626.912) [-628.652] (-627.804) (-625.409) -- 0:00:22
632500 -- (-626.118) [-629.474] (-625.859) (-625.955) * (-629.718) (-631.126) (-627.847) [-625.464] -- 0:00:22
633000 -- [-625.770] (-626.420) (-626.583) (-627.748) * [-627.798] (-628.444) (-626.805) (-628.695) -- 0:00:22
633500 -- (-628.846) (-627.835) (-629.741) [-629.283] * (-626.990) (-626.401) [-628.583] (-625.475) -- 0:00:22
634000 -- (-629.191) (-627.183) (-627.593) [-625.427] * [-624.540] (-628.617) (-629.404) (-628.621) -- 0:00:22
634500 -- (-629.177) [-627.186] (-625.983) (-631.159) * (-626.973) (-626.657) [-624.985] (-628.198) -- 0:00:22
635000 -- (-627.121) (-625.074) (-625.480) [-625.667] * (-627.196) [-625.170] (-626.989) (-626.340) -- 0:00:22
Average standard deviation of split frequencies: 0.007206
635500 -- (-625.080) (-627.536) (-626.337) [-625.378] * [-626.474] (-626.014) (-626.897) (-625.530) -- 0:00:22
636000 -- (-627.487) (-627.836) [-625.777] (-626.375) * [-624.903] (-629.392) (-627.199) (-626.847) -- 0:00:22
636500 -- (-626.861) (-627.188) [-625.653] (-625.585) * (-625.259) (-628.108) (-629.660) [-625.705] -- 0:00:22
637000 -- (-625.778) (-626.941) (-625.678) [-625.409] * [-627.415] (-625.388) (-626.205) (-625.517) -- 0:00:22
637500 -- (-627.663) [-627.388] (-629.322) (-627.492) * (-625.094) (-627.605) [-625.611] (-626.561) -- 0:00:22
638000 -- (-627.278) (-627.373) [-628.804] (-630.185) * (-629.378) (-627.911) [-625.306] (-627.689) -- 0:00:22
638500 -- (-627.086) (-627.691) (-632.099) [-626.988] * [-630.538] (-626.209) (-625.371) (-626.601) -- 0:00:22
639000 -- (-625.987) (-626.963) [-627.427] (-628.263) * (-625.761) (-627.214) [-625.347] (-627.532) -- 0:00:22
639500 -- [-626.491] (-627.354) (-626.128) (-627.642) * (-627.087) (-627.208) (-627.174) [-626.358] -- 0:00:22
640000 -- [-628.382] (-626.532) (-625.575) (-628.273) * [-625.328] (-626.556) (-625.705) (-624.974) -- 0:00:22
Average standard deviation of split frequencies: 0.006709
640500 -- [-626.103] (-626.379) (-625.498) (-625.778) * (-627.320) [-629.386] (-625.864) (-625.466) -- 0:00:22
641000 -- (-627.147) [-625.499] (-628.000) (-626.534) * (-628.582) (-630.057) (-626.202) [-627.965] -- 0:00:22
641500 -- (-626.034) (-631.917) [-629.194] (-626.981) * (-630.089) (-632.076) [-625.405] (-634.313) -- 0:00:22
642000 -- (-627.620) (-628.622) [-628.633] (-628.925) * (-626.939) (-630.521) [-626.364] (-626.002) -- 0:00:22
642500 -- (-626.905) (-628.851) [-629.783] (-626.721) * (-629.463) (-627.606) [-625.755] (-626.951) -- 0:00:22
643000 -- (-625.674) [-626.811] (-626.338) (-626.002) * [-626.725] (-626.420) (-627.248) (-628.320) -- 0:00:22
643500 -- [-625.276] (-625.109) (-625.721) (-626.648) * (-630.341) (-626.997) (-627.470) [-626.114] -- 0:00:22
644000 -- (-625.886) (-625.995) (-629.351) [-627.159] * (-626.978) (-624.887) (-628.871) [-626.642] -- 0:00:22
644500 -- [-628.871] (-626.337) (-629.409) (-626.499) * (-630.933) [-625.001] (-630.249) (-625.984) -- 0:00:22
645000 -- [-625.669] (-630.307) (-630.381) (-626.235) * [-626.466] (-625.486) (-628.173) (-627.244) -- 0:00:22
Average standard deviation of split frequencies: 0.007083
645500 -- [-626.239] (-628.201) (-628.282) (-626.210) * (-628.180) (-627.229) (-628.016) [-625.834] -- 0:00:21
646000 -- [-626.869] (-627.611) (-629.522) (-632.632) * (-627.294) (-627.987) [-625.802] (-625.460) -- 0:00:21
646500 -- (-627.913) (-625.443) [-626.919] (-627.941) * (-626.573) [-625.563] (-624.663) (-625.530) -- 0:00:21
647000 -- [-625.754] (-625.876) (-627.059) (-626.241) * (-627.889) (-629.096) [-624.663] (-627.155) -- 0:00:21
647500 -- (-625.839) [-625.947] (-626.973) (-625.840) * [-628.827] (-628.320) (-626.044) (-625.416) -- 0:00:21
648000 -- [-625.553] (-628.301) (-626.928) (-627.662) * (-630.852) (-625.564) [-628.714] (-625.715) -- 0:00:22
648500 -- (-627.126) (-626.585) (-625.877) [-628.474] * (-627.773) (-625.420) [-626.155] (-626.603) -- 0:00:22
649000 -- (-627.018) (-626.201) (-625.427) [-625.889] * (-627.776) (-626.591) (-628.921) [-627.051] -- 0:00:22
649500 -- (-627.227) (-630.287) [-625.348] (-626.788) * [-627.539] (-631.818) (-628.991) (-627.006) -- 0:00:22
650000 -- (-626.115) [-626.769] (-625.351) (-626.015) * (-628.369) [-625.907] (-627.530) (-626.812) -- 0:00:22
Average standard deviation of split frequencies: 0.006606
650500 -- [-626.484] (-628.504) (-630.965) (-631.350) * (-626.080) (-632.097) (-625.992) [-626.112] -- 0:00:22
651000 -- (-631.124) [-626.971] (-626.591) (-631.963) * (-624.965) [-626.402] (-626.672) (-627.445) -- 0:00:21
651500 -- (-625.766) [-626.155] (-626.746) (-629.655) * (-625.489) (-626.517) (-625.867) [-626.871] -- 0:00:21
652000 -- (-626.528) (-626.976) (-627.053) [-627.084] * [-626.498] (-627.179) (-629.433) (-625.662) -- 0:00:21
652500 -- (-627.290) (-625.234) (-627.449) [-626.895] * (-629.484) [-626.343] (-630.032) (-625.749) -- 0:00:21
653000 -- (-627.679) (-626.809) (-627.560) [-625.741] * (-625.124) (-630.452) (-627.430) [-625.745] -- 0:00:21
653500 -- (-629.792) (-625.398) [-626.488] (-625.489) * (-630.777) [-625.813] (-625.876) (-626.915) -- 0:00:21
654000 -- (-629.616) (-631.591) (-626.006) [-627.489] * (-626.844) [-626.531] (-626.378) (-626.798) -- 0:00:21
654500 -- [-625.393] (-631.005) (-626.360) (-632.131) * (-626.564) [-625.352] (-629.102) (-625.194) -- 0:00:21
655000 -- (-627.174) (-625.348) (-628.649) [-625.178] * (-626.840) (-626.478) (-629.771) [-625.514] -- 0:00:21
Average standard deviation of split frequencies: 0.006975
655500 -- (-626.931) [-625.889] (-626.157) (-625.581) * (-625.222) (-626.665) [-627.817] (-627.967) -- 0:00:21
656000 -- (-629.965) [-625.638] (-625.354) (-625.496) * [-625.205] (-627.132) (-625.776) (-626.451) -- 0:00:21
656500 -- (-628.641) (-629.183) [-625.405] (-629.727) * (-627.920) [-627.182] (-628.529) (-626.925) -- 0:00:21
657000 -- (-625.137) (-628.270) [-626.896] (-630.694) * (-627.557) (-626.657) (-625.273) [-626.536] -- 0:00:21
657500 -- (-625.025) (-629.108) (-629.066) [-628.934] * [-626.722] (-626.172) (-625.201) (-627.746) -- 0:00:21
658000 -- (-625.835) (-627.481) [-628.285] (-626.370) * (-626.813) [-625.583] (-625.033) (-625.836) -- 0:00:21
658500 -- (-626.373) (-627.591) [-627.287] (-626.909) * [-626.047] (-626.175) (-629.152) (-627.979) -- 0:00:21
659000 -- (-628.990) (-627.494) (-625.219) [-625.401] * (-626.477) [-626.271] (-626.091) (-625.162) -- 0:00:21
659500 -- [-627.513] (-627.777) (-624.984) (-631.787) * [-625.020] (-628.050) (-627.376) (-624.752) -- 0:00:21
660000 -- (-629.547) [-626.673] (-627.943) (-626.796) * (-627.884) (-633.115) [-625.549] (-625.920) -- 0:00:21
Average standard deviation of split frequencies: 0.006254
660500 -- [-625.794] (-629.115) (-626.407) (-625.712) * [-626.958] (-631.446) (-625.377) (-628.281) -- 0:00:21
661000 -- [-626.098] (-625.506) (-626.886) (-626.795) * (-627.971) [-626.807] (-626.591) (-626.489) -- 0:00:21
661500 -- [-627.294] (-626.217) (-628.777) (-626.828) * [-629.824] (-627.845) (-627.348) (-625.396) -- 0:00:21
662000 -- (-625.578) (-626.967) [-627.433] (-627.398) * (-630.064) (-626.589) [-626.589] (-625.557) -- 0:00:21
662500 -- [-625.635] (-628.719) (-627.686) (-625.789) * [-627.229] (-631.990) (-628.277) (-625.201) -- 0:00:21
663000 -- (-625.734) [-629.713] (-632.604) (-625.624) * (-625.378) [-626.207] (-626.770) (-626.284) -- 0:00:21
663500 -- (-633.850) (-626.740) [-626.688] (-627.539) * (-625.528) [-626.527] (-625.752) (-630.683) -- 0:00:21
664000 -- (-627.443) (-628.120) [-628.208] (-627.320) * (-629.457) (-630.720) (-626.893) [-626.749] -- 0:00:21
664500 -- (-626.304) [-629.076] (-628.060) (-625.191) * (-626.790) (-631.076) (-626.861) [-628.363] -- 0:00:21
665000 -- (-629.198) (-626.526) (-626.412) [-626.120] * (-627.282) (-629.190) (-625.747) [-627.943] -- 0:00:21
Average standard deviation of split frequencies: 0.006745
665500 -- [-626.939] (-625.595) (-625.293) (-625.189) * (-628.094) (-626.719) [-629.681] (-625.609) -- 0:00:21
666000 -- (-628.409) (-628.915) (-625.438) [-626.457] * [-626.353] (-629.744) (-630.050) (-632.159) -- 0:00:21
666500 -- (-632.262) (-631.085) [-627.058] (-625.965) * (-625.763) (-626.214) [-626.653] (-627.108) -- 0:00:21
667000 -- (-627.035) (-626.585) (-628.848) [-625.830] * [-625.980] (-626.802) (-627.067) (-626.276) -- 0:00:20
667500 -- (-626.319) [-627.595] (-626.915) (-626.301) * [-627.969] (-626.823) (-627.080) (-625.968) -- 0:00:20
668000 -- (-626.048) (-628.628) [-625.636] (-627.075) * (-625.159) [-626.621] (-626.659) (-625.975) -- 0:00:20
668500 -- (-628.242) (-628.061) [-626.236] (-626.098) * (-625.261) (-628.176) (-626.028) [-625.316] -- 0:00:20
669000 -- [-626.488] (-627.698) (-626.854) (-629.156) * (-631.527) (-631.780) [-626.419] (-625.293) -- 0:00:20
669500 -- [-625.526] (-630.868) (-628.548) (-629.970) * (-626.663) [-627.128] (-626.834) (-627.357) -- 0:00:20
670000 -- (-625.879) [-626.202] (-627.349) (-629.767) * [-626.415] (-626.847) (-626.209) (-628.031) -- 0:00:20
Average standard deviation of split frequencies: 0.006615
670500 -- (-627.727) (-627.270) [-626.495] (-629.278) * [-629.462] (-628.245) (-626.179) (-631.357) -- 0:00:20
671000 -- (-626.051) (-628.965) (-628.844) [-629.404] * [-628.739] (-625.967) (-627.863) (-630.481) -- 0:00:20
671500 -- [-627.963] (-626.913) (-627.057) (-628.236) * (-628.231) [-624.764] (-627.283) (-625.948) -- 0:00:20
672000 -- (-626.910) (-626.097) (-626.341) [-626.776] * (-625.082) [-626.323] (-630.674) (-625.774) -- 0:00:20
672500 -- (-626.666) [-625.015] (-625.358) (-628.381) * (-625.137) (-626.524) [-628.961] (-625.655) -- 0:00:20
673000 -- (-628.960) [-629.190] (-627.785) (-627.295) * (-625.576) (-627.345) [-627.931] (-625.581) -- 0:00:20
673500 -- (-625.362) (-626.376) [-624.993] (-626.701) * (-624.821) (-626.569) [-627.315] (-624.931) -- 0:00:20
674000 -- (-626.815) (-626.321) (-626.778) [-625.488] * (-625.889) (-626.382) (-626.489) [-627.698] -- 0:00:20
674500 -- (-632.836) (-625.760) [-625.921] (-627.119) * (-627.069) (-629.699) [-625.420] (-626.252) -- 0:00:20
675000 -- (-631.965) (-627.489) (-627.662) [-626.908] * (-627.658) (-630.021) [-625.596] (-627.746) -- 0:00:20
Average standard deviation of split frequencies: 0.006973
675500 -- (-626.006) (-625.895) (-626.270) [-625.535] * (-626.738) (-628.335) (-625.298) [-626.700] -- 0:00:20
676000 -- (-629.745) [-626.844] (-626.002) (-626.251) * (-630.546) (-627.330) (-626.112) [-627.645] -- 0:00:20
676500 -- (-627.756) [-624.928] (-625.931) (-625.757) * (-632.979) (-626.716) (-625.304) [-628.816] -- 0:00:20
677000 -- [-627.144] (-626.209) (-626.920) (-625.947) * (-628.510) [-626.674] (-629.318) (-624.952) -- 0:00:20
677500 -- (-625.924) (-626.208) [-626.457] (-625.088) * (-628.967) [-625.740] (-629.764) (-625.067) -- 0:00:20
678000 -- (-625.944) (-629.126) [-625.187] (-627.497) * (-628.823) (-629.632) [-628.547] (-627.916) -- 0:00:20
678500 -- (-626.233) (-629.419) (-628.885) [-625.371] * (-628.742) (-631.112) [-626.818] (-625.506) -- 0:00:20
679000 -- (-625.290) [-628.105] (-626.986) (-625.567) * (-625.180) (-625.843) [-632.061] (-625.310) -- 0:00:20
679500 -- (-625.334) (-626.784) (-627.388) [-626.105] * (-626.783) (-628.398) [-625.144] (-628.884) -- 0:00:20
680000 -- (-625.652) (-630.769) (-630.577) [-624.947] * (-627.390) (-627.789) (-627.500) [-626.561] -- 0:00:20
Average standard deviation of split frequencies: 0.006478
680500 -- (-630.128) (-629.521) (-627.576) [-628.014] * (-625.953) (-626.596) (-625.288) [-628.100] -- 0:00:20
681000 -- (-630.047) [-626.116] (-626.251) (-627.865) * (-630.260) [-627.212] (-627.262) (-628.236) -- 0:00:20
681500 -- [-628.537] (-627.381) (-625.943) (-626.146) * (-626.570) [-626.720] (-628.330) (-628.968) -- 0:00:20
682000 -- (-625.425) [-628.329] (-629.811) (-627.082) * [-626.564] (-627.668) (-625.651) (-625.633) -- 0:00:20
682500 -- (-626.779) (-628.391) (-627.223) [-625.061] * [-629.618] (-626.260) (-626.643) (-625.005) -- 0:00:20
683000 -- (-629.302) [-625.453] (-627.221) (-628.009) * (-626.215) [-626.077] (-629.358) (-626.639) -- 0:00:19
683500 -- (-626.847) (-628.174) [-627.967] (-626.550) * (-626.325) (-626.405) [-629.461] (-625.829) -- 0:00:19
684000 -- (-627.754) (-626.045) [-625.810] (-626.297) * [-632.594] (-628.442) (-626.685) (-626.173) -- 0:00:19
684500 -- (-625.455) (-626.325) [-625.668] (-625.142) * [-630.812] (-629.701) (-627.331) (-625.562) -- 0:00:19
685000 -- (-626.346) (-625.235) (-625.211) [-625.777] * (-627.775) (-628.549) (-626.048) [-626.243] -- 0:00:19
Average standard deviation of split frequencies: 0.006831
685500 -- (-627.703) (-625.441) [-628.274] (-626.684) * (-627.160) (-633.489) [-626.034] (-625.196) -- 0:00:19
686000 -- (-631.415) (-630.705) [-625.412] (-625.805) * [-626.390] (-630.741) (-627.517) (-625.114) -- 0:00:20
686500 -- [-625.887] (-627.741) (-625.887) (-625.624) * [-625.508] (-626.597) (-626.982) (-626.780) -- 0:00:20
687000 -- (-625.567) [-627.714] (-628.869) (-626.745) * (-628.369) [-626.920] (-630.765) (-625.671) -- 0:00:20
687500 -- [-629.117] (-626.789) (-627.356) (-627.569) * (-628.101) (-630.266) (-627.086) [-626.393] -- 0:00:20
688000 -- [-628.259] (-628.516) (-625.526) (-626.715) * (-629.486) (-628.222) (-629.102) [-626.722] -- 0:00:19
688500 -- (-627.333) (-627.572) [-627.171] (-625.633) * (-633.387) (-625.806) [-628.145] (-628.497) -- 0:00:19
689000 -- (-627.083) (-626.994) [-626.294] (-626.908) * (-626.937) [-626.040] (-625.673) (-627.921) -- 0:00:19
689500 -- (-626.586) (-625.804) [-625.210] (-627.800) * (-628.164) (-626.751) (-626.278) [-624.692] -- 0:00:19
690000 -- [-627.137] (-628.008) (-625.889) (-633.234) * (-626.898) [-627.949] (-626.981) (-626.904) -- 0:00:19
Average standard deviation of split frequencies: 0.006825
690500 -- [-627.890] (-626.918) (-631.895) (-629.124) * (-626.465) (-625.289) (-626.431) [-625.769] -- 0:00:19
691000 -- (-626.040) [-625.891] (-629.394) (-627.438) * [-625.102] (-626.200) (-625.444) (-627.367) -- 0:00:19
691500 -- (-625.785) [-631.054] (-626.867) (-626.348) * (-625.715) (-627.502) [-629.632] (-633.188) -- 0:00:19
692000 -- (-626.810) [-627.150] (-630.708) (-626.895) * (-626.217) (-625.862) (-624.925) [-630.010] -- 0:00:19
692500 -- (-628.480) (-626.694) (-629.061) [-626.604] * (-629.718) [-625.355] (-627.498) (-625.965) -- 0:00:19
693000 -- [-626.112] (-628.530) (-632.417) (-630.578) * (-628.517) [-624.636] (-628.748) (-625.476) -- 0:00:19
693500 -- [-628.944] (-625.155) (-629.797) (-625.785) * (-628.572) (-625.186) [-624.725] (-624.978) -- 0:00:19
694000 -- (-627.951) (-626.353) (-629.757) [-626.032] * (-626.002) [-625.001] (-628.044) (-626.655) -- 0:00:19
694500 -- [-625.023] (-628.457) (-628.640) (-625.535) * (-629.066) (-629.685) (-627.464) [-628.429] -- 0:00:19
695000 -- [-625.971] (-628.017) (-628.575) (-626.012) * (-625.074) (-627.035) (-625.935) [-625.755] -- 0:00:19
Average standard deviation of split frequencies: 0.006773
695500 -- (-628.336) (-628.584) (-626.663) [-626.058] * (-628.427) (-626.083) (-626.035) [-628.121] -- 0:00:19
696000 -- (-626.661) (-629.960) [-625.671] (-628.938) * (-626.057) [-625.495] (-625.150) (-635.359) -- 0:00:19
696500 -- (-627.498) (-629.194) [-626.289] (-628.836) * (-629.772) [-626.255] (-627.194) (-630.351) -- 0:00:19
697000 -- (-625.573) (-628.155) [-625.455] (-627.850) * (-625.149) [-625.467] (-625.671) (-627.453) -- 0:00:19
697500 -- (-626.020) (-625.322) [-626.197] (-627.360) * [-625.845] (-627.191) (-627.208) (-625.249) -- 0:00:19
698000 -- (-627.632) [-625.335] (-625.666) (-628.057) * [-628.988] (-627.962) (-630.879) (-625.884) -- 0:00:19
698500 -- [-625.525] (-625.226) (-625.963) (-628.527) * [-625.758] (-626.078) (-626.177) (-625.385) -- 0:00:19
699000 -- (-627.353) (-627.810) (-627.870) [-626.686] * (-626.370) [-626.596] (-629.486) (-627.502) -- 0:00:19
699500 -- [-631.165] (-626.588) (-628.926) (-626.593) * (-626.706) (-628.201) (-627.016) [-626.797] -- 0:00:19
700000 -- (-627.621) [-630.401] (-625.359) (-627.318) * (-629.884) (-627.033) [-626.353] (-625.329) -- 0:00:19
Average standard deviation of split frequencies: 0.006372
700500 -- (-625.351) (-626.401) (-628.639) [-628.665] * (-628.717) (-626.709) [-626.398] (-625.120) -- 0:00:19
701000 -- (-628.273) [-627.610] (-628.642) (-626.351) * (-628.441) (-628.143) (-626.256) [-626.469] -- 0:00:19
701500 -- (-626.601) [-626.407] (-625.375) (-626.847) * (-626.005) [-626.362] (-631.799) (-626.891) -- 0:00:19
702000 -- (-627.906) (-626.510) (-626.118) [-628.068] * (-626.350) (-626.149) [-628.463] (-626.537) -- 0:00:19
702500 -- [-627.713] (-630.638) (-627.118) (-626.731) * [-626.615] (-629.017) (-631.087) (-626.852) -- 0:00:19
703000 -- [-626.964] (-629.813) (-629.350) (-626.371) * (-625.702) (-626.817) (-626.816) [-625.314] -- 0:00:19
703500 -- (-627.578) (-632.254) (-626.529) [-625.837] * (-627.664) (-628.085) [-625.256] (-626.414) -- 0:00:18
704000 -- (-628.472) (-626.504) (-628.461) [-625.001] * (-627.234) [-624.944] (-626.362) (-626.595) -- 0:00:18
704500 -- (-629.285) (-625.688) (-626.876) [-625.313] * [-626.954] (-625.949) (-627.374) (-626.188) -- 0:00:18
705000 -- (-627.294) (-629.721) [-625.907] (-625.370) * (-626.912) (-628.149) [-625.885] (-625.859) -- 0:00:18
Average standard deviation of split frequencies: 0.006520
705500 -- (-627.679) [-627.442] (-627.418) (-629.325) * [-627.392] (-626.541) (-626.768) (-629.156) -- 0:00:18
706000 -- (-629.728) (-628.137) (-626.591) [-626.759] * (-626.667) [-628.587] (-626.230) (-628.738) -- 0:00:18
706500 -- (-627.360) (-627.574) [-627.409] (-630.230) * (-631.785) (-625.833) [-628.563] (-626.162) -- 0:00:18
707000 -- [-627.037] (-625.939) (-625.731) (-624.674) * [-629.569] (-625.062) (-628.570) (-626.001) -- 0:00:18
707500 -- [-627.524] (-626.975) (-627.256) (-624.907) * [-630.164] (-625.029) (-625.658) (-625.259) -- 0:00:18
708000 -- (-628.160) (-627.324) [-625.710] (-626.330) * (-626.389) (-625.720) [-627.714] (-633.414) -- 0:00:18
708500 -- (-628.205) (-627.289) (-627.105) [-626.969] * (-626.096) (-626.513) (-627.229) [-625.392] -- 0:00:18
709000 -- [-627.356] (-626.054) (-625.532) (-628.989) * (-626.811) [-628.437] (-625.858) (-628.281) -- 0:00:18
709500 -- (-628.498) [-626.228] (-628.703) (-628.847) * [-625.789] (-627.398) (-626.150) (-627.929) -- 0:00:18
710000 -- (-627.632) (-625.956) [-625.634] (-626.558) * (-628.109) (-629.777) [-628.534] (-624.886) -- 0:00:18
Average standard deviation of split frequencies: 0.006126
710500 -- [-626.754] (-626.835) (-625.082) (-627.790) * (-625.363) (-627.832) (-627.037) [-624.822] -- 0:00:18
711000 -- (-633.160) (-626.149) [-625.631] (-627.523) * (-625.916) (-626.429) (-628.367) [-631.418] -- 0:00:18
711500 -- (-630.986) (-626.955) (-630.713) [-625.774] * (-627.087) (-626.277) (-627.569) [-626.915] -- 0:00:18
712000 -- (-628.586) (-628.815) (-628.135) [-627.453] * [-626.603] (-627.946) (-626.826) (-630.176) -- 0:00:18
712500 -- (-628.164) (-625.993) (-628.104) [-628.530] * (-625.217) (-625.127) [-629.807] (-625.711) -- 0:00:18
713000 -- (-628.052) [-625.678] (-631.238) (-626.742) * (-627.817) [-626.830] (-627.290) (-625.537) -- 0:00:18
713500 -- [-625.092] (-631.563) (-626.602) (-628.839) * (-629.676) (-629.173) (-629.690) [-626.850] -- 0:00:18
714000 -- (-626.835) (-625.541) (-625.739) [-625.416] * (-626.683) (-627.711) (-626.082) [-626.580] -- 0:00:18
714500 -- (-626.444) (-625.630) (-631.955) [-627.292] * (-626.699) (-627.648) (-626.688) [-626.010] -- 0:00:18
715000 -- (-625.802) [-626.235] (-628.278) (-625.766) * (-626.384) (-631.673) (-630.178) [-626.038] -- 0:00:18
Average standard deviation of split frequencies: 0.006778
715500 -- (-626.339) (-625.597) (-626.365) [-627.124] * [-627.804] (-627.765) (-625.713) (-627.902) -- 0:00:18
716000 -- (-626.266) (-627.311) [-627.865] (-631.013) * (-629.237) (-629.003) (-625.960) [-628.583] -- 0:00:18
716500 -- (-627.832) (-625.379) (-627.061) [-627.416] * (-627.432) (-627.199) (-625.380) [-626.029] -- 0:00:18
717000 -- (-631.470) (-626.344) [-629.543] (-625.209) * (-626.352) [-627.255] (-627.763) (-628.115) -- 0:00:18
717500 -- (-626.231) (-626.210) [-626.914] (-627.429) * (-627.608) (-631.107) [-627.429] (-626.525) -- 0:00:18
718000 -- [-626.058] (-626.302) (-626.890) (-628.218) * (-625.950) [-627.361] (-624.911) (-629.649) -- 0:00:18
718500 -- (-625.558) (-626.564) [-626.475] (-628.409) * (-628.627) (-625.755) [-625.827] (-626.445) -- 0:00:18
719000 -- [-628.078] (-629.453) (-628.859) (-629.384) * (-626.338) (-626.696) (-627.536) [-629.838] -- 0:00:17
719500 -- (-627.431) [-628.729] (-625.529) (-627.828) * (-625.140) [-626.188] (-626.212) (-626.755) -- 0:00:17
720000 -- [-627.468] (-633.203) (-629.538) (-626.356) * (-627.283) [-626.863] (-625.051) (-629.187) -- 0:00:17
Average standard deviation of split frequencies: 0.006618
720500 -- (-625.671) (-625.384) (-629.556) [-625.814] * (-626.508) (-626.003) [-626.792] (-626.750) -- 0:00:17
721000 -- (-625.569) (-629.262) [-625.324] (-628.068) * (-626.918) (-628.968) (-630.462) [-625.229] -- 0:00:17
721500 -- [-625.123] (-626.725) (-631.026) (-625.737) * (-625.530) (-629.866) [-627.136] (-625.971) -- 0:00:17
722000 -- (-627.872) [-627.368] (-626.163) (-627.509) * (-627.450) (-629.219) [-625.572] (-625.647) -- 0:00:17
722500 -- [-624.944] (-628.349) (-626.540) (-627.191) * (-624.912) (-626.141) (-625.493) [-625.331] -- 0:00:17
723000 -- [-625.878] (-627.367) (-626.753) (-629.950) * (-624.870) (-627.029) [-626.330] (-628.362) -- 0:00:17
723500 -- (-625.781) (-627.135) (-629.391) [-630.990] * (-626.891) (-629.909) [-626.728] (-626.707) -- 0:00:17
724000 -- (-627.173) (-626.831) [-626.689] (-628.753) * (-625.501) (-629.699) [-627.309] (-626.388) -- 0:00:17
724500 -- (-627.192) (-625.911) [-628.930] (-627.352) * (-626.139) (-629.529) [-625.661] (-628.533) -- 0:00:17
725000 -- (-628.348) (-627.097) [-626.184] (-626.350) * (-626.135) (-626.033) [-627.592] (-627.289) -- 0:00:17
Average standard deviation of split frequencies: 0.006379
725500 -- (-627.738) (-626.358) [-627.147] (-629.288) * (-628.229) [-626.663] (-627.543) (-630.815) -- 0:00:17
726000 -- (-625.889) (-627.489) (-627.439) [-627.167] * [-631.047] (-625.935) (-629.143) (-632.497) -- 0:00:17
726500 -- (-628.599) [-627.424] (-625.996) (-628.001) * (-629.707) [-626.198] (-624.851) (-633.469) -- 0:00:17
727000 -- (-631.303) (-630.885) (-628.401) [-626.602] * (-626.565) [-628.284] (-625.142) (-630.897) -- 0:00:17
727500 -- (-626.246) (-629.184) (-627.087) [-626.748] * (-627.684) [-626.605] (-626.000) (-627.789) -- 0:00:17
728000 -- (-629.865) (-628.256) [-624.771] (-625.911) * (-630.479) (-626.194) [-628.355] (-631.255) -- 0:00:17
728500 -- (-625.707) (-629.097) (-625.484) [-625.710] * [-625.434] (-625.930) (-629.056) (-627.360) -- 0:00:17
729000 -- [-628.563] (-629.032) (-626.481) (-625.468) * [-625.518] (-626.532) (-627.590) (-628.948) -- 0:00:17
729500 -- [-626.256] (-626.290) (-625.187) (-629.285) * (-626.566) (-629.006) [-626.412] (-628.741) -- 0:00:17
730000 -- (-627.824) (-627.195) [-624.596] (-629.727) * (-629.022) (-628.470) (-627.254) [-629.795] -- 0:00:17
Average standard deviation of split frequencies: 0.006338
730500 -- (-626.729) (-627.219) (-626.771) [-627.015] * (-626.732) (-628.056) (-627.229) [-628.346] -- 0:00:17
731000 -- (-628.103) (-627.978) (-627.145) [-627.030] * (-627.242) (-626.143) [-625.272] (-626.288) -- 0:00:17
731500 -- (-625.509) (-627.082) [-626.805] (-625.400) * (-626.066) (-626.221) (-627.663) [-626.997] -- 0:00:17
732000 -- (-625.420) [-629.831] (-626.782) (-625.990) * (-626.557) (-626.694) (-627.210) [-625.365] -- 0:00:17
732500 -- (-626.230) (-631.248) [-625.285] (-626.326) * (-625.784) [-625.362] (-627.103) (-627.042) -- 0:00:17
733000 -- [-628.092] (-627.485) (-625.634) (-626.321) * [-627.301] (-626.838) (-632.326) (-628.145) -- 0:00:17
733500 -- (-631.558) (-636.261) [-628.275] (-627.531) * (-624.900) (-626.488) (-630.275) [-625.635] -- 0:00:17
734000 -- (-634.323) [-626.672] (-625.851) (-627.032) * (-630.962) (-625.108) [-632.584] (-628.898) -- 0:00:17
734500 -- (-632.257) (-625.723) (-627.560) [-626.031] * [-626.110] (-624.908) (-628.312) (-629.791) -- 0:00:16
735000 -- (-626.609) (-624.876) [-626.726] (-627.649) * (-625.591) (-626.215) (-627.095) [-630.125] -- 0:00:16
Average standard deviation of split frequencies: 0.006405
735500 -- [-626.870] (-627.177) (-626.511) (-627.354) * [-625.833] (-626.981) (-626.416) (-626.045) -- 0:00:16
736000 -- (-629.373) (-628.211) [-626.602] (-628.032) * (-626.567) [-625.418] (-626.921) (-625.562) -- 0:00:16
736500 -- (-627.660) (-626.718) (-626.918) [-626.317] * (-628.144) (-626.889) [-626.153] (-626.248) -- 0:00:16
737000 -- [-629.362] (-628.733) (-626.924) (-631.297) * (-626.342) (-626.844) (-625.140) [-625.471] -- 0:00:16
737500 -- (-628.348) (-627.566) [-625.298] (-625.323) * (-625.249) (-626.230) (-625.140) [-626.371] -- 0:00:16
738000 -- [-627.218] (-625.573) (-627.938) (-626.422) * (-625.707) (-625.349) (-626.412) [-629.528] -- 0:00:16
738500 -- (-628.652) (-626.940) (-625.679) [-628.028] * (-625.242) [-625.066] (-627.134) (-630.406) -- 0:00:16
739000 -- [-627.582] (-628.073) (-625.775) (-630.670) * (-634.144) [-625.206] (-629.200) (-629.204) -- 0:00:16
739500 -- (-626.787) (-626.791) (-627.620) [-625.478] * [-626.191] (-625.048) (-627.839) (-631.402) -- 0:00:16
740000 -- (-626.297) [-626.068] (-626.478) (-625.964) * (-626.321) (-625.131) (-626.198) [-628.886] -- 0:00:16
Average standard deviation of split frequencies: 0.006589
740500 -- (-624.847) [-626.148] (-626.175) (-627.898) * [-626.604] (-624.796) (-625.187) (-627.603) -- 0:00:16
741000 -- (-626.595) [-626.582] (-624.781) (-627.088) * (-629.232) (-627.239) (-625.386) [-628.156] -- 0:00:16
741500 -- (-627.103) (-630.912) (-625.081) [-627.799] * (-627.826) (-628.307) (-626.438) [-628.797] -- 0:00:16
742000 -- (-625.771) (-627.975) (-632.861) [-627.698] * (-628.587) (-627.560) (-626.200) [-627.736] -- 0:00:16
742500 -- [-626.730] (-629.135) (-626.085) (-626.040) * (-629.921) (-628.598) (-625.373) [-625.291] -- 0:00:16
743000 -- (-627.772) (-626.770) [-625.577] (-632.318) * (-632.840) [-627.513] (-626.586) (-629.641) -- 0:00:16
743500 -- (-626.791) [-627.348] (-625.373) (-629.214) * (-628.641) (-626.839) [-625.179] (-633.725) -- 0:00:16
744000 -- (-627.535) (-628.724) [-629.049] (-629.539) * (-626.788) [-626.813] (-626.067) (-632.028) -- 0:00:16
744500 -- [-626.196] (-625.756) (-625.507) (-627.702) * (-626.693) (-628.220) [-627.073] (-628.281) -- 0:00:16
745000 -- (-631.365) (-627.483) (-625.426) [-628.741] * [-626.133] (-626.062) (-626.931) (-628.473) -- 0:00:16
Average standard deviation of split frequencies: 0.006280
745500 -- (-626.875) (-629.463) [-626.326] (-627.202) * (-625.147) [-627.045] (-625.150) (-628.125) -- 0:00:16
746000 -- (-628.648) [-627.696] (-628.665) (-625.169) * (-625.624) [-625.366] (-628.392) (-629.832) -- 0:00:16
746500 -- (-625.332) (-627.080) [-627.957] (-628.114) * (-625.886) (-629.545) [-629.103] (-630.525) -- 0:00:16
747000 -- [-625.554] (-626.856) (-626.938) (-630.452) * [-626.475] (-626.832) (-628.596) (-629.168) -- 0:00:16
747500 -- (-625.775) (-626.415) (-625.831) [-629.638] * (-628.632) (-626.798) [-627.619] (-625.250) -- 0:00:16
748000 -- (-630.566) (-626.230) (-626.370) [-626.571] * (-630.564) (-625.366) (-627.616) [-628.056] -- 0:00:16
748500 -- (-628.302) (-629.771) [-625.384] (-626.202) * (-628.393) (-628.148) [-626.163] (-626.642) -- 0:00:16
749000 -- [-627.824] (-627.969) (-629.049) (-628.265) * (-628.628) [-629.650] (-625.946) (-625.902) -- 0:00:16
749500 -- (-630.174) (-629.355) (-627.702) [-628.274] * [-626.066] (-630.942) (-625.762) (-626.325) -- 0:00:16
750000 -- (-626.816) (-625.679) [-627.207] (-628.011) * (-627.807) [-629.989] (-629.531) (-625.466) -- 0:00:16
Average standard deviation of split frequencies: 0.006241
750500 -- (-626.979) (-627.830) (-626.186) [-625.854] * [-627.328] (-628.639) (-626.049) (-626.435) -- 0:00:15
751000 -- (-625.970) (-625.630) [-626.319] (-629.882) * (-629.717) (-627.493) (-626.050) [-626.309] -- 0:00:15
751500 -- (-627.720) [-625.947] (-627.569) (-633.343) * (-629.419) (-627.489) [-627.839] (-625.979) -- 0:00:15
752000 -- (-627.114) (-629.142) (-628.008) [-627.294] * [-628.241] (-626.222) (-628.575) (-626.129) -- 0:00:15
752500 -- (-627.557) (-627.373) (-627.017) [-625.141] * (-631.199) [-625.861] (-628.391) (-628.255) -- 0:00:15
753000 -- (-629.062) [-625.847] (-628.081) (-629.944) * (-628.442) (-626.003) [-632.691] (-628.024) -- 0:00:15
753500 -- [-628.060] (-627.903) (-627.710) (-631.061) * (-631.345) [-626.443] (-626.989) (-629.653) -- 0:00:15
754000 -- [-624.903] (-627.319) (-628.495) (-627.126) * (-626.564) [-628.703] (-630.219) (-627.996) -- 0:00:15
754500 -- [-625.431] (-626.180) (-625.976) (-627.001) * (-627.973) (-626.268) [-627.351] (-626.005) -- 0:00:15
755000 -- (-626.804) (-626.730) (-628.018) [-630.810] * (-630.454) (-626.419) [-629.544] (-627.340) -- 0:00:15
Average standard deviation of split frequencies: 0.006391
755500 -- (-628.992) (-626.434) [-628.223] (-628.231) * [-626.063] (-631.793) (-630.189) (-626.706) -- 0:00:15
756000 -- (-633.705) [-625.375] (-627.523) (-626.804) * (-628.744) (-626.783) (-630.555) [-627.177] -- 0:00:15
756500 -- (-637.279) (-627.689) (-625.143) [-625.725] * (-628.226) [-626.385] (-630.202) (-625.372) -- 0:00:15
757000 -- [-627.989] (-627.152) (-625.217) (-625.220) * [-628.728] (-626.086) (-627.469) (-625.753) -- 0:00:15
757500 -- (-626.537) (-627.194) (-627.229) [-629.849] * (-626.054) (-627.066) [-630.234] (-625.433) -- 0:00:15
758000 -- (-627.508) (-625.718) (-629.559) [-626.871] * (-630.275) (-625.160) [-629.264] (-626.584) -- 0:00:15
758500 -- [-627.029] (-626.970) (-626.717) (-628.344) * (-628.310) [-627.661] (-628.256) (-627.390) -- 0:00:15
759000 -- (-628.415) [-626.200] (-628.837) (-627.205) * (-627.653) (-628.181) (-628.753) [-629.265] -- 0:00:15
759500 -- (-631.085) [-625.086] (-625.878) (-626.616) * (-629.441) [-625.792] (-627.272) (-625.421) -- 0:00:15
760000 -- (-627.393) (-628.877) [-627.554] (-628.174) * (-628.865) [-626.863] (-626.842) (-625.776) -- 0:00:15
Average standard deviation of split frequencies: 0.006507
760500 -- (-629.152) (-626.989) (-625.295) [-627.345] * [-628.919] (-627.195) (-627.715) (-626.283) -- 0:00:15
761000 -- (-626.989) (-626.932) (-627.360) [-627.810] * (-626.240) [-626.849] (-626.673) (-626.674) -- 0:00:15
761500 -- [-625.048] (-627.045) (-631.645) (-624.796) * (-627.393) [-627.539] (-626.842) (-627.337) -- 0:00:15
762000 -- (-627.633) (-627.461) (-628.437) [-626.264] * (-626.673) (-629.111) (-625.523) [-626.204] -- 0:00:15
762500 -- (-628.315) (-627.238) [-627.940] (-625.985) * (-628.145) (-628.112) [-625.981] (-626.119) -- 0:00:15
763000 -- [-629.667] (-630.667) (-628.848) (-627.452) * [-625.331] (-629.490) (-628.916) (-628.390) -- 0:00:15
763500 -- (-630.672) [-625.567] (-630.361) (-627.604) * (-625.576) [-629.784] (-629.055) (-627.293) -- 0:00:15
764000 -- (-631.071) (-625.559) (-627.821) [-626.996] * [-626.236] (-627.842) (-628.284) (-628.955) -- 0:00:15
764500 -- (-628.577) (-626.096) [-627.960] (-625.895) * (-626.695) (-625.668) (-629.130) [-626.691] -- 0:00:15
765000 -- (-624.968) (-626.711) (-628.155) [-624.814] * [-626.624] (-627.472) (-628.404) (-628.377) -- 0:00:15
Average standard deviation of split frequencies: 0.006616
765500 -- [-626.025] (-626.866) (-626.757) (-631.720) * (-625.624) (-625.399) (-627.503) [-628.383] -- 0:00:15
766000 -- (-626.163) (-626.605) (-627.396) [-628.197] * (-626.205) (-629.297) (-628.148) [-629.318] -- 0:00:14
766500 -- (-627.026) [-625.145] (-625.798) (-628.216) * (-627.286) [-624.754] (-626.027) (-628.680) -- 0:00:14
767000 -- (-632.515) (-629.707) (-626.818) [-628.083] * [-625.794] (-625.815) (-628.112) (-626.471) -- 0:00:14
767500 -- (-637.276) [-626.298] (-626.924) (-626.928) * [-625.735] (-626.275) (-626.297) (-626.282) -- 0:00:14
768000 -- [-627.325] (-624.824) (-628.120) (-626.016) * (-624.785) [-627.745] (-626.108) (-628.942) -- 0:00:14
768500 -- (-625.545) (-625.489) (-629.462) [-624.810] * [-625.557] (-628.957) (-629.477) (-627.332) -- 0:00:14
769000 -- (-628.521) (-625.351) [-627.653] (-625.379) * (-627.295) [-625.634] (-625.299) (-627.371) -- 0:00:14
769500 -- [-626.591] (-628.447) (-626.770) (-627.794) * (-626.258) (-624.953) [-624.913] (-625.151) -- 0:00:14
770000 -- (-629.909) (-627.788) (-626.480) [-630.924] * (-628.085) [-627.635] (-625.072) (-625.849) -- 0:00:14
Average standard deviation of split frequencies: 0.006843
770500 -- (-629.749) (-631.489) (-627.071) [-627.750] * (-627.298) [-628.556] (-625.065) (-632.931) -- 0:00:14
771000 -- (-628.741) (-627.424) (-625.563) [-625.733] * (-628.830) (-628.106) [-626.761] (-625.316) -- 0:00:14
771500 -- (-628.399) (-628.046) (-626.629) [-626.691] * (-625.785) (-625.839) [-626.749] (-626.779) -- 0:00:14
772000 -- (-627.753) (-627.524) (-625.472) [-627.377] * (-625.429) (-625.223) (-626.894) [-626.648] -- 0:00:14
772500 -- [-627.344] (-627.221) (-630.767) (-627.525) * (-625.309) (-625.211) (-627.919) [-625.306] -- 0:00:14
773000 -- (-626.476) (-630.294) [-626.276] (-625.056) * (-627.005) (-626.816) (-626.030) [-625.162] -- 0:00:14
773500 -- (-626.985) (-630.475) [-626.110] (-627.754) * [-628.403] (-629.537) (-626.116) (-626.308) -- 0:00:14
774000 -- (-628.629) (-632.025) [-625.291] (-628.383) * [-625.523] (-626.811) (-627.969) (-625.671) -- 0:00:14
774500 -- [-629.044] (-627.390) (-624.918) (-626.769) * [-627.471] (-627.993) (-627.918) (-626.161) -- 0:00:14
775000 -- [-626.696] (-626.499) (-626.630) (-627.166) * (-626.882) (-628.314) (-626.186) [-626.349] -- 0:00:14
Average standard deviation of split frequencies: 0.007325
775500 -- (-626.283) [-626.557] (-627.022) (-627.187) * (-627.943) [-628.983] (-625.608) (-624.978) -- 0:00:14
776000 -- (-626.588) (-626.940) (-628.210) [-625.073] * (-627.461) (-632.947) (-629.389) [-626.314] -- 0:00:14
776500 -- [-629.100] (-625.677) (-626.115) (-626.519) * [-628.507] (-628.546) (-628.322) (-625.106) -- 0:00:14
777000 -- [-626.618] (-626.312) (-628.805) (-628.276) * (-628.932) (-627.709) (-626.605) [-626.651] -- 0:00:14
777500 -- (-634.715) (-626.248) [-628.363] (-625.862) * (-629.505) (-626.151) [-625.231] (-625.252) -- 0:00:14
778000 -- (-625.230) (-627.738) [-629.715] (-626.599) * (-627.540) [-625.540] (-626.589) (-625.264) -- 0:00:14
778500 -- (-625.043) (-626.061) [-628.969] (-625.466) * (-630.631) (-626.274) (-628.629) [-625.103] -- 0:00:14
779000 -- (-626.569) (-627.909) [-632.248] (-630.593) * (-625.453) (-628.138) [-625.025] (-625.284) -- 0:00:14
779500 -- [-628.489] (-625.643) (-631.445) (-629.350) * (-625.197) (-627.182) [-625.756] (-629.175) -- 0:00:14
780000 -- (-629.553) [-627.700] (-627.454) (-626.596) * (-625.485) (-625.733) [-624.985] (-629.507) -- 0:00:14
Average standard deviation of split frequencies: 0.007104
780500 -- (-626.519) [-626.090] (-625.917) (-626.460) * (-627.026) (-625.857) (-628.969) [-628.341] -- 0:00:14
781000 -- [-627.351] (-626.945) (-632.771) (-625.491) * (-633.543) (-628.700) (-628.211) [-626.465] -- 0:00:14
781500 -- (-626.832) (-628.083) (-626.873) [-625.356] * (-625.486) (-626.422) (-629.292) [-625.592] -- 0:00:13
782000 -- [-629.088] (-625.448) (-627.173) (-629.483) * (-628.672) [-626.779] (-628.829) (-626.493) -- 0:00:13
782500 -- (-626.033) [-626.890] (-626.427) (-629.278) * (-625.777) [-625.677] (-626.840) (-627.598) -- 0:00:13
783000 -- [-625.624] (-630.080) (-637.566) (-626.608) * [-628.092] (-629.950) (-627.147) (-628.417) -- 0:00:13
783500 -- (-629.532) (-628.346) (-627.557) [-625.870] * (-625.674) (-633.002) [-626.824] (-627.134) -- 0:00:13
784000 -- (-632.514) (-626.280) [-628.959] (-626.520) * [-625.933] (-628.908) (-626.900) (-625.912) -- 0:00:13
784500 -- (-627.189) [-627.176] (-627.930) (-628.401) * (-626.659) [-627.752] (-628.248) (-628.525) -- 0:00:13
785000 -- (-625.752) [-624.903] (-633.147) (-625.730) * (-628.973) [-625.984] (-627.506) (-626.212) -- 0:00:13
Average standard deviation of split frequencies: 0.007550
785500 -- (-627.581) (-626.271) [-628.083] (-626.473) * (-627.174) (-625.740) (-627.550) [-627.405] -- 0:00:13
786000 -- (-628.886) [-625.589] (-627.347) (-625.531) * (-626.768) (-627.641) (-625.673) [-626.509] -- 0:00:13
786500 -- (-627.407) (-627.772) (-626.968) [-626.898] * (-625.324) (-627.239) [-625.428] (-628.667) -- 0:00:13
787000 -- (-628.908) (-627.322) [-627.747] (-627.987) * (-628.084) (-628.128) (-625.280) [-626.625] -- 0:00:13
787500 -- (-627.723) [-627.485] (-626.552) (-627.991) * (-628.656) (-625.672) [-625.506] (-626.353) -- 0:00:13
788000 -- (-627.286) (-626.679) [-626.860] (-631.100) * (-625.824) (-627.946) [-627.676] (-625.253) -- 0:00:13
788500 -- (-625.369) (-627.936) [-624.967] (-627.577) * (-625.198) (-625.397) (-626.711) [-625.014] -- 0:00:13
789000 -- [-627.827] (-629.854) (-626.389) (-630.654) * (-626.646) (-625.668) (-628.822) [-626.159] -- 0:00:13
789500 -- (-630.156) (-631.187) [-628.953] (-632.451) * [-628.258] (-625.579) (-632.702) (-627.277) -- 0:00:13
790000 -- (-629.184) (-627.240) (-626.579) [-627.224] * (-628.230) [-626.521] (-626.735) (-631.683) -- 0:00:13
Average standard deviation of split frequencies: 0.007470
790500 -- [-628.041] (-626.069) (-627.087) (-627.498) * [-624.981] (-625.082) (-629.126) (-626.691) -- 0:00:13
791000 -- (-627.024) (-629.498) [-627.542] (-625.742) * (-626.733) [-625.350] (-627.090) (-626.410) -- 0:00:13
791500 -- [-628.290] (-627.065) (-626.508) (-629.891) * [-626.611] (-626.059) (-626.636) (-627.392) -- 0:00:13
792000 -- [-627.379] (-629.267) (-626.509) (-625.347) * (-626.621) (-625.283) [-626.061] (-625.944) -- 0:00:13
792500 -- [-627.905] (-627.999) (-628.994) (-628.620) * (-627.646) (-627.318) [-624.746] (-631.602) -- 0:00:13
793000 -- (-626.088) [-628.588] (-630.225) (-630.398) * (-628.030) (-625.877) [-627.929] (-628.774) -- 0:00:13
793500 -- (-626.706) (-627.050) [-625.344] (-628.773) * (-626.552) [-625.031] (-629.026) (-626.243) -- 0:00:13
794000 -- (-625.917) (-625.847) (-626.432) [-627.398] * [-627.968] (-626.930) (-630.882) (-626.548) -- 0:00:13
794500 -- [-625.072] (-629.613) (-629.053) (-625.316) * (-627.083) [-628.938] (-633.094) (-626.427) -- 0:00:13
795000 -- (-628.399) [-627.465] (-626.020) (-629.112) * (-628.582) (-627.204) (-628.645) [-626.182] -- 0:00:13
Average standard deviation of split frequencies: 0.007908
795500 -- [-627.030] (-627.600) (-626.273) (-627.121) * (-626.314) (-626.417) [-626.524] (-627.909) -- 0:00:13
796000 -- (-627.663) (-627.077) [-625.724] (-627.564) * (-625.763) (-625.764) (-627.147) [-631.408] -- 0:00:13
796500 -- (-625.098) (-627.563) [-626.891] (-631.439) * (-625.739) [-628.340] (-629.439) (-630.194) -- 0:00:13
797000 -- [-625.011] (-626.522) (-630.513) (-629.617) * [-625.478] (-625.070) (-629.464) (-631.592) -- 0:00:12
797500 -- [-626.090] (-628.909) (-626.547) (-626.782) * (-626.457) (-626.197) (-630.858) [-631.566] -- 0:00:12
798000 -- (-630.937) (-631.803) (-626.988) [-626.867] * (-626.904) [-630.747] (-626.528) (-626.754) -- 0:00:12
798500 -- (-628.062) (-627.653) (-625.133) [-626.702] * (-627.218) (-625.684) [-626.037] (-626.677) -- 0:00:12
799000 -- (-626.303) (-628.248) (-626.495) [-626.893] * (-625.279) [-629.877] (-626.955) (-628.044) -- 0:00:12
799500 -- (-626.890) (-625.830) (-628.838) [-628.097] * (-627.140) (-626.358) [-625.769] (-632.706) -- 0:00:12
800000 -- (-626.520) [-625.499] (-626.205) (-627.176) * (-629.302) (-625.258) [-626.175] (-628.454) -- 0:00:12
Average standard deviation of split frequencies: 0.007931
800500 -- [-627.583] (-627.680) (-632.358) (-627.158) * (-628.617) [-625.484] (-625.703) (-626.967) -- 0:00:12
801000 -- [-630.899] (-625.924) (-629.715) (-625.998) * [-629.009] (-626.355) (-630.769) (-626.379) -- 0:00:12
801500 -- [-627.452] (-626.321) (-627.053) (-625.539) * [-627.635] (-628.920) (-625.955) (-624.872) -- 0:00:12
802000 -- (-626.680) (-628.743) (-628.544) [-630.683] * (-625.422) (-627.075) [-627.461] (-625.640) -- 0:00:12
802500 -- (-626.340) (-626.035) (-630.888) [-627.133] * (-626.368) (-625.645) [-625.828] (-625.974) -- 0:00:12
803000 -- (-625.229) [-626.501] (-626.405) (-626.735) * (-626.749) (-626.120) [-625.703] (-625.380) -- 0:00:12
803500 -- (-628.277) [-626.295] (-625.272) (-627.571) * (-627.387) (-629.203) (-626.962) [-627.915] -- 0:00:12
804000 -- (-629.203) [-625.635] (-626.237) (-625.839) * (-625.681) (-632.815) (-628.650) [-628.782] -- 0:00:12
804500 -- [-627.581] (-625.399) (-625.459) (-625.751) * (-625.368) (-626.102) [-626.694] (-628.454) -- 0:00:12
805000 -- (-624.980) (-629.103) [-629.706] (-627.300) * [-625.142] (-628.070) (-626.174) (-625.977) -- 0:00:12
Average standard deviation of split frequencies: 0.008291
805500 -- (-625.004) (-629.574) (-626.101) [-626.602] * [-625.625] (-626.605) (-628.608) (-626.248) -- 0:00:12
806000 -- (-628.065) (-625.223) (-626.551) [-625.375] * (-625.509) (-628.337) [-627.258] (-627.642) -- 0:00:12
806500 -- (-630.757) (-625.272) (-630.264) [-626.120] * [-626.135] (-626.991) (-626.990) (-626.275) -- 0:00:12
807000 -- (-627.759) (-626.345) [-629.362] (-625.704) * (-625.954) [-630.175] (-627.113) (-626.611) -- 0:00:12
807500 -- [-628.964] (-625.504) (-626.311) (-625.246) * (-626.202) (-628.843) [-625.973] (-628.591) -- 0:00:12
808000 -- (-628.380) (-626.007) [-627.651] (-629.941) * (-627.619) (-626.514) [-627.942] (-627.779) -- 0:00:12
808500 -- (-626.669) (-630.222) (-627.621) [-627.393] * (-627.625) (-625.956) [-625.521] (-626.586) -- 0:00:12
809000 -- [-629.680] (-628.144) (-629.188) (-627.709) * (-630.581) (-628.513) (-626.138) [-627.441] -- 0:00:12
809500 -- [-626.670] (-625.348) (-625.864) (-627.873) * (-627.074) (-625.484) (-626.227) [-627.436] -- 0:00:12
810000 -- (-626.908) (-628.326) [-625.859] (-628.882) * [-628.678] (-629.135) (-625.921) (-625.311) -- 0:00:12
Average standard deviation of split frequencies: 0.008346
810500 -- (-626.005) (-628.325) [-626.341] (-631.844) * (-627.804) (-625.690) (-624.772) [-627.910] -- 0:00:12
811000 -- (-625.744) (-626.358) (-628.409) [-625.209] * (-626.538) (-626.903) (-624.776) [-629.017] -- 0:00:12
811500 -- (-629.086) (-626.412) (-630.034) [-625.124] * (-625.113) (-628.488) (-627.953) [-629.534] -- 0:00:12
812000 -- (-625.717) (-625.489) (-628.264) [-625.438] * [-626.025] (-626.673) (-630.249) (-628.086) -- 0:00:12
812500 -- [-627.261] (-625.228) (-627.195) (-627.787) * (-628.285) [-626.208] (-636.683) (-629.146) -- 0:00:12
813000 -- [-626.529] (-625.105) (-625.197) (-629.721) * (-629.041) [-625.867] (-628.212) (-625.756) -- 0:00:11
813500 -- (-627.828) (-626.071) (-627.651) [-627.088] * [-632.355] (-629.410) (-627.033) (-627.033) -- 0:00:11
814000 -- (-625.956) [-625.818] (-625.350) (-627.660) * (-630.714) (-627.826) (-629.086) [-626.798] -- 0:00:11
814500 -- (-625.946) (-625.569) (-625.055) [-627.266] * (-630.871) [-626.139] (-626.411) (-627.024) -- 0:00:11
815000 -- (-626.709) (-625.821) [-625.199] (-637.893) * [-626.956] (-624.891) (-626.634) (-626.334) -- 0:00:11
Average standard deviation of split frequencies: 0.008394
815500 -- [-626.223] (-627.231) (-625.034) (-641.156) * (-626.317) [-626.081] (-628.562) (-629.283) -- 0:00:11
816000 -- [-625.401] (-629.184) (-626.016) (-632.266) * (-625.844) (-631.484) (-628.179) [-629.528] -- 0:00:11
816500 -- (-625.597) [-628.863] (-628.541) (-627.408) * (-624.702) [-625.589] (-633.140) (-628.454) -- 0:00:11
817000 -- [-625.839] (-627.394) (-625.778) (-626.624) * [-625.692] (-631.342) (-625.713) (-631.430) -- 0:00:11
817500 -- (-626.341) (-625.660) [-626.382] (-625.860) * [-628.118] (-626.110) (-625.805) (-626.350) -- 0:00:11
818000 -- [-627.223] (-625.089) (-624.918) (-625.218) * (-629.414) (-627.044) [-625.940] (-625.966) -- 0:00:11
818500 -- (-625.537) [-625.841] (-625.117) (-626.432) * (-635.416) [-628.937] (-625.669) (-626.159) -- 0:00:11
819000 -- [-625.275] (-627.082) (-627.121) (-625.557) * (-626.434) (-629.302) (-627.052) [-626.539] -- 0:00:11
819500 -- (-626.336) (-628.541) (-629.126) [-625.773] * (-626.633) (-628.141) (-625.323) [-626.016] -- 0:00:11
820000 -- [-627.348] (-625.478) (-624.821) (-625.880) * (-626.952) [-628.589] (-626.170) (-628.305) -- 0:00:11
Average standard deviation of split frequencies: 0.008473
820500 -- (-625.360) [-624.812] (-625.896) (-631.815) * (-629.248) (-626.969) [-625.895] (-627.065) -- 0:00:11
821000 -- (-625.724) (-625.643) [-625.875] (-627.240) * (-632.689) (-624.630) [-625.989] (-627.402) -- 0:00:11
821500 -- [-627.427] (-625.686) (-626.211) (-626.298) * [-625.634] (-625.811) (-625.773) (-629.163) -- 0:00:11
822000 -- [-625.953] (-625.732) (-627.475) (-628.113) * (-629.548) [-625.864] (-627.507) (-627.958) -- 0:00:11
822500 -- (-626.637) (-625.608) [-627.997] (-631.877) * (-632.270) (-629.038) (-627.756) [-628.988] -- 0:00:11
823000 -- (-625.225) (-625.495) [-626.614] (-625.080) * [-624.941] (-627.765) (-625.101) (-630.913) -- 0:00:11
823500 -- (-628.352) (-627.507) [-625.851] (-625.095) * (-625.217) (-625.886) [-629.618] (-630.530) -- 0:00:11
824000 -- (-629.573) [-627.851] (-635.977) (-625.080) * [-626.502] (-626.091) (-626.960) (-627.278) -- 0:00:11
824500 -- (-625.942) [-626.955] (-633.183) (-624.675) * (-626.772) (-627.035) (-631.951) [-624.640] -- 0:00:11
825000 -- (-626.725) [-627.004] (-627.257) (-625.825) * (-626.373) (-625.352) [-625.181] (-626.265) -- 0:00:11
Average standard deviation of split frequencies: 0.008124
825500 -- (-625.858) (-626.449) [-625.113] (-625.300) * (-628.240) (-626.322) (-625.091) [-626.368] -- 0:00:10
826000 -- (-625.031) (-625.879) (-629.692) [-625.620] * (-627.557) (-625.912) [-625.334] (-627.508) -- 0:00:10
826500 -- (-626.579) [-625.111] (-629.658) (-625.225) * [-625.196] (-627.161) (-625.491) (-628.660) -- 0:00:10
827000 -- [-625.088] (-629.724) (-628.816) (-626.326) * (-629.926) (-626.104) [-627.943] (-625.231) -- 0:00:11
827500 -- [-626.599] (-627.297) (-628.886) (-625.125) * (-627.369) [-626.348] (-626.096) (-626.054) -- 0:00:11
828000 -- (-626.124) [-625.835] (-627.179) (-629.405) * (-626.884) (-627.103) (-625.735) [-626.351] -- 0:00:11
828500 -- [-625.732] (-626.665) (-632.957) (-626.577) * [-627.157] (-629.317) (-628.795) (-628.313) -- 0:00:10
829000 -- [-627.503] (-626.271) (-626.326) (-626.666) * (-625.004) [-631.476] (-626.556) (-628.058) -- 0:00:10
829500 -- (-627.254) (-626.603) (-627.982) [-627.202] * (-625.819) [-626.802] (-628.702) (-628.674) -- 0:00:10
830000 -- [-625.389] (-626.234) (-628.719) (-625.532) * (-625.877) [-627.962] (-631.405) (-628.301) -- 0:00:10
Average standard deviation of split frequencies: 0.007980
830500 -- (-625.800) (-625.436) [-625.425] (-625.474) * [-625.720] (-626.544) (-627.312) (-629.358) -- 0:00:10
831000 -- (-625.175) (-627.285) (-625.908) [-625.359] * [-626.737] (-628.030) (-625.872) (-627.675) -- 0:00:10
831500 -- (-626.514) (-628.727) (-629.251) [-625.675] * [-627.190] (-625.473) (-625.682) (-626.517) -- 0:00:10
832000 -- [-626.963] (-630.690) (-628.992) (-626.041) * (-626.612) [-627.074] (-626.880) (-631.214) -- 0:00:10
832500 -- (-627.385) (-628.566) (-629.073) [-626.524] * (-628.027) (-627.918) [-625.441] (-628.880) -- 0:00:10
833000 -- (-625.862) (-625.640) [-625.431] (-626.717) * (-627.039) [-628.399] (-629.919) (-626.720) -- 0:00:10
833500 -- [-626.925] (-625.620) (-626.431) (-624.954) * (-629.301) (-630.186) (-628.665) [-626.673] -- 0:00:10
834000 -- (-627.752) [-627.812] (-627.068) (-625.079) * [-626.404] (-627.756) (-628.361) (-626.392) -- 0:00:10
834500 -- (-626.839) (-628.551) (-629.145) [-631.179] * [-627.348] (-625.369) (-626.759) (-626.188) -- 0:00:10
835000 -- (-627.231) [-625.433] (-626.347) (-629.922) * [-624.830] (-627.087) (-627.200) (-631.068) -- 0:00:10
Average standard deviation of split frequencies: 0.008247
835500 -- (-628.025) (-625.879) (-625.416) [-624.658] * (-625.094) (-625.908) [-627.183] (-629.074) -- 0:00:10
836000 -- (-627.338) (-628.915) (-625.710) [-625.602] * [-630.456] (-627.468) (-626.225) (-625.720) -- 0:00:10
836500 -- (-627.289) (-625.798) (-626.234) [-625.536] * (-626.500) (-625.717) [-626.369] (-627.522) -- 0:00:10
837000 -- (-627.943) (-625.960) [-626.652] (-631.173) * [-627.563] (-626.397) (-629.163) (-625.292) -- 0:00:10
837500 -- [-629.623] (-625.264) (-629.418) (-629.402) * (-633.245) [-626.859] (-626.895) (-629.339) -- 0:00:10
838000 -- (-624.755) [-624.618] (-627.254) (-628.051) * (-632.657) [-628.480] (-627.281) (-628.917) -- 0:00:10
838500 -- (-629.042) (-626.741) [-626.090] (-625.983) * [-637.097] (-626.399) (-627.371) (-628.224) -- 0:00:10
839000 -- [-625.526] (-626.769) (-625.749) (-627.492) * (-628.406) (-628.650) (-627.784) [-625.044] -- 0:00:10
839500 -- [-629.992] (-627.618) (-629.060) (-628.754) * (-629.360) [-627.861] (-625.587) (-627.041) -- 0:00:10
840000 -- (-634.041) (-626.310) [-626.051] (-628.214) * (-629.087) [-630.773] (-632.870) (-625.348) -- 0:00:10
Average standard deviation of split frequencies: 0.007916
840500 -- [-627.893] (-626.559) (-626.816) (-631.324) * (-627.997) [-627.467] (-631.946) (-626.515) -- 0:00:10
841000 -- [-628.149] (-625.908) (-627.129) (-627.694) * [-627.593] (-628.758) (-629.147) (-628.507) -- 0:00:10
841500 -- (-626.308) (-625.549) (-630.161) [-625.062] * (-626.115) (-626.166) (-635.456) [-627.502] -- 0:00:09
842000 -- (-633.025) [-626.598] (-629.735) (-626.310) * (-630.861) (-633.344) [-627.988] (-627.285) -- 0:00:09
842500 -- [-627.412] (-626.805) (-631.694) (-625.897) * [-630.691] (-625.921) (-628.000) (-625.761) -- 0:00:09
843000 -- (-628.248) (-626.106) [-626.192] (-625.490) * (-627.272) (-626.052) [-626.936] (-627.036) -- 0:00:10
843500 -- [-625.535] (-628.884) (-625.727) (-629.552) * (-626.993) (-627.230) (-628.023) [-626.983] -- 0:00:10
844000 -- (-627.425) (-625.986) [-626.727] (-628.513) * (-626.254) (-626.594) [-626.032] (-625.663) -- 0:00:09
844500 -- (-626.744) (-628.890) [-629.556] (-626.526) * [-627.142] (-627.988) (-626.846) (-627.732) -- 0:00:09
845000 -- [-627.149] (-625.505) (-629.943) (-628.619) * (-626.858) [-625.893] (-625.976) (-628.988) -- 0:00:09
Average standard deviation of split frequencies: 0.007932
845500 -- (-626.814) (-627.242) (-626.297) [-627.159] * [-626.859] (-626.139) (-626.134) (-626.604) -- 0:00:09
846000 -- [-627.431] (-627.077) (-625.212) (-629.793) * (-627.830) [-625.240] (-625.756) (-626.296) -- 0:00:09
846500 -- [-625.874] (-627.403) (-626.317) (-627.316) * (-630.501) [-627.183] (-626.766) (-626.928) -- 0:00:09
847000 -- (-625.537) (-626.449) (-629.766) [-626.056] * (-625.629) (-626.262) [-628.048] (-628.376) -- 0:00:09
847500 -- [-627.740] (-626.536) (-626.292) (-625.905) * (-627.824) (-626.755) (-627.062) [-625.259] -- 0:00:09
848000 -- (-625.627) (-625.917) [-626.867] (-627.263) * (-625.883) (-628.727) [-624.931] (-626.943) -- 0:00:09
848500 -- (-630.497) [-625.482] (-628.881) (-626.000) * (-626.971) (-628.739) (-625.792) [-626.547] -- 0:00:09
849000 -- (-627.599) (-628.316) (-625.698) [-627.375] * (-625.425) [-625.753] (-626.425) (-627.541) -- 0:00:09
849500 -- (-626.649) [-626.547] (-629.873) (-626.985) * (-627.821) [-626.212] (-624.808) (-625.304) -- 0:00:09
850000 -- (-628.061) (-625.807) (-626.042) [-626.943] * [-628.144] (-626.013) (-626.461) (-627.514) -- 0:00:09
Average standard deviation of split frequencies: 0.007954
850500 -- (-630.708) [-625.738] (-629.449) (-625.793) * [-626.303] (-627.106) (-629.990) (-625.685) -- 0:00:09
851000 -- (-632.810) (-625.154) [-625.599] (-626.935) * (-627.710) [-627.565] (-627.098) (-625.631) -- 0:00:09
851500 -- (-626.169) [-625.317] (-626.298) (-628.817) * [-625.446] (-627.419) (-625.689) (-628.549) -- 0:00:09
852000 -- (-626.828) (-625.438) [-626.593] (-626.934) * (-624.728) (-628.022) (-628.769) [-626.089] -- 0:00:09
852500 -- [-624.810] (-625.837) (-626.299) (-627.219) * (-627.236) (-627.182) [-628.330] (-627.547) -- 0:00:09
853000 -- (-624.767) [-625.633] (-626.871) (-629.122) * (-628.057) [-626.249] (-631.492) (-627.852) -- 0:00:09
853500 -- [-624.784] (-626.442) (-628.736) (-626.160) * [-628.367] (-626.422) (-626.547) (-629.232) -- 0:00:09
854000 -- (-624.707) [-625.803] (-628.941) (-626.158) * [-625.545] (-628.842) (-627.519) (-625.234) -- 0:00:09
854500 -- (-625.530) (-628.435) [-625.209] (-629.010) * (-628.714) (-630.321) [-628.230] (-633.051) -- 0:00:09
855000 -- (-626.158) [-626.573] (-625.195) (-627.766) * (-627.413) [-625.164] (-627.461) (-632.733) -- 0:00:09
Average standard deviation of split frequencies: 0.007613
855500 -- [-625.683] (-626.202) (-625.802) (-630.177) * (-627.324) (-627.262) [-627.550] (-630.078) -- 0:00:09
856000 -- [-626.321] (-626.949) (-627.057) (-629.487) * (-627.413) [-627.458] (-629.020) (-626.327) -- 0:00:09
856500 -- (-626.853) [-625.112] (-628.486) (-629.956) * (-625.295) (-629.103) [-627.021] (-626.220) -- 0:00:09
857000 -- [-628.176] (-626.502) (-629.630) (-625.570) * (-627.282) (-626.798) [-625.160] (-625.109) -- 0:00:09
857500 -- [-626.548] (-631.360) (-629.208) (-625.423) * [-626.520] (-627.387) (-625.351) (-625.603) -- 0:00:08
858000 -- (-627.815) (-626.433) (-626.691) [-626.968] * [-627.698] (-628.669) (-628.741) (-625.833) -- 0:00:08
858500 -- (-625.322) (-626.936) (-629.096) [-626.828] * (-626.288) (-625.763) [-627.022] (-626.463) -- 0:00:08
859000 -- (-626.260) (-625.435) [-626.646] (-628.383) * (-626.710) (-625.600) [-628.133] (-627.035) -- 0:00:08
859500 -- [-626.230] (-625.833) (-625.742) (-630.920) * [-629.372] (-631.554) (-627.432) (-628.282) -- 0:00:08
860000 -- (-626.693) (-626.110) (-626.503) [-628.220] * [-626.186] (-629.226) (-626.161) (-627.482) -- 0:00:08
Average standard deviation of split frequencies: 0.007410
860500 -- (-631.663) [-625.090] (-627.117) (-627.724) * (-634.006) (-626.906) (-627.239) [-627.196] -- 0:00:08
861000 -- [-626.877] (-625.329) (-627.210) (-627.125) * (-627.719) (-627.070) [-628.023] (-626.726) -- 0:00:08
861500 -- (-626.766) [-625.942] (-628.165) (-626.993) * (-629.264) (-627.003) (-626.332) [-625.569] -- 0:00:08
862000 -- (-626.222) (-628.189) [-631.042] (-628.763) * [-629.176] (-626.813) (-626.975) (-629.750) -- 0:00:08
862500 -- [-625.763] (-626.413) (-625.041) (-629.706) * (-630.252) [-625.292] (-627.114) (-631.465) -- 0:00:08
863000 -- (-628.108) (-627.290) (-627.796) [-626.847] * (-629.636) [-625.572] (-630.808) (-627.872) -- 0:00:08
863500 -- (-626.843) [-625.208] (-627.675) (-627.566) * (-628.995) (-627.316) (-627.172) [-626.033] -- 0:00:08
864000 -- (-624.843) [-625.945] (-627.059) (-625.939) * (-625.525) [-627.324] (-632.248) (-626.919) -- 0:00:08
864500 -- (-628.425) [-627.650] (-626.048) (-626.717) * (-625.786) [-629.887] (-629.372) (-628.204) -- 0:00:08
865000 -- [-626.331] (-625.801) (-628.127) (-628.117) * (-630.724) (-629.886) [-631.419] (-627.170) -- 0:00:08
Average standard deviation of split frequencies: 0.006660
865500 -- (-628.366) [-624.610] (-625.702) (-630.738) * (-626.814) (-625.929) [-626.758] (-627.587) -- 0:00:08
866000 -- (-624.908) [-625.460] (-626.747) (-630.506) * (-627.140) [-625.553] (-629.226) (-628.276) -- 0:00:08
866500 -- (-625.444) (-625.162) [-627.642] (-626.298) * (-627.545) (-627.125) [-630.108] (-628.417) -- 0:00:08
867000 -- [-624.974] (-624.990) (-624.946) (-625.205) * (-628.023) (-624.875) (-631.101) [-626.632] -- 0:00:08
867500 -- (-626.159) (-628.284) (-626.701) [-626.929] * (-629.770) (-625.884) (-630.387) [-626.841] -- 0:00:08
868000 -- [-626.232] (-628.858) (-625.563) (-625.508) * (-626.144) [-625.627] (-626.893) (-628.019) -- 0:00:08
868500 -- (-625.630) (-629.550) (-624.844) [-629.344] * [-627.064] (-625.449) (-628.319) (-627.559) -- 0:00:08
869000 -- (-627.142) (-628.229) (-629.503) [-630.170] * [-626.456] (-624.861) (-625.642) (-626.124) -- 0:00:08
869500 -- (-627.919) [-626.794] (-630.597) (-631.932) * [-627.052] (-628.803) (-627.448) (-626.142) -- 0:00:08
870000 -- (-629.741) (-627.359) (-627.112) [-628.611] * (-627.277) (-630.221) [-624.975] (-628.400) -- 0:00:08
Average standard deviation of split frequencies: 0.006529
870500 -- (-627.309) [-626.142] (-628.038) (-629.724) * (-625.715) (-629.211) (-627.770) [-627.306] -- 0:00:08
871000 -- (-626.176) (-625.395) (-627.301) [-625.943] * (-627.023) (-625.522) [-626.129] (-627.291) -- 0:00:08
871500 -- [-626.065] (-626.179) (-626.224) (-627.093) * (-625.001) (-624.853) (-628.707) [-627.394] -- 0:00:08
872000 -- (-626.566) [-624.941] (-626.358) (-625.113) * [-625.196] (-624.947) (-628.514) (-627.304) -- 0:00:08
872500 -- (-625.869) (-626.019) (-625.883) [-626.765] * (-625.117) (-627.894) [-625.135] (-625.541) -- 0:00:08
873000 -- [-629.824] (-625.554) (-626.171) (-625.689) * [-627.724] (-627.279) (-626.042) (-633.711) -- 0:00:08
873500 -- [-629.384] (-628.171) (-625.666) (-626.665) * [-628.382] (-626.530) (-628.136) (-630.859) -- 0:00:07
874000 -- [-630.031] (-627.265) (-627.213) (-625.962) * (-625.758) (-631.135) (-627.718) [-625.386] -- 0:00:07
874500 -- (-625.084) (-632.821) (-628.623) [-626.578] * (-628.436) (-629.515) [-625.297] (-627.027) -- 0:00:07
875000 -- (-625.234) (-626.452) (-627.188) [-626.439] * (-628.917) [-630.893] (-628.825) (-628.858) -- 0:00:07
Average standard deviation of split frequencies: 0.006553
875500 -- (-624.864) [-626.090] (-628.557) (-626.039) * (-625.694) (-632.557) [-629.164] (-628.693) -- 0:00:07
876000 -- (-628.088) (-628.049) [-632.712] (-626.990) * (-626.361) (-633.323) (-629.384) [-626.221] -- 0:00:07
876500 -- (-625.364) [-627.451] (-628.262) (-626.109) * (-628.875) (-626.466) [-624.938] (-625.663) -- 0:00:07
877000 -- (-625.826) (-628.439) [-626.784] (-626.914) * (-628.358) (-626.462) [-625.675] (-626.755) -- 0:00:07
877500 -- (-626.832) (-624.904) (-630.921) [-627.135] * [-625.441] (-625.856) (-626.194) (-625.991) -- 0:00:07
878000 -- (-626.323) (-626.262) [-625.242] (-625.585) * (-626.793) (-627.334) [-626.147] (-628.248) -- 0:00:07
878500 -- (-626.697) (-626.087) [-632.319] (-626.461) * [-625.367] (-630.170) (-626.140) (-628.722) -- 0:00:07
879000 -- (-628.523) (-625.352) (-628.017) [-626.454] * [-628.038] (-630.236) (-627.522) (-628.614) -- 0:00:07
879500 -- (-628.799) (-625.762) (-626.251) [-625.545] * [-625.547] (-628.549) (-626.709) (-628.411) -- 0:00:07
880000 -- (-628.312) (-626.091) (-626.569) [-625.973] * [-627.715] (-631.101) (-625.690) (-628.368) -- 0:00:07
Average standard deviation of split frequencies: 0.006455
880500 -- (-627.478) (-626.928) (-627.120) [-625.964] * [-625.461] (-625.229) (-629.868) (-631.220) -- 0:00:07
881000 -- [-628.318] (-628.064) (-625.294) (-626.890) * [-625.508] (-626.619) (-627.337) (-627.090) -- 0:00:07
881500 -- (-628.035) (-628.463) (-625.972) [-625.502] * [-625.986] (-625.049) (-627.890) (-628.130) -- 0:00:07
882000 -- [-628.214] (-627.276) (-627.117) (-626.807) * (-625.913) (-626.096) [-628.796] (-628.323) -- 0:00:07
882500 -- [-627.466] (-631.184) (-627.686) (-626.087) * (-626.320) (-626.791) [-628.075] (-627.244) -- 0:00:07
883000 -- (-628.504) (-626.910) [-626.209] (-625.769) * [-632.908] (-628.320) (-629.850) (-625.755) -- 0:00:07
883500 -- (-630.521) (-630.951) (-628.759) [-628.625] * [-636.179] (-632.189) (-629.895) (-629.611) -- 0:00:07
884000 -- [-629.533] (-629.843) (-629.312) (-628.351) * [-626.073] (-626.956) (-626.676) (-633.508) -- 0:00:07
884500 -- [-626.930] (-625.391) (-629.718) (-627.157) * (-625.024) [-625.611] (-626.835) (-633.344) -- 0:00:07
885000 -- [-626.453] (-625.412) (-630.297) (-629.004) * (-626.995) (-634.149) [-627.083] (-625.774) -- 0:00:07
Average standard deviation of split frequencies: 0.006729
885500 -- (-629.286) [-624.901] (-628.547) (-627.866) * (-628.202) (-628.007) (-626.754) [-626.752] -- 0:00:07
886000 -- (-628.603) (-627.168) [-627.164] (-632.610) * (-625.645) (-626.385) [-628.456] (-628.163) -- 0:00:07
886500 -- [-626.961] (-631.389) (-628.988) (-634.623) * (-626.084) (-627.364) (-628.601) [-630.609] -- 0:00:07
887000 -- [-626.249] (-629.992) (-627.347) (-634.684) * [-625.414] (-626.803) (-627.671) (-627.128) -- 0:00:07
887500 -- (-629.850) (-627.207) (-627.206) [-626.015] * (-625.414) [-626.646] (-626.436) (-628.433) -- 0:00:07
888000 -- (-632.440) [-628.215] (-627.217) (-626.707) * [-626.772] (-628.509) (-626.624) (-627.994) -- 0:00:07
888500 -- (-628.269) [-628.190] (-629.259) (-626.645) * [-627.891] (-627.693) (-629.789) (-628.181) -- 0:00:07
889000 -- (-628.867) [-629.788] (-629.236) (-627.014) * (-627.855) (-625.929) (-628.167) [-627.848] -- 0:00:06
889500 -- [-627.698] (-627.171) (-628.534) (-632.674) * [-629.737] (-625.553) (-628.120) (-630.651) -- 0:00:06
890000 -- (-629.314) (-626.269) [-626.948] (-625.588) * (-628.928) (-625.718) [-625.880] (-626.230) -- 0:00:06
Average standard deviation of split frequencies: 0.006818
890500 -- [-625.668] (-626.232) (-626.879) (-624.987) * [-626.366] (-626.615) (-626.439) (-628.474) -- 0:00:06
891000 -- (-626.222) (-630.074) [-625.846] (-626.762) * (-626.261) (-626.580) [-626.257] (-625.543) -- 0:00:06
891500 -- [-626.530] (-627.521) (-628.555) (-625.395) * (-625.659) (-629.542) [-626.356] (-625.123) -- 0:00:06
892000 -- (-625.808) (-628.040) (-629.456) [-627.399] * [-625.635] (-626.153) (-630.931) (-626.302) -- 0:00:06
892500 -- (-627.321) (-628.150) (-629.829) [-631.396] * (-626.597) (-626.585) (-625.363) [-625.039] -- 0:00:06
893000 -- (-627.083) [-626.831] (-626.142) (-632.534) * (-627.366) [-625.056] (-626.908) (-627.960) -- 0:00:06
893500 -- (-626.711) [-625.717] (-625.450) (-627.973) * (-626.639) (-626.361) (-631.920) [-631.904] -- 0:00:06
894000 -- (-625.336) [-632.274] (-624.705) (-626.933) * [-627.005] (-626.574) (-630.722) (-625.528) -- 0:00:06
894500 -- (-625.858) (-628.942) (-628.231) [-627.370] * (-626.616) [-629.191] (-630.877) (-630.292) -- 0:00:06
895000 -- [-629.386] (-629.528) (-627.729) (-627.032) * (-629.477) (-627.719) (-628.285) [-626.008] -- 0:00:06
Average standard deviation of split frequencies: 0.006778
895500 -- [-625.907] (-630.451) (-626.145) (-631.976) * [-629.598] (-627.200) (-628.472) (-626.884) -- 0:00:06
896000 -- (-625.674) [-630.623] (-628.675) (-626.854) * [-625.113] (-625.987) (-629.282) (-626.412) -- 0:00:06
896500 -- (-628.496) (-630.096) (-627.152) [-624.753] * (-626.008) (-626.804) [-625.275] (-628.419) -- 0:00:06
897000 -- (-627.364) (-630.559) [-628.390] (-626.931) * [-626.824] (-628.060) (-629.808) (-626.308) -- 0:00:06
897500 -- (-627.140) [-626.800] (-627.356) (-625.007) * (-626.153) (-626.773) (-627.542) [-629.511] -- 0:00:06
898000 -- (-627.445) [-626.042] (-625.755) (-625.295) * (-625.793) [-627.490] (-625.949) (-625.251) -- 0:00:06
898500 -- (-624.916) [-626.467] (-627.363) (-626.752) * (-626.703) (-637.167) [-626.669] (-627.269) -- 0:00:06
899000 -- (-625.388) [-627.647] (-625.085) (-630.236) * (-628.157) (-625.650) (-625.592) [-626.788] -- 0:00:06
899500 -- (-626.569) [-626.452] (-629.070) (-627.392) * (-625.912) (-627.117) (-626.280) [-626.585] -- 0:00:06
900000 -- [-627.800] (-628.504) (-634.484) (-630.273) * (-628.284) (-630.692) (-626.432) [-627.670] -- 0:00:06
Average standard deviation of split frequencies: 0.006897
900500 -- (-628.188) (-625.189) [-626.834] (-627.035) * (-630.611) (-627.343) (-626.432) [-626.032] -- 0:00:06
901000 -- (-627.240) [-625.232] (-629.416) (-625.576) * (-627.206) (-626.034) (-628.376) [-629.691] -- 0:00:06
901500 -- [-629.541] (-626.258) (-628.597) (-629.628) * (-627.581) (-628.496) [-631.541] (-628.618) -- 0:00:06
902000 -- (-627.166) (-625.532) (-630.501) [-627.238] * (-627.488) (-625.019) [-630.376] (-628.161) -- 0:00:06
902500 -- (-627.836) [-628.189] (-626.699) (-626.970) * (-628.717) (-627.036) [-629.261] (-629.031) -- 0:00:06
903000 -- (-626.778) [-627.040] (-626.803) (-626.533) * (-627.155) (-625.418) (-626.709) [-627.173] -- 0:00:06
903500 -- [-625.579] (-627.059) (-627.957) (-625.670) * [-626.774] (-626.151) (-627.693) (-628.788) -- 0:00:06
904000 -- (-626.639) [-625.512] (-627.993) (-628.268) * (-625.184) [-626.376] (-629.329) (-625.574) -- 0:00:06
904500 -- (-627.493) [-626.030] (-626.873) (-627.654) * (-625.393) [-625.766] (-627.049) (-625.600) -- 0:00:06
905000 -- (-628.161) [-626.279] (-635.735) (-626.943) * [-625.531] (-627.683) (-628.843) (-625.477) -- 0:00:05
Average standard deviation of split frequencies: 0.007101
905500 -- (-628.090) (-626.605) (-629.519) [-626.541] * [-625.072] (-626.007) (-625.601) (-628.189) -- 0:00:05
906000 -- [-624.889] (-627.244) (-628.008) (-628.267) * (-624.864) (-625.881) (-628.954) [-626.377] -- 0:00:05
906500 -- (-628.626) [-628.104] (-627.857) (-628.051) * (-626.664) (-625.523) (-626.103) [-625.546] -- 0:00:05
907000 -- (-627.204) [-628.723] (-630.004) (-627.246) * [-625.311] (-625.615) (-628.611) (-626.310) -- 0:00:05
907500 -- (-628.847) (-627.084) [-626.543] (-627.212) * (-626.232) (-627.502) [-625.077] (-626.863) -- 0:00:05
908000 -- (-628.032) (-625.702) (-627.041) [-625.888] * (-628.320) (-625.644) [-626.012] (-627.342) -- 0:00:05
908500 -- [-627.483] (-625.547) (-630.346) (-627.256) * [-626.609] (-627.260) (-629.182) (-627.523) -- 0:00:05
909000 -- (-627.422) [-625.635] (-628.383) (-627.933) * (-626.781) [-627.792] (-627.465) (-626.857) -- 0:00:05
909500 -- [-627.204] (-628.228) (-626.873) (-626.896) * [-624.916] (-627.981) (-627.465) (-626.457) -- 0:00:05
910000 -- [-628.909] (-627.113) (-627.406) (-627.403) * (-624.950) (-630.437) (-626.961) [-627.054] -- 0:00:05
Average standard deviation of split frequencies: 0.007186
910500 -- (-626.611) [-625.346] (-625.483) (-627.229) * (-625.932) (-630.078) [-625.764] (-626.515) -- 0:00:05
911000 -- [-626.049] (-628.573) (-625.522) (-627.728) * (-627.028) (-628.278) (-625.769) [-626.223] -- 0:00:05
911500 -- (-625.892) (-626.691) [-625.158] (-625.871) * (-626.357) (-625.872) [-625.626] (-626.566) -- 0:00:05
912000 -- (-626.854) (-626.747) (-626.280) [-627.098] * (-626.664) (-628.122) [-625.278] (-627.339) -- 0:00:05
912500 -- (-624.994) [-628.108] (-626.181) (-625.621) * (-625.626) [-629.095] (-625.919) (-626.057) -- 0:00:05
913000 -- (-625.062) (-626.596) (-625.121) [-624.844] * [-626.518] (-630.435) (-625.434) (-626.087) -- 0:00:05
913500 -- (-626.612) (-632.176) (-631.625) [-626.583] * (-626.387) (-629.430) [-626.218] (-629.432) -- 0:00:05
914000 -- [-626.242] (-627.446) (-625.539) (-627.291) * (-626.111) (-626.532) (-628.336) [-626.088] -- 0:00:05
914500 -- (-626.257) (-628.989) (-626.786) [-625.669] * (-626.435) [-625.320] (-626.485) (-626.705) -- 0:00:05
915000 -- (-627.825) (-625.287) (-628.537) [-627.244] * (-625.894) [-627.052] (-628.692) (-625.604) -- 0:00:05
Average standard deviation of split frequencies: 0.007235
915500 -- [-627.383] (-627.418) (-626.329) (-627.500) * [-625.194] (-628.353) (-630.448) (-629.885) -- 0:00:05
916000 -- [-625.259] (-627.897) (-633.978) (-626.017) * (-625.919) (-628.679) [-627.308] (-626.060) -- 0:00:05
916500 -- [-625.720] (-626.594) (-626.602) (-625.590) * [-626.713] (-630.883) (-627.399) (-626.094) -- 0:00:05
917000 -- (-624.985) [-625.315] (-626.950) (-625.368) * (-630.684) (-626.251) [-626.086] (-625.177) -- 0:00:05
917500 -- (-627.952) (-627.413) (-628.657) [-626.086] * (-627.992) (-625.198) (-627.081) [-624.930] -- 0:00:05
918000 -- [-626.570] (-628.923) (-630.421) (-627.661) * (-625.985) [-627.420] (-627.375) (-625.501) -- 0:00:05
918500 -- (-629.194) (-629.054) [-627.813] (-631.231) * [-626.764] (-625.104) (-626.857) (-624.642) -- 0:00:05
919000 -- (-629.280) (-629.392) (-630.754) [-626.186] * (-628.429) (-624.891) (-626.534) [-625.076] -- 0:00:05
919500 -- (-625.680) (-628.132) (-627.611) [-625.798] * [-626.250] (-627.167) (-628.634) (-627.452) -- 0:00:05
920000 -- (-626.548) (-627.458) [-625.069] (-625.812) * (-626.410) [-625.560] (-628.674) (-626.103) -- 0:00:05
Average standard deviation of split frequencies: 0.007259
920500 -- (-626.142) [-628.207] (-625.222) (-628.223) * (-625.413) [-626.100] (-626.078) (-624.740) -- 0:00:05
921000 -- (-626.902) [-628.407] (-627.146) (-632.565) * [-626.006] (-625.172) (-627.323) (-625.438) -- 0:00:04
921500 -- (-625.204) (-629.215) [-628.176] (-626.663) * [-626.383] (-627.633) (-632.770) (-625.055) -- 0:00:04
922000 -- [-626.634] (-628.612) (-629.846) (-626.123) * (-626.223) [-626.710] (-628.132) (-626.191) -- 0:00:04
922500 -- (-628.178) (-627.078) [-628.739] (-625.304) * (-625.384) (-628.249) [-626.424] (-625.594) -- 0:00:04
923000 -- (-627.706) (-627.463) [-627.233] (-628.848) * [-626.104] (-626.630) (-628.769) (-626.341) -- 0:00:04
923500 -- [-629.688] (-625.283) (-626.653) (-627.634) * (-633.027) (-627.210) [-625.865] (-628.473) -- 0:00:04
924000 -- (-624.799) [-626.793] (-630.670) (-625.970) * [-627.309] (-627.332) (-625.503) (-626.542) -- 0:00:04
924500 -- [-626.762] (-626.453) (-628.313) (-627.941) * (-627.155) (-627.348) [-628.517] (-625.806) -- 0:00:04
925000 -- (-626.245) [-626.096] (-626.382) (-627.267) * (-625.466) (-626.373) (-630.651) [-625.831] -- 0:00:04
Average standard deviation of split frequencies: 0.007127
925500 -- (-627.218) [-625.059] (-627.896) (-628.977) * (-625.988) (-625.372) [-628.679] (-625.654) -- 0:00:04
926000 -- (-629.046) [-626.721] (-629.848) (-626.426) * (-627.403) [-624.668] (-628.641) (-631.776) -- 0:00:04
926500 -- (-627.154) [-626.275] (-624.957) (-627.422) * (-630.364) [-626.649] (-626.456) (-626.509) -- 0:00:04
927000 -- (-627.146) [-629.293] (-625.270) (-626.962) * [-625.178] (-628.355) (-625.330) (-626.233) -- 0:00:04
927500 -- (-626.718) [-629.100] (-628.905) (-628.478) * (-629.274) (-627.098) [-625.651] (-628.585) -- 0:00:04
928000 -- (-627.928) [-626.760] (-625.845) (-629.728) * (-628.340) [-630.256] (-625.751) (-629.754) -- 0:00:04
928500 -- (-629.339) (-626.949) [-626.185] (-628.576) * (-627.013) (-625.052) [-626.077] (-627.582) -- 0:00:04
929000 -- (-628.089) [-625.429] (-627.391) (-629.311) * (-626.554) (-626.574) (-624.812) [-625.391] -- 0:00:04
929500 -- (-628.869) (-625.430) (-626.713) [-627.833] * (-630.098) (-629.012) [-625.478] (-625.657) -- 0:00:04
930000 -- (-625.734) (-625.430) [-628.031] (-629.529) * [-629.567] (-627.886) (-626.755) (-630.934) -- 0:00:04
Average standard deviation of split frequencies: 0.006853
930500 -- (-629.048) (-626.976) (-625.297) [-626.920] * (-628.865) (-630.406) (-626.016) [-627.132] -- 0:00:04
931000 -- (-630.538) [-627.022] (-628.625) (-627.513) * [-627.366] (-630.362) (-625.472) (-625.960) -- 0:00:04
931500 -- (-625.922) [-625.555] (-626.219) (-627.755) * (-628.184) (-632.016) (-626.179) [-625.127] -- 0:00:04
932000 -- [-626.768] (-626.764) (-625.969) (-625.906) * (-627.993) (-632.356) (-627.149) [-625.007] -- 0:00:04
932500 -- (-631.711) (-628.239) (-626.013) [-627.913] * (-627.408) (-627.624) (-627.078) [-627.568] -- 0:00:04
933000 -- (-627.633) (-627.074) (-626.231) [-625.831] * (-628.112) (-627.954) (-628.288) [-625.459] -- 0:00:04
933500 -- (-627.689) (-627.559) (-627.958) [-626.960] * (-627.088) (-627.427) (-627.803) [-628.636] -- 0:00:04
934000 -- (-630.285) [-626.895] (-629.486) (-628.998) * (-628.221) (-626.824) [-628.979] (-629.300) -- 0:00:04
934500 -- [-627.691] (-627.794) (-627.562) (-626.340) * (-626.922) [-626.186] (-629.094) (-629.216) -- 0:00:04
935000 -- (-626.415) (-629.545) [-625.777] (-628.848) * (-625.542) [-629.805] (-626.417) (-630.446) -- 0:00:04
Average standard deviation of split frequencies: 0.006607
935500 -- (-625.123) (-627.390) [-625.630] (-627.251) * [-625.772] (-630.450) (-626.068) (-626.781) -- 0:00:04
936000 -- (-625.645) [-626.784] (-627.674) (-626.707) * [-627.254] (-629.087) (-627.550) (-628.105) -- 0:00:04
936500 -- (-629.172) (-626.187) [-627.324] (-626.871) * (-631.225) [-629.092] (-629.994) (-629.802) -- 0:00:04
937000 -- [-627.064] (-638.616) (-627.686) (-628.263) * [-630.652] (-628.009) (-624.969) (-627.720) -- 0:00:03
937500 -- (-631.693) (-629.148) (-633.296) [-628.859] * (-629.198) (-625.914) (-632.383) [-626.013] -- 0:00:03
938000 -- (-630.018) [-629.454] (-627.295) (-626.540) * (-625.259) (-627.199) (-626.620) [-626.140] -- 0:00:03
938500 -- (-626.409) (-625.783) [-628.135] (-625.848) * [-627.927] (-625.984) (-628.668) (-625.591) -- 0:00:03
939000 -- [-627.807] (-624.807) (-630.042) (-628.249) * (-627.225) [-626.603] (-627.053) (-628.822) -- 0:00:03
939500 -- [-626.768] (-625.636) (-625.305) (-627.749) * (-628.159) (-630.695) [-628.026] (-627.260) -- 0:00:03
940000 -- (-626.560) (-625.147) (-626.632) [-629.035] * (-626.457) [-628.020] (-626.712) (-625.690) -- 0:00:03
Average standard deviation of split frequencies: 0.006662
940500 -- (-626.438) [-627.108] (-624.768) (-628.252) * [-626.303] (-626.051) (-631.008) (-629.750) -- 0:00:03
941000 -- [-625.855] (-626.880) (-625.427) (-627.739) * (-625.572) [-625.010] (-627.327) (-627.625) -- 0:00:03
941500 -- [-628.944] (-626.362) (-626.801) (-631.198) * (-625.806) (-625.310) (-630.453) [-629.788] -- 0:00:03
942000 -- (-630.188) (-626.367) (-629.661) [-627.600] * [-626.336] (-626.213) (-626.669) (-627.869) -- 0:00:03
942500 -- (-635.489) (-625.944) (-627.053) [-626.557] * [-627.015] (-626.632) (-628.720) (-629.329) -- 0:00:03
943000 -- (-626.849) [-627.390] (-628.880) (-629.233) * (-627.277) [-626.770] (-626.478) (-626.145) -- 0:00:03
943500 -- (-626.981) (-627.278) (-629.094) [-627.081] * (-627.223) [-628.127] (-625.863) (-625.878) -- 0:00:03
944000 -- (-628.059) (-627.331) [-625.209] (-626.494) * (-626.758) (-632.922) [-628.464] (-625.247) -- 0:00:03
944500 -- [-625.518] (-628.042) (-628.515) (-625.804) * (-628.486) (-627.442) [-627.124] (-626.225) -- 0:00:03
945000 -- (-629.626) (-626.961) [-625.773] (-625.726) * (-627.085) (-630.274) (-628.630) [-625.011] -- 0:00:03
Average standard deviation of split frequencies: 0.006332
945500 -- (-627.984) (-630.548) (-627.560) [-625.099] * (-625.326) (-634.935) (-626.116) [-624.931] -- 0:00:03
946000 -- [-626.037] (-625.054) (-630.101) (-625.560) * (-629.563) (-637.857) [-627.534] (-625.500) -- 0:00:03
946500 -- (-627.495) (-625.055) [-626.455] (-625.237) * (-626.516) (-633.738) [-628.047] (-625.468) -- 0:00:03
947000 -- [-626.557] (-626.043) (-625.455) (-627.085) * (-628.727) (-625.799) [-627.424] (-627.350) -- 0:00:03
947500 -- (-627.091) (-625.452) (-628.109) [-633.281] * [-626.082] (-627.591) (-628.636) (-625.267) -- 0:00:03
948000 -- (-627.292) (-625.481) [-628.802] (-625.978) * (-627.604) [-627.826] (-626.659) (-626.438) -- 0:00:03
948500 -- (-625.488) [-628.061] (-627.617) (-628.858) * [-627.223] (-628.131) (-626.886) (-629.478) -- 0:00:03
949000 -- (-626.460) [-627.513] (-628.993) (-626.457) * (-625.434) [-629.880] (-628.773) (-626.208) -- 0:00:03
949500 -- (-627.580) (-630.297) [-631.840] (-633.672) * [-625.311] (-629.234) (-627.097) (-626.867) -- 0:00:03
950000 -- (-630.202) (-628.317) [-631.554] (-627.838) * (-625.549) (-629.668) [-625.425] (-625.749) -- 0:00:03
Average standard deviation of split frequencies: 0.006125
950500 -- (-626.308) [-626.332] (-631.623) (-627.694) * (-627.101) (-628.943) [-628.519] (-625.517) -- 0:00:03
951000 -- (-631.652) (-627.032) [-625.521] (-628.279) * [-628.813] (-630.995) (-626.928) (-625.461) -- 0:00:03
951500 -- [-626.636] (-627.858) (-627.618) (-628.138) * [-625.984] (-627.330) (-625.121) (-625.377) -- 0:00:03
952000 -- (-629.109) (-624.818) (-627.575) [-626.582] * [-633.064] (-628.940) (-633.348) (-625.214) -- 0:00:03
952500 -- [-629.436] (-626.995) (-630.660) (-625.091) * (-631.392) (-627.698) (-630.889) [-627.246] -- 0:00:02
953000 -- (-627.695) (-625.759) [-627.070] (-628.006) * [-625.583] (-628.146) (-629.500) (-625.297) -- 0:00:02
953500 -- (-625.541) [-625.143] (-628.555) (-627.920) * (-627.452) [-628.533] (-631.710) (-625.379) -- 0:00:02
954000 -- (-625.597) [-626.678] (-625.911) (-629.159) * [-627.791] (-633.542) (-626.726) (-626.098) -- 0:00:02
954500 -- [-628.380] (-626.237) (-625.577) (-627.852) * [-627.460] (-629.245) (-631.110) (-625.709) -- 0:00:02
955000 -- [-626.800] (-626.726) (-627.837) (-626.610) * [-626.367] (-628.072) (-626.493) (-625.020) -- 0:00:02
Average standard deviation of split frequencies: 0.006010
955500 -- (-626.177) (-628.271) (-628.456) [-628.089] * [-629.259] (-630.433) (-624.982) (-625.505) -- 0:00:02
956000 -- (-630.382) [-626.818] (-625.718) (-627.668) * (-625.234) (-626.772) [-626.937] (-626.138) -- 0:00:02
956500 -- (-626.183) (-627.830) (-628.325) [-628.927] * [-629.010] (-627.122) (-628.950) (-626.497) -- 0:00:02
957000 -- (-628.954) (-628.988) (-627.527) [-627.138] * (-625.321) [-626.342] (-628.748) (-626.389) -- 0:00:02
957500 -- [-625.744] (-626.988) (-627.581) (-626.259) * (-627.869) (-629.431) [-625.804] (-627.864) -- 0:00:02
958000 -- (-628.959) (-625.398) [-625.350] (-627.297) * (-628.074) [-627.002] (-627.935) (-628.456) -- 0:00:02
958500 -- (-626.065) (-626.615) (-626.933) [-625.879] * (-627.197) (-626.709) (-628.009) [-625.972] -- 0:00:02
959000 -- (-628.995) (-628.481) (-626.496) [-625.612] * [-628.177] (-628.478) (-627.195) (-626.582) -- 0:00:02
959500 -- (-633.156) (-628.558) [-626.836] (-630.808) * (-628.666) (-628.333) [-627.361] (-624.823) -- 0:00:02
960000 -- (-632.833) (-627.854) [-632.238] (-626.852) * [-627.177] (-630.603) (-627.673) (-627.737) -- 0:00:02
Average standard deviation of split frequencies: 0.006437
960500 -- (-629.760) [-625.838] (-630.406) (-626.913) * (-626.866) [-625.654] (-626.068) (-628.197) -- 0:00:02
961000 -- (-625.781) (-630.543) (-627.235) [-627.115] * (-625.833) (-626.827) (-628.894) [-628.124] -- 0:00:02
961500 -- (-626.560) (-626.567) [-626.045] (-627.831) * (-627.433) (-627.048) [-627.024] (-629.353) -- 0:00:02
962000 -- (-624.977) [-627.079] (-629.768) (-626.948) * (-631.774) (-629.144) [-625.328] (-630.396) -- 0:00:02
962500 -- [-625.601] (-625.833) (-629.466) (-633.226) * [-627.627] (-630.091) (-625.306) (-625.194) -- 0:00:02
963000 -- (-627.892) (-627.177) (-628.274) [-626.203] * (-627.604) (-626.351) (-627.409) [-626.450] -- 0:00:02
963500 -- (-626.552) [-627.061] (-626.389) (-626.095) * (-625.676) [-628.649] (-631.804) (-627.108) -- 0:00:02
964000 -- [-626.406] (-629.328) (-625.903) (-629.176) * (-628.471) [-626.646] (-629.038) (-628.574) -- 0:00:02
964500 -- (-626.430) (-630.798) [-632.000] (-628.302) * [-626.294] (-625.252) (-627.657) (-625.052) -- 0:00:02
965000 -- (-627.142) [-627.124] (-628.460) (-625.376) * (-626.748) (-627.362) [-626.142] (-629.152) -- 0:00:02
Average standard deviation of split frequencies: 0.006344
965500 -- (-628.095) (-630.394) [-630.943] (-628.611) * [-626.726] (-629.627) (-625.199) (-632.213) -- 0:00:02
966000 -- (-624.719) (-627.123) (-628.872) [-626.282] * (-627.849) [-628.397] (-624.966) (-629.120) -- 0:00:02
966500 -- (-624.700) [-629.844] (-630.146) (-626.515) * (-630.910) [-630.051] (-625.225) (-625.535) -- 0:00:02
967000 -- (-625.755) [-626.281] (-629.790) (-626.689) * (-626.644) (-628.414) (-625.795) [-624.847] -- 0:00:02
967500 -- (-625.963) (-628.036) [-625.391] (-629.618) * (-626.546) [-628.018] (-626.677) (-626.972) -- 0:00:02
968000 -- [-627.091] (-626.924) (-625.171) (-629.726) * (-631.581) [-629.015] (-625.722) (-633.137) -- 0:00:02
968500 -- [-625.653] (-626.059) (-626.722) (-631.215) * (-630.412) (-627.405) (-626.845) [-628.996] -- 0:00:01
969000 -- (-624.910) (-630.665) (-626.248) [-627.390] * [-625.348] (-629.445) (-628.743) (-631.031) -- 0:00:01
969500 -- [-630.362] (-628.343) (-626.869) (-628.992) * (-625.230) (-628.246) [-626.315] (-627.715) -- 0:00:01
970000 -- (-626.610) [-627.630] (-627.977) (-628.024) * (-625.239) (-627.195) (-629.858) [-625.508] -- 0:00:01
Average standard deviation of split frequencies: 0.006192
970500 -- (-627.934) (-627.128) [-627.594] (-625.802) * (-626.831) (-627.038) (-629.023) [-626.471] -- 0:00:01
971000 -- [-625.242] (-629.135) (-630.648) (-627.304) * (-629.038) (-627.287) (-626.037) [-625.263] -- 0:00:01
971500 -- [-626.645] (-630.621) (-627.960) (-631.438) * (-629.513) [-628.813] (-628.066) (-625.340) -- 0:00:01
972000 -- [-624.749] (-626.257) (-628.159) (-625.530) * (-628.446) (-629.342) [-628.894] (-629.282) -- 0:00:01
972500 -- (-625.436) (-626.294) (-627.712) [-625.937] * (-630.956) (-630.194) [-627.952] (-628.094) -- 0:00:01
973000 -- (-628.773) (-630.040) (-625.801) [-626.625] * (-629.174) (-626.906) [-625.858] (-626.509) -- 0:00:01
973500 -- (-627.147) [-627.334] (-625.071) (-625.946) * (-627.932) [-629.967] (-625.337) (-627.271) -- 0:00:01
974000 -- (-625.914) [-625.676] (-624.797) (-626.110) * (-625.142) (-630.802) (-625.182) [-626.941] -- 0:00:01
974500 -- (-625.882) (-626.351) [-628.258] (-626.422) * (-627.161) (-629.993) (-625.340) [-625.009] -- 0:00:01
975000 -- (-625.171) (-628.185) (-631.495) [-626.111] * (-628.243) (-627.725) (-626.652) [-626.472] -- 0:00:01
Average standard deviation of split frequencies: 0.006790
975500 -- (-626.893) (-627.876) (-626.829) [-627.775] * (-626.214) (-629.645) (-625.278) [-631.091] -- 0:00:01
976000 -- (-626.843) (-626.435) (-627.565) [-626.484] * [-628.317] (-625.813) (-626.077) (-627.741) -- 0:00:01
976500 -- (-626.493) (-625.877) [-629.225] (-625.659) * (-625.167) [-627.219] (-626.857) (-626.569) -- 0:00:01
977000 -- (-627.845) (-626.065) [-626.516] (-625.773) * (-625.006) [-625.928] (-627.488) (-627.442) -- 0:00:01
977500 -- (-627.228) [-626.006] (-629.900) (-628.449) * (-627.778) [-628.570] (-627.996) (-628.345) -- 0:00:01
978000 -- (-627.391) (-632.401) [-627.302] (-627.712) * (-627.425) (-626.187) [-628.436] (-629.048) -- 0:00:01
978500 -- (-629.225) (-629.017) [-630.961] (-626.955) * (-633.067) (-629.933) [-629.194] (-627.719) -- 0:00:01
979000 -- (-627.439) [-628.464] (-626.780) (-624.972) * (-630.399) (-629.516) [-625.854] (-629.550) -- 0:00:01
979500 -- (-625.710) (-629.546) [-628.909] (-628.042) * (-627.200) (-627.008) (-629.416) [-626.438] -- 0:00:01
980000 -- (-625.328) [-626.093] (-632.911) (-626.350) * [-627.649] (-624.663) (-629.307) (-625.787) -- 0:00:01
Average standard deviation of split frequencies: 0.006673
980500 -- [-626.765] (-626.905) (-629.976) (-626.264) * (-626.606) [-625.267] (-629.225) (-628.309) -- 0:00:01
981000 -- [-626.966] (-625.566) (-627.042) (-632.732) * (-627.050) (-630.662) [-629.212] (-628.361) -- 0:00:01
981500 -- (-624.868) (-627.634) (-627.180) [-627.421] * (-626.709) (-626.477) (-629.969) [-628.608] -- 0:00:01
982000 -- [-627.329] (-628.656) (-627.057) (-626.356) * (-626.121) (-626.711) (-629.317) [-626.137] -- 0:00:01
982500 -- [-625.773] (-631.353) (-627.628) (-629.368) * (-629.273) (-626.674) (-628.673) [-630.732] -- 0:00:01
983000 -- (-626.156) (-631.037) [-626.393] (-626.495) * (-630.674) (-625.965) (-625.709) [-625.404] -- 0:00:01
983500 -- (-628.714) (-626.467) [-625.755] (-627.706) * (-625.199) (-626.598) [-626.701] (-626.260) -- 0:00:01
984000 -- [-626.183] (-630.194) (-626.255) (-625.929) * (-627.799) (-626.913) (-625.970) [-626.327] -- 0:00:01
984500 -- [-624.944] (-626.077) (-626.072) (-629.437) * [-625.372] (-625.783) (-629.347) (-629.215) -- 0:00:00
985000 -- (-626.803) [-628.047] (-626.432) (-626.676) * (-628.947) [-627.103] (-625.799) (-625.475) -- 0:00:00
Average standard deviation of split frequencies: 0.007031
985500 -- [-626.195] (-625.860) (-626.738) (-628.194) * (-629.692) (-627.723) (-626.364) [-627.241] -- 0:00:00
986000 -- [-625.886] (-626.839) (-626.208) (-628.640) * (-626.277) (-625.559) (-625.871) [-625.909] -- 0:00:00
986500 -- [-625.217] (-626.771) (-629.528) (-627.584) * (-627.741) (-627.993) (-626.362) [-626.684] -- 0:00:00
987000 -- (-625.682) (-627.979) [-627.664] (-626.734) * (-626.212) [-627.169] (-631.239) (-631.300) -- 0:00:00
987500 -- [-625.920] (-632.559) (-625.853) (-629.764) * (-628.336) (-625.700) (-628.624) [-626.313] -- 0:00:00
988000 -- (-626.660) (-626.737) [-625.696] (-627.567) * (-626.961) [-627.231] (-627.425) (-625.770) -- 0:00:00
988500 -- [-627.343] (-627.330) (-625.431) (-627.697) * (-626.036) (-631.351) (-625.085) [-627.513] -- 0:00:00
989000 -- (-627.834) (-626.060) [-625.765] (-627.936) * (-626.802) (-630.802) [-625.227] (-627.468) -- 0:00:00
989500 -- [-627.221] (-629.475) (-628.302) (-626.469) * (-625.005) [-626.294] (-626.158) (-627.204) -- 0:00:00
990000 -- [-626.498] (-626.767) (-625.601) (-625.744) * (-626.550) [-626.304] (-626.363) (-628.806) -- 0:00:00
Average standard deviation of split frequencies: 0.007390
990500 -- (-630.054) (-625.638) [-626.419] (-625.062) * (-627.848) (-626.366) [-627.628] (-630.477) -- 0:00:00
991000 -- (-626.455) (-627.232) (-626.587) [-625.124] * (-630.889) (-627.225) [-626.072] (-628.330) -- 0:00:00
991500 -- (-625.147) (-629.259) (-625.117) [-625.681] * (-628.342) [-627.997] (-627.233) (-625.436) -- 0:00:00
992000 -- (-625.201) [-626.294] (-625.318) (-626.820) * (-628.624) (-628.576) [-625.499] (-629.821) -- 0:00:00
992500 -- (-628.233) (-628.311) (-627.800) [-629.341] * (-629.637) (-625.450) [-625.318] (-625.872) -- 0:00:00
993000 -- (-626.295) [-629.737] (-625.903) (-630.387) * (-628.733) [-625.609] (-627.386) (-631.759) -- 0:00:00
993500 -- (-629.623) [-625.191] (-629.564) (-630.877) * (-628.767) (-625.268) [-626.640] (-633.945) -- 0:00:00
994000 -- (-628.713) [-626.009] (-629.932) (-627.498) * (-628.107) [-625.929] (-627.760) (-629.994) -- 0:00:00
994500 -- (-626.035) (-625.375) (-629.166) [-627.586] * (-626.974) [-626.009] (-627.275) (-626.609) -- 0:00:00
995000 -- (-628.590) [-626.277] (-626.628) (-628.723) * (-626.946) (-625.073) (-625.248) [-626.360] -- 0:00:00
Average standard deviation of split frequencies: 0.007601
995500 -- (-626.565) (-630.106) (-626.007) [-627.681] * [-627.721] (-624.973) (-625.631) (-629.462) -- 0:00:00
996000 -- (-624.901) [-625.784] (-630.451) (-627.177) * (-625.855) [-626.876] (-625.591) (-626.894) -- 0:00:00
996500 -- (-624.842) (-625.661) [-628.995] (-626.959) * [-625.231] (-626.317) (-626.576) (-629.100) -- 0:00:00
997000 -- (-625.736) [-625.195] (-627.354) (-627.166) * [-625.380] (-625.480) (-628.380) (-628.192) -- 0:00:00
997500 -- (-627.415) (-626.889) [-626.639] (-632.970) * [-629.316] (-632.508) (-626.924) (-629.663) -- 0:00:00
998000 -- (-629.905) [-627.594] (-624.964) (-626.444) * (-629.703) (-628.765) [-630.307] (-628.314) -- 0:00:00
998500 -- (-629.273) (-632.413) (-626.976) [-625.094] * (-627.191) (-628.816) [-631.446] (-627.242) -- 0:00:00
999000 -- (-628.432) (-630.298) (-625.450) [-626.237] * (-625.036) [-627.275] (-631.903) (-625.488) -- 0:00:00
999500 -- (-626.227) (-626.876) (-627.185) [-626.237] * (-625.430) (-626.640) (-630.328) [-626.858] -- 0:00:00
1000000 -- [-624.944] (-626.469) (-631.288) (-629.473) * [-631.342] (-626.446) (-627.576) (-627.111) -- 0:00:00
Average standard deviation of split frequencies: 0.007731
Analysis completed in 1 mins 3 seconds
Analysis used 62.17 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -624.54
Likelihood of best state for "cold" chain of run 2 was -624.54
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 59 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
31.7 % ( 22 %) Dirichlet(Pi{all})
33.3 % ( 32 %) Slider(Pi{all})
79.2 % ( 55 %) Multiplier(Alpha{1,2})
77.5 % ( 55 %) Multiplier(Alpha{3})
23.8 % ( 20 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.4 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.2 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
32.3 % ( 20 %) Dirichlet(Pi{all})
34.2 % ( 27 %) Slider(Pi{all})
78.7 % ( 50 %) Multiplier(Alpha{1,2})
77.5 % ( 56 %) Multiplier(Alpha{3})
23.7 % ( 21 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.6 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166289 0.82 0.67
3 | 166232 166783 0.84
4 | 166773 166973 166950
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166478 0.82 0.67
3 | 166517 166819 0.84
4 | 167824 166259 166103
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -626.21
|1 1 1 |
| 2 1 2 1 |
| 1 1 1 2 1 2 |
| 22 1 21 2 1|
| 2 12 * |
| 2 2 11 1 2 2 22 1 12 2 11 |
| *2 112 *2 1 1 1 221 1 1 |
| 1 * 2 11 1 1 1 * 1 1 2 2 22 2|
| 1 1 2 1 2 2 2 2 2 1* |
|2 1 1 2 22 11 2 * 1 2 |
| 21 2 11 1 1 2 |
| 2 2 2 21 |
| 21 2 2 1 |
| |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -627.89
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -626.23 -629.90
2 -626.24 -630.61
--------------------------------------
TOTAL -626.23 -630.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886971 0.085846 0.384532 1.458633 0.850121 1452.04 1454.85 1.000
r(A<->C){all} 0.178483 0.021159 0.000031 0.458376 0.146321 106.19 249.33 1.008
r(A<->G){all} 0.159389 0.017365 0.000012 0.420971 0.127049 221.02 244.15 1.002
r(A<->T){all} 0.163371 0.017520 0.000621 0.426681 0.129967 163.74 252.40 1.004
r(C<->G){all} 0.164594 0.018667 0.000030 0.440226 0.131792 189.25 240.53 1.007
r(C<->T){all} 0.168440 0.020874 0.000024 0.456280 0.132588 273.34 356.15 1.001
r(G<->T){all} 0.165724 0.020680 0.000001 0.463767 0.123291 271.68 332.17 1.000
pi(A){all} 0.202830 0.000345 0.166076 0.238816 0.202215 1303.39 1374.75 1.000
pi(C){all} 0.287696 0.000428 0.246638 0.326871 0.287956 1171.65 1255.15 1.000
pi(G){all} 0.320773 0.000439 0.278479 0.359412 0.320602 981.97 1115.18 1.001
pi(T){all} 0.188701 0.000327 0.152602 0.223223 0.187955 1038.64 1113.71 1.001
alpha{1,2} 0.438900 0.253876 0.000100 1.410039 0.255783 1096.16 1166.87 1.001
alpha{3} 0.452962 0.223648 0.000145 1.408192 0.289632 1141.56 1321.28 1.000
pinvar{all} 0.996545 0.000019 0.989027 1.000000 0.997906 999.28 1182.69 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .***.*
9 -- ..*.*.
10 -- ...*.*
11 -- ..*..*
12 -- .*.*..
13 -- .****.
14 -- ...**.
15 -- .*.***
16 -- .*...*
17 -- .*..*.
18 -- ..**..
19 -- ..****
20 -- .**.**
21 -- ....**
22 -- .***..
23 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 451 0.150233 0.022141 0.134577 0.165889 2
8 444 0.147901 0.009422 0.141239 0.154564 2
9 442 0.147235 0.004711 0.143904 0.150566 2
10 438 0.145903 0.012248 0.137242 0.154564 2
11 433 0.144237 0.008951 0.137908 0.150566 2
12 431 0.143571 0.005182 0.139907 0.147235 2
13 430 0.143238 0.003769 0.140573 0.145903 2
14 428 0.142572 0.004711 0.139241 0.145903 2
15 425 0.141572 0.004240 0.138574 0.144570 2
16 425 0.141572 0.000471 0.141239 0.141905 2
17 424 0.141239 0.003769 0.138574 0.143904 2
18 417 0.138907 0.007066 0.133911 0.143904 2
19 410 0.136576 0.010364 0.129247 0.143904 2
20 403 0.134244 0.001413 0.133245 0.135243 2
21 401 0.133578 0.009893 0.126582 0.140573 2
22 289 0.096269 0.013662 0.086609 0.105929 2
23 286 0.095270 0.009422 0.088608 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097909 0.009225 0.000011 0.284566 0.068391 1.000 2
length{all}[2] 0.099586 0.009936 0.000072 0.302480 0.069768 1.000 2
length{all}[3] 0.100745 0.009654 0.000004 0.303698 0.072242 1.000 2
length{all}[4] 0.098119 0.009691 0.000066 0.291961 0.066868 1.002 2
length{all}[5] 0.101275 0.010397 0.000039 0.307064 0.068974 1.000 2
length{all}[6] 0.096605 0.009235 0.000014 0.281637 0.065919 1.000 2
length{all}[7] 0.091715 0.008014 0.000624 0.273061 0.061381 0.998 2
length{all}[8] 0.106873 0.011305 0.000058 0.314372 0.074977 1.003 2
length{all}[9] 0.096557 0.009750 0.000074 0.311157 0.068194 1.008 2
length{all}[10] 0.091034 0.007722 0.000058 0.253478 0.067599 0.998 2
length{all}[11] 0.087655 0.008562 0.000122 0.271236 0.059343 0.998 2
length{all}[12] 0.109212 0.011797 0.000098 0.298966 0.078104 0.998 2
length{all}[13] 0.099071 0.010442 0.000284 0.298417 0.064378 0.998 2
length{all}[14] 0.098862 0.008759 0.000074 0.281038 0.070165 1.005 2
length{all}[15] 0.097166 0.009996 0.000028 0.283640 0.064903 1.000 2
length{all}[16] 0.098152 0.008703 0.000510 0.284438 0.072807 0.999 2
length{all}[17] 0.092159 0.009298 0.000324 0.279061 0.061224 0.998 2
length{all}[18] 0.095103 0.010434 0.000235 0.265896 0.063788 0.999 2
length{all}[19] 0.093883 0.008524 0.000136 0.271177 0.068532 1.003 2
length{all}[20] 0.097533 0.010517 0.000233 0.295967 0.063028 0.999 2
length{all}[21] 0.096517 0.007090 0.000203 0.267207 0.074091 0.998 2
length{all}[22] 0.094399 0.011051 0.000057 0.305430 0.058159 1.010 2
length{all}[23] 0.101677 0.011493 0.001130 0.321808 0.069404 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007731
Maximum standard deviation of split frequencies = 0.022141
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 459
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 50 patterns at 153 / 153 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 50 patterns at 153 / 153 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
48800 bytes for conP
4400 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.083038 0.088450 0.080967 0.052268 0.088305 0.027614 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -667.833187
Iterating by ming2
Initial: fx= 667.833187
x= 0.08304 0.08845 0.08097 0.05227 0.08830 0.02761 0.30000 1.30000
1 h-m-p 0.0000 0.0002 365.1443 +++ 643.262433 m 0.0002 14 | 1/8
2 h-m-p 0.0014 0.0075 43.9776 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 334.4382 +++ 624.782648 m 0.0002 46 | 2/8
4 h-m-p 0.0016 0.0113 30.8374 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 300.0748 +++ 607.369532 m 0.0002 78 | 3/8
6 h-m-p 0.0025 0.0204 19.8363 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 261.1169 ++ 606.419954 m 0.0000 110 | 4/8
8 h-m-p 0.0002 0.0398 12.9196 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 213.2118 ++ 604.807997 m 0.0000 140 | 5/8
10 h-m-p 0.0006 0.0636 8.6533 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 150.9008 ++ 604.785690 m 0.0000 171 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 ------C 604.785690 0 0.0000 188 | 6/8
13 h-m-p 0.0419 8.0000 0.0000 -C 604.785690 0 0.0026 202
Out..
lnL = -604.785690
203 lfun, 203 eigenQcodon, 1218 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.090786 0.034689 0.045930 0.051465 0.034178 0.093711 0.299881 0.541457 0.319386
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.700467
np = 9
lnL0 = -656.060883
Iterating by ming2
Initial: fx= 656.060883
x= 0.09079 0.03469 0.04593 0.05146 0.03418 0.09371 0.29988 0.54146 0.31939
1 h-m-p 0.0000 0.0002 346.5962 +++ 626.620366 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0000 144.9616 ++ 626.234999 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0000 7796.7046 ++ 619.685011 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 107334.8265 ++ 617.232345 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 30257.3224 ++ 605.259467 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 1023.1026 ++ 604.785709 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0003 ----------------.. | 6/9
8 h-m-p 0.0160 8.0000 0.0001 +++++ 604.785709 m 8.0000 119 | 6/9
9 h-m-p 0.0058 2.9088 0.2546 +++++ 604.785690 m 2.9088 137 | 7/9
10 h-m-p 0.3162 1.5810 0.0882 ++ 604.785690 m 1.5810 152 | 8/9
11 h-m-p 1.2942 6.4708 0.0796 ---Y 604.785690 0 0.0051 169 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 N 604.785690 0 1.6000 182
Out..
lnL = -604.785690
183 lfun, 549 eigenQcodon, 2196 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070304 0.019679 0.041067 0.082959 0.036414 0.079009 0.000100 1.298016 0.348484 0.160081 1.389254
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 13.384359
np = 11
lnL0 = -650.771837
Iterating by ming2
Initial: fx= 650.771837
x= 0.07030 0.01968 0.04107 0.08296 0.03641 0.07901 0.00011 1.29802 0.34848 0.16008 1.38925
1 h-m-p 0.0000 0.0000 316.9850 ++ 650.353796 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 181.3320 +++ 634.212953 m 0.0006 31 | 2/11
3 h-m-p 0.0001 0.0003 157.2412 ++ 624.398803 m 0.0003 45 | 3/11
4 h-m-p 0.0001 0.0005 58.6988 ++ 622.076526 m 0.0005 59 | 4/11
5 h-m-p 0.0000 0.0000 662.6928 ++ 621.467664 m 0.0000 73 | 5/11
6 h-m-p 0.0002 0.0102 16.7838 +++ 621.233205 m 0.0102 88 | 6/11
7 h-m-p 0.0001 0.0004 73.1929 ++ 617.965685 m 0.0004 102 | 7/11
8 h-m-p 0.0001 0.0155 71.7574 ++++ 604.785707 m 0.0155 118 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 604.785707 m 8.0000 132 | 8/11
10 h-m-p 0.0160 8.0000 0.0180 --------Y 604.785707 0 0.0000 157 | 8/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 604.785707 m 8.0000 177 | 8/11
12 h-m-p 0.0160 8.0000 2.3723 +++Y 604.785686 0 2.4959 197 | 8/11
13 h-m-p 1.6000 8.0000 0.2708 ++ 604.785685 m 8.0000 211 | 8/11
14 h-m-p 1.6000 8.0000 0.4020 C 604.785685 0 0.5410 228 | 8/11
15 h-m-p 1.6000 8.0000 0.0125 C 604.785685 0 1.2836 245 | 8/11
16 h-m-p 1.6000 8.0000 0.0005 ++ 604.785685 m 8.0000 262 | 8/11
17 h-m-p 0.0879 8.0000 0.0410 ++C 604.785685 0 1.5397 281 | 8/11
18 h-m-p 1.6000 8.0000 0.0008 ++ 604.785685 m 8.0000 298 | 8/11
19 h-m-p 0.0014 0.7084 5.6617 ----------C 604.785685 0 0.0000 325 | 8/11
20 h-m-p 0.0055 2.7409 66.1786 +++++ 604.785674 m 2.7409 342 | 8/11
21 h-m-p -0.0000 -0.0000 0.4784
h-m-p: -0.00000000e+00 -0.00000000e+00 4.78379337e-01 604.785674
.. | 8/11
22 h-m-p 0.0160 8.0000 0.0000 Y 604.785674 0 0.0160 370 | 8/11
23 h-m-p 0.2143 8.0000 0.0000 -C 604.785674 0 0.0134 388
Out..
lnL = -604.785674
389 lfun, 1556 eigenQcodon, 7002 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -604.782131 S = -604.782075 -0.000022
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:02
did 20 / 50 patterns 0:02
did 30 / 50 patterns 0:03
did 40 / 50 patterns 0:03
did 50 / 50 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067596 0.103535 0.057447 0.058747 0.013560 0.013327 0.000100 0.934600 1.107347
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.311674
np = 9
lnL0 = -650.559364
Iterating by ming2
Initial: fx= 650.559364
x= 0.06760 0.10353 0.05745 0.05875 0.01356 0.01333 0.00011 0.93460 1.10735
1 h-m-p 0.0000 0.0000 345.1190 ++ 649.942506 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0258 36.5634 +++++ 632.708189 m 0.0258 29 | 2/9
3 h-m-p 0.0001 0.0006 229.8709 ++ 622.420562 m 0.0006 41 | 3/9
4 h-m-p 0.0003 0.0013 103.2442 ++ 612.050612 m 0.0013 53 | 4/9
5 h-m-p 0.0023 0.0114 15.1953 ------------.. | 4/9
6 h-m-p 0.0000 0.0000 303.3062 ++ 610.099950 m 0.0000 87 | 5/9
7 h-m-p 0.0160 8.0000 1.6149 -------------.. | 5/9
8 h-m-p 0.0000 0.0000 262.7541 ++ 609.895250 m 0.0000 122 | 6/9
9 h-m-p 0.0160 8.0000 1.3112 -------------.. | 6/9
10 h-m-p 0.0000 0.0001 213.3462 ++ 604.805698 m 0.0001 157 | 7/9
11 h-m-p 0.0177 8.0000 0.9438 -------------.. | 7/9
12 h-m-p 0.0000 0.0000 153.5683 ++ 604.785754 m 0.0000 194 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 N 604.785754 0 1.6000 206 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 Y 604.785754 0 0.0312 219
QuantileBeta(0.15, 0.00494, 1.23220) = 7.475222e-163 2000 rounds
| 7/9
15 h-m-p 0.1713 8.0000 0.0000 +++ 604.785754 m 8.0000 234
QuantileBeta(0.15, 0.00495, 1.23220) = 3.676058e-162 2000 rounds
| 7/9
16 h-m-p 0.0013 0.0066 0.0005 C 604.785754 0 0.0003 248
QuantileBeta(0.15, 0.00495, 1.23220) = 3.639667e-162 2000 rounds
| 7/9
17 h-m-p 0.0160 8.0000 1.5000 +++++ 604.785691 m 8.0000 265 | 7/9
18 h-m-p 1.6000 8.0000 0.4881 ++ 604.785691 m 8.0000 277 | 7/9
19 h-m-p 0.1590 3.3838 24.5561 +++ 604.785690 m 3.3838 292 | 8/9
20 h-m-p 1.6000 8.0000 0.1943 -------------N 604.785690 0 0.0000 317 | 8/9
21 h-m-p 0.3144 8.0000 0.0000 -----Y 604.785690 0 0.0001 335
Out..
lnL = -604.785690
336 lfun, 3696 eigenQcodon, 20160 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042747 0.027096 0.011653 0.049619 0.045242 0.059040 0.000100 0.900000 0.602881 1.585744 1.300066
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.324603
np = 11
lnL0 = -638.525471
Iterating by ming2
Initial: fx= 638.525471
x= 0.04275 0.02710 0.01165 0.04962 0.04524 0.05904 0.00011 0.90000 0.60288 1.58574 1.30007
1 h-m-p 0.0000 0.0000 333.4179 ++ 637.838191 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0014 87.9016 +++ 628.069425 m 0.0014 31 | 2/11
3 h-m-p 0.0001 0.0003 202.0063 ++ 617.017083 m 0.0003 45 | 3/11
4 h-m-p 0.0015 0.0101 40.5994 ++ 608.852772 m 0.0101 59 | 4/11
5 h-m-p 0.0000 0.0000 138132.7326 ++ 607.725893 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0001 2860.5178 ++ 606.920796 m 0.0001 87 | 6/11
7 h-m-p 0.0003 0.0014 54.0001 ----------.. | 6/11
8 h-m-p 0.0000 0.0000 209.9248 ++ 606.305366 m 0.0000 123 | 7/11
9 h-m-p 0.0006 0.1093 3.3785 -----------.. | 7/11
10 h-m-p 0.0000 0.0001 148.8714 ++ 604.785696 m 0.0001 160 | 8/11
11 h-m-p 0.0250 8.0000 0.0000 +++++ 604.785696 m 8.0000 177 | 8/11
12 h-m-p 0.0082 4.0987 0.1552 --------N 604.785696 0 0.0000 202 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 604.785696 m 8.0000 222 | 8/11
14 h-m-p 0.0051 2.5487 0.4654 +++++ 604.785680 m 2.5487 242 | 9/11
15 h-m-p 1.6000 8.0000 0.3229 ++ 604.785678 m 8.0000 259 | 9/11
16 h-m-p 0.3435 1.7174 1.1070 ++ 604.785677 m 1.7174 275 | 9/11
17 h-m-p 0.0000 0.0000 0.4514
h-m-p: 6.09162351e-18 3.04581176e-17 4.51449145e-01 604.785677
.. | 9/11
18 h-m-p 0.0160 8.0000 0.0000 -----------Y 604.785677 0 0.0000 313 | 9/11
19 h-m-p 0.0160 8.0000 0.0000 -----------Y 604.785677 0 0.0000 340
Out..
lnL = -604.785677
341 lfun, 4092 eigenQcodon, 22506 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -604.783813 S = -604.782216 -0.000699
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:13
did 20 / 50 patterns 0:14
did 30 / 50 patterns 0:14
did 40 / 50 patterns 0:14
did 50 / 50 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=153
NC_011896_1_WP_010907685_1_375_MLBR_RS01800 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
NC_002677_1_NP_301361_1_233_rpsI VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK
**************************************************
NC_011896_1_WP_010907685_1_375_MLBR_RS01800 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
NC_002677_1_NP_301361_1_233_rpsI FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015 FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG
**************************************************
NC_011896_1_WP_010907685_1_375_MLBR_RS01800 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
NC_002677_1_NP_301361_1_233_rpsI ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015 ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY
**************************************************
NC_011896_1_WP_010907685_1_375_MLBR_RS01800 SKR
NC_002677_1_NP_301361_1_233_rpsI SKR
NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830 SKR
NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040 SKR
NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935 SKR
NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015 SKR
***
>NC_011896_1_WP_010907685_1_375_MLBR_RS01800 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC AGCAAGCGC >NC_002677_1_NP_301361_1_233_rpsI GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC AGCAAGCGC >NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC AGCAAGCGC >NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC AGCAAGCGC >NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC AGCAAGCGC >NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015 GTGACCGAAACCAGCGAAGCCGTGGAGATTGCGGTGGGGACTCCAGCAGC CAAGCATAGTGAATCTTTTGTGTTCGAGCGGTCCATCCAGACTGTTGGCC GCCGCAAAGAGGCCGTCGTGCGGGTGCGGTTGGTGCTCGGCACCGGCAAG TTCGATCTCAATGGTCGCAGCCTGGAGGACTACTTCCCGAACAAGGTGCA TCAGCAGCTCATTAAAGCACCGTTGGTCACTGTTGAGCGGACAAGGAACT TCGACATATTCGCTCTCCTACACGGTGGTGGACCATCGGGTCAGGCCGGG GCGCTTCGTCTGGGCATCGCCCGGGCGTTGATCCTGGCGTCACCGGAGGA CCGGCCCGCCTTGAAGAAGGCCGGTTTCCTCACCCGTGATCCACGCTCGA CTGAGCGCAAGAAGTATGGCTTGAAGAAGGCCCGCAAGGCGCCGCAGTAC AGCAAGCGC
>NC_011896_1_WP_010907685_1_375_MLBR_RS01800 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY SKR >NC_002677_1_NP_301361_1_233_rpsI VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY SKR >NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY SKR >NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY SKR >NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY SKR >NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015 VTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRLVLGTGK FDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAG ALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQY SKR
#NEXUS
[ID: 0483631343]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907685_1_375_MLBR_RS01800
NC_002677_1_NP_301361_1_233_rpsI
NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830
NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040
NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935
NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907685_1_375_MLBR_RS01800,
2 NC_002677_1_NP_301361_1_233_rpsI,
3 NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830,
4 NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040,
5 NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935,
6 NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06839099,2:0.06976782,3:0.07224186,4:0.06686778,5:0.06897448,6:0.0659185);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06839099,2:0.06976782,3:0.07224186,4:0.06686778,5:0.06897448,6:0.0659185);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -626.23 -629.90
2 -626.24 -630.61
--------------------------------------
TOTAL -626.23 -630.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886971 0.085846 0.384532 1.458633 0.850121 1452.04 1454.85 1.000
r(A<->C){all} 0.178483 0.021159 0.000031 0.458376 0.146321 106.19 249.33 1.008
r(A<->G){all} 0.159389 0.017365 0.000012 0.420971 0.127049 221.02 244.15 1.002
r(A<->T){all} 0.163371 0.017520 0.000621 0.426681 0.129967 163.74 252.40 1.004
r(C<->G){all} 0.164594 0.018667 0.000030 0.440226 0.131792 189.25 240.53 1.007
r(C<->T){all} 0.168440 0.020874 0.000024 0.456280 0.132588 273.34 356.15 1.001
r(G<->T){all} 0.165724 0.020680 0.000001 0.463767 0.123291 271.68 332.17 1.000
pi(A){all} 0.202830 0.000345 0.166076 0.238816 0.202215 1303.39 1374.75 1.000
pi(C){all} 0.287696 0.000428 0.246638 0.326871 0.287956 1171.65 1255.15 1.000
pi(G){all} 0.320773 0.000439 0.278479 0.359412 0.320602 981.97 1115.18 1.001
pi(T){all} 0.188701 0.000327 0.152602 0.223223 0.187955 1038.64 1113.71 1.001
alpha{1,2} 0.438900 0.253876 0.000100 1.410039 0.255783 1096.16 1166.87 1.001
alpha{3} 0.452962 0.223648 0.000145 1.408192 0.289632 1141.56 1321.28 1.000
pinvar{all} 0.996545 0.000019 0.989027 1.000000 0.997906 999.28 1182.69 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpsI/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 153
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 6 6 6 6 6 6 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 5 5 5 5 5 5 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 7 7 7 7 7 7
CTA 1 1 1 1 1 1 | CCA 3 3 3 3 3 3 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 3 3 3 3 3 3 | CCG 4 4 4 4 4 4 | CAG 5 5 5 5 5 5 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 4 4 4 4 4 4 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 4 4 4 4 4 4 | AAC 2 2 2 2 2 2 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 0 0 0 0 0 0 | AAG 11 11 11 11 11 11 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 1 1 1 1 1 1 | Asp GAT 2 2 2 2 2 2 | Gly GGT 5 5 5 5 5 5
GTC 2 2 2 2 2 2 | GCC 8 8 8 8 8 8 | GAC 3 3 3 3 3 3 | GGC 5 5 5 5 5 5
GTA 0 0 0 0 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 3 3 3 3 3 3 | GGA 1 1 1 1 1 1
GTG 8 8 8 8 8 8 | GCG 5 5 5 5 5 5 | GAG 7 7 7 7 7 7 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907685_1_375_MLBR_RS01800
position 1: T:0.13072 C:0.26797 A:0.23529 G:0.36601
position 2: T:0.26144 C:0.24837 A:0.27451 G:0.21569
position 3: T:0.16993 C:0.34641 A:0.09804 G:0.38562
Average T:0.18736 C:0.28758 A:0.20261 G:0.32244
#2: NC_002677_1_NP_301361_1_233_rpsI
position 1: T:0.13072 C:0.26797 A:0.23529 G:0.36601
position 2: T:0.26144 C:0.24837 A:0.27451 G:0.21569
position 3: T:0.16993 C:0.34641 A:0.09804 G:0.38562
Average T:0.18736 C:0.28758 A:0.20261 G:0.32244
#3: NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830
position 1: T:0.13072 C:0.26797 A:0.23529 G:0.36601
position 2: T:0.26144 C:0.24837 A:0.27451 G:0.21569
position 3: T:0.16993 C:0.34641 A:0.09804 G:0.38562
Average T:0.18736 C:0.28758 A:0.20261 G:0.32244
#4: NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040
position 1: T:0.13072 C:0.26797 A:0.23529 G:0.36601
position 2: T:0.26144 C:0.24837 A:0.27451 G:0.21569
position 3: T:0.16993 C:0.34641 A:0.09804 G:0.38562
Average T:0.18736 C:0.28758 A:0.20261 G:0.32244
#5: NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935
position 1: T:0.13072 C:0.26797 A:0.23529 G:0.36601
position 2: T:0.26144 C:0.24837 A:0.27451 G:0.21569
position 3: T:0.16993 C:0.34641 A:0.09804 G:0.38562
Average T:0.18736 C:0.28758 A:0.20261 G:0.32244
#6: NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015
position 1: T:0.13072 C:0.26797 A:0.23529 G:0.36601
position 2: T:0.26144 C:0.24837 A:0.27451 G:0.21569
position 3: T:0.16993 C:0.34641 A:0.09804 G:0.38562
Average T:0.18736 C:0.28758 A:0.20261 G:0.32244
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 36 | TCC 6 | TAC 12 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 12
CTC 30 | CCC 6 | CAC 6 | CGC 42
CTA 6 | CCA 18 | Gln Q CAA 0 | CGA 0
CTG 18 | CCG 24 | CAG 30 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 24 | Asn N AAT 6 | Ser S AGT 6
ATC 18 | ACC 24 | AAC 12 | AGC 18
ATA 6 | ACA 6 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 0 | ACG 0 | AAG 66 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 6 | Asp D GAT 12 | Gly G GGT 30
GTC 12 | GCC 48 | GAC 18 | GGC 30
GTA 0 | GCA 12 | Glu E GAA 18 | GGA 6
GTG 48 | GCG 30 | GAG 42 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13072 C:0.26797 A:0.23529 G:0.36601
position 2: T:0.26144 C:0.24837 A:0.27451 G:0.21569
position 3: T:0.16993 C:0.34641 A:0.09804 G:0.38562
Average T:0.18736 C:0.28758 A:0.20261 G:0.32244
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -604.785690 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299881 1.300066
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907685_1_375_MLBR_RS01800: 0.000004, NC_002677_1_NP_301361_1_233_rpsI: 0.000004, NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830: 0.000004, NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040: 0.000004, NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935: 0.000004, NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29988
omega (dN/dS) = 1.30007
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 365.6 93.4 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 365.6 93.4 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 365.6 93.4 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 365.6 93.4 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 365.6 93.4 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 365.6 93.4 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -604.785690 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.514363
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907685_1_375_MLBR_RS01800: 0.000004, NC_002677_1_NP_301361_1_233_rpsI: 0.000004, NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830: 0.000004, NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040: 0.000004, NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935: 0.000004, NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.51436 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 369.6 89.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 369.6 89.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 369.6 89.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 369.6 89.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 369.6 89.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 369.6 89.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -604.785674 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 0.000001 155.330237
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907685_1_375_MLBR_RS01800: 0.000004, NC_002677_1_NP_301361_1_233_rpsI: 0.000004, NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830: 0.000004, NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040: 0.000004, NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935: 0.000004, NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 155.33024
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 369.6 89.4 155.3302 0.0000 0.0000 0.0 0.0
7..2 0.000 369.6 89.4 155.3302 0.0000 0.0000 0.0 0.0
7..3 0.000 369.6 89.4 155.3302 0.0000 0.0000 0.0 0.0
7..4 0.000 369.6 89.4 155.3302 0.0000 0.0000 0.0 0.0
7..5 0.000 369.6 89.4 155.3302 0.0000 0.0000 0.0 0.0
7..6 0.000 369.6 89.4 155.3302 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907685_1_375_MLBR_RS01800)
Pr(w>1) post mean +- SE for w
1 V 1.000** 155.330
2 T 1.000** 155.330
3 E 1.000** 155.330
4 T 1.000** 155.330
5 S 1.000** 155.330
6 E 1.000** 155.330
7 A 1.000** 155.330
8 V 1.000** 155.330
9 E 1.000** 155.330
10 I 1.000** 155.330
11 A 1.000** 155.330
12 V 1.000** 155.330
13 G 1.000** 155.330
14 T 1.000** 155.330
15 P 1.000** 155.330
16 A 1.000** 155.330
17 A 1.000** 155.330
18 K 1.000** 155.330
19 H 1.000** 155.330
20 S 1.000** 155.330
21 E 1.000** 155.330
22 S 1.000** 155.330
23 F 1.000** 155.330
24 V 1.000** 155.330
25 F 1.000** 155.330
26 E 1.000** 155.330
27 R 1.000** 155.330
28 S 1.000** 155.330
29 I 1.000** 155.330
30 Q 1.000** 155.330
31 T 1.000** 155.330
32 V 1.000** 155.330
33 G 1.000** 155.330
34 R 1.000** 155.330
35 R 1.000** 155.330
36 K 1.000** 155.330
37 E 1.000** 155.330
38 A 1.000** 155.330
39 V 1.000** 155.330
40 V 1.000** 155.330
41 R 1.000** 155.330
42 V 1.000** 155.330
43 R 1.000** 155.330
44 L 1.000** 155.330
45 V 1.000** 155.330
46 L 1.000** 155.330
47 G 1.000** 155.330
48 T 1.000** 155.330
49 G 1.000** 155.330
50 K 1.000** 155.330
51 F 1.000** 155.330
52 D 1.000** 155.330
53 L 1.000** 155.330
54 N 1.000** 155.330
55 G 1.000** 155.330
56 R 1.000** 155.330
57 S 1.000** 155.330
58 L 1.000** 155.330
59 E 1.000** 155.330
60 D 1.000** 155.330
61 Y 1.000** 155.330
62 F 1.000** 155.330
63 P 1.000** 155.330
64 N 1.000** 155.330
65 K 1.000** 155.330
66 V 1.000** 155.330
67 H 1.000** 155.330
68 Q 1.000** 155.330
69 Q 1.000** 155.330
70 L 1.000** 155.330
71 I 1.000** 155.330
72 K 1.000** 155.330
73 A 1.000** 155.330
74 P 1.000** 155.330
75 L 1.000** 155.330
76 V 1.000** 155.330
77 T 1.000** 155.330
78 V 1.000** 155.330
79 E 1.000** 155.330
80 R 1.000** 155.330
81 T 1.000** 155.330
82 R 1.000** 155.330
83 N 1.000** 155.330
84 F 1.000** 155.330
85 D 1.000** 155.330
86 I 1.000** 155.330
87 F 1.000** 155.330
88 A 1.000** 155.330
89 L 1.000** 155.330
90 L 1.000** 155.330
91 H 1.000** 155.330
92 G 1.000** 155.330
93 G 1.000** 155.330
94 G 1.000** 155.330
95 P 1.000** 155.330
96 S 1.000** 155.330
97 G 1.000** 155.330
98 Q 1.000** 155.330
99 A 1.000** 155.330
100 G 1.000** 155.330
101 A 1.000** 155.330
102 L 1.000** 155.330
103 R 1.000** 155.330
104 L 1.000** 155.330
105 G 1.000** 155.330
106 I 1.000** 155.330
107 A 1.000** 155.330
108 R 1.000** 155.330
109 A 1.000** 155.330
110 L 1.000** 155.330
111 I 1.000** 155.330
112 L 1.000** 155.330
113 A 1.000** 155.330
114 S 1.000** 155.330
115 P 1.000** 155.330
116 E 1.000** 155.330
117 D 1.000** 155.330
118 R 1.000** 155.330
119 P 1.000** 155.330
120 A 1.000** 155.330
121 L 1.000** 155.330
122 K 1.000** 155.330
123 K 1.000** 155.330
124 A 1.000** 155.330
125 G 1.000** 155.330
126 F 1.000** 155.330
127 L 1.000** 155.330
128 T 1.000** 155.330
129 R 1.000** 155.330
130 D 1.000** 155.330
131 P 1.000** 155.330
132 R 1.000** 155.330
133 S 1.000** 155.330
134 T 1.000** 155.330
135 E 1.000** 155.330
136 R 1.000** 155.330
137 K 1.000** 155.330
138 K 1.000** 155.330
139 Y 1.000** 155.330
140 G 1.000** 155.330
141 L 1.000** 155.330
142 K 1.000** 155.330
143 K 1.000** 155.330
144 A 1.000** 155.330
145 R 1.000** 155.330
146 K 1.000** 155.330
147 A 1.000** 155.330
148 P 1.000** 155.330
149 Q 1.000** 155.330
150 Y 1.000** 155.330
151 S 1.000** 155.330
152 K 1.000** 155.330
153 R 1.000** 155.330
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907685_1_375_MLBR_RS01800)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -604.785690 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 99.000000 2.077878
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907685_1_375_MLBR_RS01800: 0.000004, NC_002677_1_NP_301361_1_233_rpsI: 0.000004, NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830: 0.000004, NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040: 0.000004, NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935: 0.000004, NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 99.00000 q = 2.07788
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.95225 0.96563 0.97236 0.97708 0.98085 0.98408 0.98702 0.98982 0.99269 0.99612
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 369.6 89.4 0.9798 0.0000 0.0000 0.0 0.0
7..2 0.000 369.6 89.4 0.9798 0.0000 0.0000 0.0 0.0
7..3 0.000 369.6 89.4 0.9798 0.0000 0.0000 0.0 0.0
7..4 0.000 369.6 89.4 0.9798 0.0000 0.0000 0.0 0.0
7..5 0.000 369.6 89.4 0.9798 0.0000 0.0000 0.0 0.0
7..6 0.000 369.6 89.4 0.9798 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -604.785677 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 6.980493
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907685_1_375_MLBR_RS01800: 0.000004, NC_002677_1_NP_301361_1_233_rpsI: 0.000004, NZ_LVXE01000013_1_WP_010907685_1_461_A3216_RS05830: 0.000004, NZ_LYPH01000014_1_WP_010907685_1_426_A8144_RS02040: 0.000004, NZ_CP029543_1_WP_010907685_1_377_DIJ64_RS01935: 0.000004, NZ_AP014567_1_WP_010907685_1_393_JK2ML_RS02015: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 0.00500
(p1 = 0.99999) w = 6.98049
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000 6.98049
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 369.6 89.4 6.9804 0.0000 0.0000 0.0 0.0
7..2 0.000 369.6 89.4 6.9804 0.0000 0.0000 0.0 0.0
7..3 0.000 369.6 89.4 6.9804 0.0000 0.0000 0.0 0.0
7..4 0.000 369.6 89.4 6.9804 0.0000 0.0000 0.0 0.0
7..5 0.000 369.6 89.4 6.9804 0.0000 0.0000 0.0 0.0
7..6 0.000 369.6 89.4 6.9804 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907685_1_375_MLBR_RS01800)
Pr(w>1) post mean +- SE for w
1 V 1.000** 6.980
2 T 1.000** 6.980
3 E 1.000** 6.980
4 T 1.000** 6.980
5 S 1.000** 6.980
6 E 1.000** 6.980
7 A 1.000** 6.980
8 V 1.000** 6.980
9 E 1.000** 6.980
10 I 1.000** 6.980
11 A 1.000** 6.980
12 V 1.000** 6.980
13 G 1.000** 6.980
14 T 1.000** 6.980
15 P 1.000** 6.980
16 A 1.000** 6.980
17 A 1.000** 6.980
18 K 1.000** 6.980
19 H 1.000** 6.980
20 S 1.000** 6.980
21 E 1.000** 6.980
22 S 1.000** 6.980
23 F 1.000** 6.980
24 V 1.000** 6.980
25 F 1.000** 6.980
26 E 1.000** 6.980
27 R 1.000** 6.980
28 S 1.000** 6.980
29 I 1.000** 6.980
30 Q 1.000** 6.980
31 T 1.000** 6.980
32 V 1.000** 6.980
33 G 1.000** 6.980
34 R 1.000** 6.980
35 R 1.000** 6.980
36 K 1.000** 6.980
37 E 1.000** 6.980
38 A 1.000** 6.980
39 V 1.000** 6.980
40 V 1.000** 6.980
41 R 1.000** 6.980
42 V 1.000** 6.980
43 R 1.000** 6.980
44 L 1.000** 6.980
45 V 1.000** 6.980
46 L 1.000** 6.980
47 G 1.000** 6.980
48 T 1.000** 6.980
49 G 1.000** 6.980
50 K 1.000** 6.980
51 F 1.000** 6.980
52 D 1.000** 6.980
53 L 1.000** 6.980
54 N 1.000** 6.980
55 G 1.000** 6.980
56 R 1.000** 6.980
57 S 1.000** 6.980
58 L 1.000** 6.980
59 E 1.000** 6.980
60 D 1.000** 6.980
61 Y 1.000** 6.980
62 F 1.000** 6.980
63 P 1.000** 6.980
64 N 1.000** 6.980
65 K 1.000** 6.980
66 V 1.000** 6.980
67 H 1.000** 6.980
68 Q 1.000** 6.980
69 Q 1.000** 6.980
70 L 1.000** 6.980
71 I 1.000** 6.980
72 K 1.000** 6.980
73 A 1.000** 6.980
74 P 1.000** 6.980
75 L 1.000** 6.980
76 V 1.000** 6.980
77 T 1.000** 6.980
78 V 1.000** 6.980
79 E 1.000** 6.980
80 R 1.000** 6.980
81 T 1.000** 6.980
82 R 1.000** 6.980
83 N 1.000** 6.980
84 F 1.000** 6.980
85 D 1.000** 6.980
86 I 1.000** 6.980
87 F 1.000** 6.980
88 A 1.000** 6.980
89 L 1.000** 6.980
90 L 1.000** 6.980
91 H 1.000** 6.980
92 G 1.000** 6.980
93 G 1.000** 6.980
94 G 1.000** 6.980
95 P 1.000** 6.980
96 S 1.000** 6.980
97 G 1.000** 6.980
98 Q 1.000** 6.980
99 A 1.000** 6.980
100 G 1.000** 6.980
101 A 1.000** 6.980
102 L 1.000** 6.980
103 R 1.000** 6.980
104 L 1.000** 6.980
105 G 1.000** 6.980
106 I 1.000** 6.980
107 A 1.000** 6.980
108 R 1.000** 6.980
109 A 1.000** 6.980
110 L 1.000** 6.980
111 I 1.000** 6.980
112 L 1.000** 6.980
113 A 1.000** 6.980
114 S 1.000** 6.980
115 P 1.000** 6.980
116 E 1.000** 6.980
117 D 1.000** 6.980
118 R 1.000** 6.980
119 P 1.000** 6.980
120 A 1.000** 6.980
121 L 1.000** 6.980
122 K 1.000** 6.980
123 K 1.000** 6.980
124 A 1.000** 6.980
125 G 1.000** 6.980
126 F 1.000** 6.980
127 L 1.000** 6.980
128 T 1.000** 6.980
129 R 1.000** 6.980
130 D 1.000** 6.980
131 P 1.000** 6.980
132 R 1.000** 6.980
133 S 1.000** 6.980
134 T 1.000** 6.980
135 E 1.000** 6.980
136 R 1.000** 6.980
137 K 1.000** 6.980
138 K 1.000** 6.980
139 Y 1.000** 6.980
140 G 1.000** 6.980
141 L 1.000** 6.980
142 K 1.000** 6.980
143 K 1.000** 6.980
144 A 1.000** 6.980
145 R 1.000** 6.980
146 K 1.000** 6.980
147 A 1.000** 6.980
148 P 1.000** 6.980
149 Q 1.000** 6.980
150 Y 1.000** 6.980
151 S 1.000** 6.980
152 K 1.000** 6.980
153 R 1.000** 6.980
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907685_1_375_MLBR_RS01800)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:14
Model 1: NearlyNeutral -604.78569 Model 2: PositiveSelection -604.785674 Model 0: one-ratio -604.78569 Model 7: beta -604.78569 Model 8: beta&w>1 -604.785677 Model 0 vs 1 0.0 Model 2 vs 1 3.200000014658144E-5 Model 8 vs 7 2.6000000161729986E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
