--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:22:44 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsJ/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -416.14 -419.11
2 -416.08 -420.23
--------------------------------------
TOTAL -416.11 -419.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899483 0.089597 0.364583 1.501585 0.864806 1501.00 1501.00 1.000
r(A<->C){all} 0.163818 0.020017 0.000172 0.440772 0.122239 218.48 221.38 1.006
r(A<->G){all} 0.163237 0.019115 0.000077 0.442410 0.123656 108.44 175.65 1.000
r(A<->T){all} 0.175722 0.021346 0.000035 0.475843 0.136832 171.93 201.57 1.010
r(C<->G){all} 0.162769 0.020213 0.000006 0.463323 0.123449 252.18 262.44 1.002
r(C<->T){all} 0.172378 0.019800 0.000041 0.457056 0.137462 196.40 240.03 1.001
r(G<->T){all} 0.162076 0.018668 0.000142 0.435464 0.126256 92.93 222.73 1.011
pi(A){all} 0.240414 0.000602 0.195314 0.288970 0.239829 1205.56 1225.08 1.001
pi(C){all} 0.306584 0.000701 0.255065 0.356917 0.306737 1013.19 1199.08 1.001
pi(G){all} 0.273632 0.000670 0.227735 0.327752 0.272472 1183.58 1281.60 1.000
pi(T){all} 0.179369 0.000475 0.136185 0.220712 0.178551 1304.44 1336.90 1.000
alpha{1,2} 0.404199 0.215124 0.000154 1.305997 0.237891 950.10 1098.63 1.000
alpha{3} 0.457623 0.247215 0.000318 1.456938 0.290708 1151.13 1169.91 1.000
pinvar{all} 0.994638 0.000042 0.982411 0.999994 0.996721 1128.02 1171.28 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -390.093177
Model 2: PositiveSelection -390.093176
Model 0: one-ratio -390.093183
Model 7: beta -390.093198
Model 8: beta&w>1 -390.093178
Model 0 vs 1 1.1999999969702912E-5
Model 2 vs 1 1.9999999949504854E-6
Model 8 vs 7 3.999999989900971E-5
>C1
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C2
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C3
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C4
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C5
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C6
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=101
C1 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C2 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C3 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C4 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C5 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C6 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
**************************************************
C1 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C2 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C3 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C4 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C5 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C6 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
**************************************************
C1 Q
C2 Q
C3 Q
C4 Q
C5 Q
C6 Q
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3030]--->[3030]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.626 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C2 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C3 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C4 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C5 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C6 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
**************************************************
C1 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C2 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C3 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C4 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C5 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C6 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
**************************************************
C1 Q
C2 Q
C3 Q
C4 Q
C5 Q
C6 Q
*
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
C2 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
C3 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
C4 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
C5 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
C6 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
**************************************************
C1 GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
C2 GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
C3 GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
C4 GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
C5 GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
C6 GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
**************************************************
C1 CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
C2 CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
C3 CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
C4 CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
C5 CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
C6 CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
**************************************************
C1 GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
C2 GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
C3 GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
C4 GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
C5 GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
C6 GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
**************************************************
C1 GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
C2 GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
C3 GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
C4 GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
C5 GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
C6 GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
**************************************************
C1 TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
C2 TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
C3 TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
C4 TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
C5 TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
C6 TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
**************************************************
C1 CAG
C2 CAG
C3 CAG
C4 CAG
C5 CAG
C6 CAG
***
>C1
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C2
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C3
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C4
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C5
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C6
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C1
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C2
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C3
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C4
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C5
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C6
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 303 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792888
Setting output file names to "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 229057237
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0214631674
Seed = 88239764
Swapseed = 1579792888
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -678.128528 -- -24.965149
Chain 2 -- -678.128490 -- -24.965149
Chain 3 -- -678.128528 -- -24.965149
Chain 4 -- -678.128425 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -678.128528 -- -24.965149
Chain 2 -- -678.128528 -- -24.965149
Chain 3 -- -678.128425 -- -24.965149
Chain 4 -- -678.128425 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-678.129] (-678.128) (-678.129) (-678.128) * [-678.129] (-678.129) (-678.128) (-678.128)
500 -- [-425.856] (-424.173) (-425.127) (-430.859) * (-424.595) (-427.023) [-424.858] (-429.470) -- 0:00:00
1000 -- [-435.531] (-426.529) (-425.808) (-422.767) * (-428.711) (-428.612) (-430.695) [-422.989] -- 0:00:00
1500 -- (-426.395) (-427.346) [-428.708] (-427.528) * [-423.407] (-427.783) (-428.140) (-422.087) -- 0:00:00
2000 -- (-421.191) (-422.457) [-426.797] (-430.016) * [-427.425] (-424.519) (-431.113) (-430.267) -- 0:00:00
2500 -- (-424.164) (-431.581) (-424.424) [-422.049] * (-433.914) (-429.958) [-430.794] (-430.226) -- 0:00:00
3000 -- (-429.094) (-428.506) (-423.511) [-420.243] * (-423.651) (-423.736) (-427.735) [-424.911] -- 0:00:00
3500 -- [-420.785] (-421.540) (-422.060) (-429.846) * (-423.141) (-428.500) (-423.265) [-429.302] -- 0:00:00
4000 -- (-427.269) [-425.846] (-427.878) (-430.687) * (-426.662) (-426.972) (-431.660) [-424.135] -- 0:00:00
4500 -- [-424.393] (-422.181) (-424.377) (-425.595) * (-432.458) (-433.271) (-426.460) [-426.692] -- 0:00:00
5000 -- (-422.538) (-434.537) [-421.740] (-426.258) * (-419.428) (-423.156) [-423.973] (-421.691) -- 0:00:00
Average standard deviation of split frequencies: 0.088815
5500 -- (-421.234) (-425.409) [-426.446] (-423.420) * (-433.925) [-424.987] (-430.303) (-424.723) -- 0:00:00
6000 -- [-419.619] (-423.881) (-424.351) (-424.568) * [-421.748] (-425.210) (-426.607) (-432.313) -- 0:00:00
6500 -- [-421.795] (-423.148) (-425.676) (-430.228) * (-428.819) (-421.280) [-420.992] (-424.044) -- 0:00:00
7000 -- [-429.793] (-423.677) (-422.856) (-425.840) * (-421.378) (-428.553) [-430.198] (-430.909) -- 0:00:00
7500 -- (-433.637) (-422.389) [-423.049] (-428.226) * [-423.348] (-425.846) (-425.812) (-430.798) -- 0:00:00
8000 -- [-423.105] (-423.777) (-432.591) (-420.632) * (-435.524) [-425.661] (-431.107) (-430.025) -- 0:00:00
8500 -- [-435.490] (-431.474) (-422.938) (-424.873) * (-424.442) [-433.029] (-428.633) (-427.972) -- 0:00:00
9000 -- (-432.336) (-435.533) (-440.201) [-425.391] * (-421.620) (-430.358) (-426.180) [-421.463] -- 0:01:50
9500 -- (-424.516) (-423.187) (-437.811) [-428.886] * [-421.841] (-423.103) (-433.903) (-421.900) -- 0:01:44
10000 -- [-424.055] (-428.834) (-418.384) (-424.035) * (-421.949) (-433.676) [-425.230] (-420.423) -- 0:01:39
Average standard deviation of split frequencies: 0.077990
10500 -- (-429.989) (-430.370) [-419.816] (-428.156) * (-424.011) [-431.326] (-436.439) (-421.509) -- 0:01:34
11000 -- (-435.090) [-424.675] (-415.118) (-427.462) * (-425.024) (-426.064) (-426.513) [-423.178] -- 0:01:29
11500 -- (-430.160) (-429.186) (-416.918) [-425.875] * (-431.160) (-422.195) [-426.254] (-432.514) -- 0:01:25
12000 -- (-416.447) (-425.796) (-417.035) [-421.564] * (-427.352) (-430.156) [-431.693] (-430.194) -- 0:01:22
12500 -- (-421.035) [-428.257] (-419.219) (-421.986) * [-426.283] (-430.030) (-433.154) (-426.537) -- 0:01:19
13000 -- [-417.449] (-427.814) (-417.506) (-426.911) * [-424.022] (-427.501) (-423.861) (-418.672) -- 0:01:15
13500 -- (-419.513) (-426.748) [-417.006] (-426.683) * [-427.341] (-428.181) (-425.248) (-418.707) -- 0:01:13
14000 -- [-417.633] (-430.892) (-414.931) (-427.088) * (-423.470) (-431.704) (-427.209) [-415.943] -- 0:01:10
14500 -- (-416.479) [-426.915] (-415.500) (-428.948) * (-428.949) (-423.875) (-431.409) [-418.858] -- 0:01:07
15000 -- (-416.070) (-427.388) (-414.850) [-425.846] * (-436.611) [-424.552] (-429.197) (-418.698) -- 0:01:05
Average standard deviation of split frequencies: 0.047468
15500 -- (-416.620) [-426.256] (-414.809) (-425.810) * (-427.515) (-423.405) (-422.560) [-415.689] -- 0:01:03
16000 -- [-415.076] (-432.726) (-414.706) (-435.629) * [-420.683] (-426.421) (-421.724) (-419.347) -- 0:01:01
16500 -- (-416.612) (-433.918) [-414.831] (-421.609) * (-435.494) (-425.610) [-421.165] (-421.036) -- 0:00:59
17000 -- (-416.907) (-424.964) (-417.775) [-426.472] * (-427.460) (-436.025) [-430.216] (-414.824) -- 0:00:57
17500 -- (-415.749) (-429.332) (-415.891) [-421.597] * (-416.032) [-422.420] (-430.947) (-418.914) -- 0:00:56
18000 -- (-418.806) (-422.486) (-418.107) [-424.236] * (-419.182) [-426.196] (-424.343) (-415.873) -- 0:00:54
18500 -- (-417.543) [-425.797] (-415.771) (-432.580) * (-415.226) (-431.775) (-431.042) [-416.889] -- 0:00:53
19000 -- (-416.221) (-422.070) [-416.485] (-426.362) * (-416.555) (-429.936) (-430.062) [-416.630] -- 0:00:51
19500 -- [-415.174] (-417.998) (-419.113) (-426.701) * (-416.063) (-432.928) [-426.791] (-415.634) -- 0:00:50
20000 -- (-416.222) (-432.844) (-416.126) [-422.716] * (-417.307) [-426.506] (-433.884) (-415.443) -- 0:00:49
Average standard deviation of split frequencies: 0.055758
20500 -- [-415.726] (-433.663) (-417.343) (-430.796) * (-422.601) [-417.118] (-434.542) (-416.427) -- 0:00:47
21000 -- (-416.177) (-429.072) (-419.530) [-425.553] * (-416.579) [-416.608] (-445.913) (-418.033) -- 0:00:46
21500 -- [-414.884] (-424.457) (-417.903) (-427.954) * (-417.932) (-428.897) (-428.683) [-420.200] -- 0:00:45
22000 -- [-419.363] (-431.348) (-418.315) (-422.178) * (-417.012) (-418.177) [-419.110] (-420.542) -- 0:00:44
22500 -- (-416.378) (-438.866) [-414.836] (-427.937) * (-415.259) (-416.770) (-415.300) [-416.668] -- 0:00:43
23000 -- [-414.789] (-421.010) (-416.513) (-426.745) * (-417.185) [-416.278] (-416.660) (-417.558) -- 0:00:42
23500 -- (-418.169) (-422.604) (-415.448) [-424.795] * (-417.052) [-416.861] (-417.484) (-416.173) -- 0:00:41
24000 -- (-416.999) [-421.796] (-416.332) (-437.579) * (-421.900) (-414.806) (-417.682) [-417.606] -- 0:00:40
24500 -- [-414.689] (-427.626) (-415.060) (-427.631) * (-418.460) (-415.530) (-419.775) [-418.309] -- 0:00:39
25000 -- [-415.341] (-434.862) (-419.253) (-431.573) * (-418.409) [-415.892] (-417.615) (-415.091) -- 0:00:39
Average standard deviation of split frequencies: 0.050364
25500 -- (-416.932) (-427.909) (-418.137) [-423.305] * (-417.655) (-415.839) (-416.720) [-415.471] -- 0:00:38
26000 -- (-417.147) (-425.451) (-416.109) [-422.367] * (-416.048) [-416.158] (-415.831) (-419.252) -- 0:01:14
26500 -- (-417.302) (-426.062) [-415.617] (-430.322) * [-415.602] (-417.845) (-417.419) (-418.101) -- 0:01:13
27000 -- [-415.474] (-428.151) (-417.623) (-424.293) * (-418.480) (-416.363) [-417.377] (-417.601) -- 0:01:12
27500 -- (-415.420) (-423.163) [-414.926] (-428.749) * [-417.626] (-418.194) (-426.717) (-417.338) -- 0:01:10
28000 -- (-415.940) [-424.390] (-417.141) (-430.408) * (-418.201) [-418.532] (-418.431) (-417.514) -- 0:01:09
28500 -- (-416.249) (-425.039) (-416.693) [-429.475] * (-415.330) [-418.123] (-418.468) (-416.462) -- 0:01:08
29000 -- (-418.473) (-433.760) (-417.676) [-426.821] * (-418.107) (-415.025) [-416.300] (-416.292) -- 0:01:06
29500 -- (-417.407) (-440.822) [-418.094] (-436.974) * (-418.783) [-417.915] (-415.882) (-417.146) -- 0:01:05
30000 -- [-415.812] (-415.865) (-417.255) (-432.224) * [-417.454] (-415.293) (-415.662) (-418.119) -- 0:01:04
Average standard deviation of split frequencies: 0.046116
30500 -- (-417.166) (-417.379) [-416.901] (-415.841) * (-416.171) (-416.263) [-415.359] (-420.792) -- 0:01:03
31000 -- [-415.983] (-416.658) (-415.395) (-417.155) * (-415.254) (-416.095) [-418.130] (-418.101) -- 0:01:02
31500 -- (-418.104) [-417.465] (-417.121) (-416.389) * [-415.657] (-426.331) (-417.328) (-419.554) -- 0:01:01
32000 -- (-418.499) (-418.230) [-416.730] (-419.663) * (-414.902) [-416.306] (-416.931) (-422.312) -- 0:01:00
32500 -- (-416.524) (-419.230) (-418.119) [-416.180] * (-417.001) (-418.394) (-417.506) [-416.396] -- 0:00:59
33000 -- (-418.527) [-419.087] (-417.255) (-416.042) * [-418.005] (-415.893) (-419.257) (-415.581) -- 0:00:58
33500 -- (-422.742) [-414.883] (-416.875) (-418.594) * (-418.104) [-416.105] (-418.957) (-415.700) -- 0:00:57
34000 -- [-415.547] (-419.567) (-419.105) (-418.361) * [-416.953] (-417.669) (-416.144) (-416.176) -- 0:00:56
34500 -- (-420.991) [-416.750] (-415.925) (-415.428) * (-417.687) (-417.916) [-416.374] (-417.346) -- 0:00:55
35000 -- (-424.321) (-416.042) [-418.530] (-416.443) * [-416.239] (-415.852) (-416.018) (-419.844) -- 0:00:55
Average standard deviation of split frequencies: 0.047140
35500 -- (-423.730) (-415.398) (-416.491) [-415.785] * [-415.547] (-415.072) (-421.570) (-417.064) -- 0:00:54
36000 -- (-418.294) (-416.282) (-416.128) [-414.881] * (-414.846) (-415.296) [-420.359] (-416.274) -- 0:00:53
36500 -- (-420.113) (-418.956) (-416.389) [-415.908] * (-415.541) [-415.437] (-417.864) (-414.709) -- 0:00:52
37000 -- (-414.968) [-419.201] (-418.698) (-417.110) * (-417.174) (-417.713) [-417.943] (-415.625) -- 0:00:52
37500 -- (-416.254) (-416.421) (-417.919) [-415.067] * [-416.108] (-418.217) (-416.342) (-415.140) -- 0:00:51
38000 -- [-417.054] (-421.042) (-415.475) (-416.676) * (-414.966) (-416.108) [-417.264] (-418.231) -- 0:00:50
38500 -- [-418.055] (-420.575) (-415.509) (-419.743) * (-414.930) (-415.345) [-417.217] (-420.258) -- 0:00:49
39000 -- (-417.643) [-415.884] (-416.880) (-417.302) * (-417.771) (-418.551) [-418.344] (-416.091) -- 0:00:49
39500 -- (-416.556) (-415.294) (-417.669) [-416.429] * [-417.713] (-419.016) (-417.779) (-416.197) -- 0:00:48
40000 -- [-417.177] (-417.227) (-419.464) (-417.297) * [-415.334] (-419.816) (-418.759) (-416.350) -- 0:00:48
Average standard deviation of split frequencies: 0.045147
40500 -- (-419.333) (-416.340) [-416.639] (-418.990) * [-416.583] (-420.358) (-420.066) (-415.551) -- 0:00:47
41000 -- (-415.981) (-416.392) [-415.857] (-417.870) * (-415.722) (-415.299) (-418.164) [-415.276] -- 0:00:46
41500 -- (-416.218) (-419.265) (-417.125) [-416.827] * (-415.854) (-419.874) (-418.280) [-417.904] -- 0:00:46
42000 -- [-419.463] (-418.972) (-415.554) (-416.807) * [-416.176] (-418.722) (-415.970) (-415.282) -- 0:00:45
42500 -- (-416.073) (-417.328) (-415.439) [-416.176] * [-415.649] (-417.151) (-417.219) (-419.286) -- 0:00:45
43000 -- (-416.356) (-416.724) [-416.473] (-417.266) * [-417.864] (-416.981) (-417.919) (-416.725) -- 0:01:06
43500 -- (-421.967) (-416.158) [-418.220] (-415.179) * [-416.965] (-417.750) (-421.115) (-416.750) -- 0:01:05
44000 -- (-419.602) [-416.489] (-416.340) (-415.540) * (-418.575) (-415.228) (-419.217) [-415.476] -- 0:01:05
44500 -- [-416.470] (-415.852) (-417.030) (-415.563) * (-417.359) [-414.966] (-416.340) (-416.785) -- 0:01:04
45000 -- (-417.621) [-414.931] (-417.696) (-416.117) * (-418.107) [-415.161] (-415.270) (-416.246) -- 0:01:03
Average standard deviation of split frequencies: 0.039455
45500 -- (-421.433) (-419.293) [-417.725] (-415.823) * (-415.314) [-416.083] (-416.360) (-417.279) -- 0:01:02
46000 -- [-416.136] (-417.362) (-419.456) (-421.306) * (-419.742) (-416.932) [-420.542] (-416.717) -- 0:01:02
46500 -- [-417.389] (-415.000) (-417.137) (-416.371) * (-415.311) [-419.254] (-415.749) (-415.439) -- 0:01:01
47000 -- (-415.492) [-417.148] (-418.158) (-415.889) * (-416.048) [-416.224] (-414.919) (-416.083) -- 0:01:00
47500 -- (-417.480) [-416.600] (-415.245) (-417.131) * (-418.842) (-418.683) [-416.631] (-416.839) -- 0:01:00
48000 -- (-416.756) [-415.685] (-416.935) (-417.043) * (-419.747) [-415.800] (-415.766) (-418.514) -- 0:00:59
48500 -- (-415.325) (-415.334) [-417.892] (-421.949) * (-420.565) (-417.433) (-416.587) [-418.362] -- 0:00:58
49000 -- (-415.764) (-416.295) [-414.718] (-423.139) * [-419.084] (-419.371) (-415.121) (-418.360) -- 0:00:58
49500 -- (-414.765) (-418.718) (-414.781) [-416.721] * (-422.589) (-415.623) [-415.988] (-417.315) -- 0:00:57
50000 -- [-416.673] (-418.186) (-415.804) (-416.359) * (-417.345) [-415.729] (-416.516) (-416.004) -- 0:00:57
Average standard deviation of split frequencies: 0.039665
50500 -- (-417.440) [-416.424] (-418.275) (-416.448) * (-418.477) [-415.850] (-417.737) (-420.268) -- 0:00:56
51000 -- (-416.753) (-414.970) [-416.317] (-416.439) * (-417.528) [-415.823] (-418.023) (-419.741) -- 0:00:55
51500 -- (-418.972) (-418.177) [-416.433] (-415.043) * [-416.866] (-416.145) (-417.810) (-419.156) -- 0:00:55
52000 -- [-417.468] (-418.851) (-415.406) (-416.571) * (-416.631) [-415.982] (-418.411) (-421.258) -- 0:00:54
52500 -- (-415.720) (-419.029) [-415.028] (-416.252) * [-415.864] (-416.505) (-415.493) (-419.739) -- 0:00:54
53000 -- [-415.904] (-416.722) (-417.072) (-416.801) * (-415.616) (-415.727) (-417.435) [-415.877] -- 0:00:53
53500 -- [-419.842] (-416.313) (-415.916) (-415.981) * [-418.547] (-417.580) (-415.288) (-416.193) -- 0:00:53
54000 -- (-416.720) (-424.226) [-414.824] (-416.691) * (-416.031) [-416.835] (-415.507) (-417.283) -- 0:00:52
54500 -- [-416.866] (-417.360) (-417.216) (-416.887) * (-416.373) (-416.154) [-415.990] (-415.738) -- 0:00:52
55000 -- (-416.812) (-418.437) (-418.553) [-415.392] * (-416.028) (-416.051) [-419.576] (-417.512) -- 0:00:51
Average standard deviation of split frequencies: 0.037039
55500 -- (-415.792) [-419.511] (-416.233) (-415.799) * (-415.283) (-418.718) (-418.977) [-417.745] -- 0:00:51
56000 -- [-418.148] (-419.952) (-420.820) (-417.824) * (-415.681) (-418.086) (-417.853) [-418.704] -- 0:00:50
56500 -- (-418.685) [-418.501] (-418.768) (-415.944) * [-414.497] (-416.063) (-418.053) (-415.054) -- 0:00:50
57000 -- (-418.890) (-416.879) (-418.205) [-416.769] * (-416.563) (-416.555) [-415.922] (-418.971) -- 0:00:49
57500 -- (-417.183) (-415.582) [-415.328] (-415.483) * (-416.991) (-415.444) [-415.677] (-419.415) -- 0:00:49
58000 -- (-416.625) [-415.820] (-416.554) (-418.743) * (-415.703) (-417.046) [-415.801] (-418.398) -- 0:00:48
58500 -- (-415.988) (-415.364) [-417.294] (-417.035) * (-416.415) [-418.136] (-417.576) (-418.646) -- 0:00:48
59000 -- [-418.165] (-414.681) (-415.814) (-416.602) * (-416.020) (-418.054) (-414.717) [-417.684] -- 0:00:47
59500 -- (-417.619) [-414.547] (-415.799) (-417.339) * (-414.865) (-415.805) (-415.453) [-415.614] -- 0:00:47
60000 -- (-422.444) (-417.362) (-417.144) [-418.469] * (-415.721) [-416.512] (-414.984) (-418.339) -- 0:01:02
Average standard deviation of split frequencies: 0.040488
60500 -- (-417.308) (-418.735) [-415.272] (-416.408) * (-415.172) [-416.199] (-415.554) (-416.260) -- 0:01:02
61000 -- (-416.876) (-420.302) (-415.600) [-415.873] * (-419.422) (-417.922) [-415.353] (-419.195) -- 0:01:01
61500 -- [-417.406] (-417.290) (-416.625) (-417.077) * (-419.170) (-419.979) (-416.212) [-415.789] -- 0:01:01
62000 -- (-420.536) (-416.127) [-415.849] (-415.102) * [-416.812] (-420.752) (-416.773) (-419.803) -- 0:01:00
62500 -- (-418.359) (-421.537) [-415.209] (-415.355) * [-415.156] (-416.096) (-417.210) (-416.691) -- 0:01:00
63000 -- (-417.886) (-417.882) [-414.784] (-414.806) * (-416.041) (-419.364) [-415.758] (-416.138) -- 0:00:59
63500 -- (-416.959) [-417.324] (-420.220) (-419.603) * [-418.954] (-416.182) (-418.203) (-415.275) -- 0:00:58
64000 -- [-418.627] (-416.173) (-417.836) (-415.270) * (-418.320) [-419.361] (-416.988) (-420.794) -- 0:00:58
64500 -- (-415.552) (-417.963) [-416.367] (-415.991) * (-417.603) (-421.036) (-415.527) [-415.199] -- 0:00:58
65000 -- (-418.770) (-416.730) (-420.425) [-417.681] * (-418.120) (-417.179) (-417.011) [-418.344] -- 0:00:57
Average standard deviation of split frequencies: 0.036733
65500 -- (-421.373) (-417.954) [-415.067] (-416.509) * (-417.424) (-417.232) [-415.000] (-418.046) -- 0:00:57
66000 -- [-415.091] (-416.842) (-421.917) (-422.111) * (-416.205) [-418.015] (-417.699) (-418.592) -- 0:00:56
66500 -- (-414.805) (-415.697) (-423.018) [-417.720] * (-415.781) (-414.864) (-415.488) [-416.376] -- 0:00:56
67000 -- (-414.769) (-416.644) (-422.453) [-416.296] * (-416.740) (-419.307) (-416.851) [-416.975] -- 0:00:55
67500 -- [-416.040] (-417.741) (-418.695) (-416.612) * [-416.406] (-416.822) (-414.929) (-416.639) -- 0:00:55
68000 -- (-417.366) [-417.553] (-415.786) (-418.027) * [-417.830] (-417.204) (-414.823) (-420.153) -- 0:00:54
68500 -- [-417.409] (-418.173) (-416.755) (-420.604) * (-415.841) (-418.246) [-417.174] (-415.305) -- 0:00:54
69000 -- [-417.586] (-416.755) (-415.241) (-416.323) * (-414.903) (-416.366) (-417.039) [-415.636] -- 0:00:53
69500 -- [-416.603] (-416.339) (-417.419) (-418.478) * [-415.577] (-420.449) (-416.466) (-416.608) -- 0:00:53
70000 -- [-417.717] (-418.221) (-416.462) (-418.589) * (-418.264) [-418.332] (-415.344) (-420.514) -- 0:00:53
Average standard deviation of split frequencies: 0.037484
70500 -- (-415.114) (-418.082) (-416.837) [-416.912] * [-415.848] (-422.702) (-416.638) (-418.881) -- 0:00:52
71000 -- [-423.552] (-417.884) (-416.732) (-421.697) * (-415.869) (-415.651) (-419.251) [-419.512] -- 0:00:52
71500 -- (-415.746) (-417.584) [-418.955] (-417.777) * (-415.080) (-418.730) [-418.223] (-419.338) -- 0:00:51
72000 -- [-417.798] (-424.005) (-420.961) (-414.898) * (-415.732) (-419.369) (-417.218) [-415.768] -- 0:00:51
72500 -- (-418.152) (-423.912) [-421.512] (-414.822) * [-414.501] (-415.740) (-414.849) (-415.002) -- 0:00:51
73000 -- [-415.391] (-417.970) (-417.431) (-415.663) * (-420.785) (-417.254) [-416.397] (-415.479) -- 0:00:50
73500 -- (-416.005) (-416.508) [-415.450] (-416.970) * (-420.391) (-417.078) (-415.041) [-415.027] -- 0:00:50
74000 -- (-417.336) [-417.920] (-415.988) (-415.554) * (-421.828) [-418.241] (-421.412) (-416.527) -- 0:00:50
74500 -- (-418.108) [-416.624] (-416.332) (-415.700) * (-426.545) [-415.078] (-425.144) (-414.799) -- 0:00:49
75000 -- (-416.255) (-416.067) [-417.817] (-414.776) * (-426.032) (-418.077) (-415.241) [-415.128] -- 0:00:49
Average standard deviation of split frequencies: 0.032786
75500 -- [-416.187] (-416.907) (-417.392) (-417.363) * (-416.519) (-420.517) [-415.373] (-416.186) -- 0:00:48
76000 -- (-417.501) (-414.730) [-416.436] (-420.241) * (-416.799) (-418.143) (-416.718) [-416.947] -- 0:01:00
76500 -- (-418.150) (-415.397) (-417.816) [-416.738] * (-416.460) (-419.891) [-415.635] (-418.836) -- 0:01:00
77000 -- (-415.006) (-416.990) (-419.355) [-417.773] * (-418.084) (-417.383) [-415.349] (-416.916) -- 0:00:59
77500 -- [-415.232] (-416.662) (-422.885) (-417.143) * (-415.745) [-418.810] (-414.908) (-415.767) -- 0:00:59
78000 -- (-415.151) [-416.604] (-418.066) (-418.082) * (-417.544) (-419.788) [-418.158] (-417.322) -- 0:00:59
78500 -- (-417.301) [-416.442] (-416.963) (-416.303) * [-417.534] (-420.859) (-417.745) (-417.165) -- 0:00:58
79000 -- (-419.038) (-417.081) (-416.841) [-416.081] * (-415.026) (-415.205) [-419.715] (-415.589) -- 0:00:58
79500 -- (-417.517) [-416.403] (-415.838) (-416.697) * (-417.943) [-420.112] (-415.404) (-415.253) -- 0:00:57
80000 -- (-415.983) [-417.970] (-415.626) (-416.603) * (-417.801) (-416.176) (-415.050) [-415.629] -- 0:00:57
Average standard deviation of split frequencies: 0.033894
80500 -- (-414.640) [-416.085] (-417.112) (-420.214) * (-416.315) (-418.100) (-417.296) [-414.903] -- 0:00:57
81000 -- (-416.078) [-417.399] (-419.909) (-416.832) * [-416.676] (-416.762) (-422.839) (-418.579) -- 0:00:56
81500 -- (-417.328) [-415.565] (-418.670) (-417.197) * (-416.608) [-416.767] (-415.236) (-417.774) -- 0:00:56
82000 -- [-415.963] (-417.902) (-422.757) (-419.283) * (-417.336) (-415.412) (-414.894) [-416.027] -- 0:00:55
82500 -- (-417.494) [-417.175] (-415.790) (-420.045) * (-415.773) (-415.165) [-415.268] (-417.244) -- 0:00:55
83000 -- [-419.337] (-414.936) (-417.391) (-416.686) * (-417.031) (-416.616) (-414.562) [-415.417] -- 0:00:55
83500 -- (-418.159) (-416.123) [-417.507] (-420.229) * [-414.866] (-419.058) (-414.622) (-415.912) -- 0:00:54
84000 -- (-417.501) (-417.446) (-416.851) [-415.869] * (-416.493) (-417.252) [-414.661] (-416.153) -- 0:00:54
84500 -- (-418.945) (-417.805) [-416.277] (-417.396) * (-422.094) (-419.069) [-416.937] (-415.527) -- 0:00:54
85000 -- (-416.559) (-417.776) [-415.429] (-417.881) * (-415.143) (-418.628) [-414.870] (-414.623) -- 0:00:53
Average standard deviation of split frequencies: 0.034533
85500 -- (-418.221) (-418.423) (-417.379) [-415.270] * (-416.290) (-417.870) [-415.471] (-420.870) -- 0:00:53
86000 -- (-416.117) (-416.285) [-415.622] (-418.818) * (-418.815) [-416.880] (-420.359) (-417.860) -- 0:00:53
86500 -- (-417.246) (-419.053) [-415.462] (-417.932) * (-416.498) (-417.685) [-415.424] (-421.365) -- 0:00:52
87000 -- (-419.185) [-417.468] (-418.659) (-415.577) * (-415.725) [-416.511] (-421.621) (-418.655) -- 0:00:52
87500 -- (-415.723) [-417.650] (-415.767) (-417.897) * (-415.677) (-415.182) (-417.560) [-417.879] -- 0:00:52
88000 -- (-419.776) (-417.848) (-418.310) [-415.690] * (-414.450) (-416.213) (-418.985) [-415.177] -- 0:00:51
88500 -- [-419.613] (-414.811) (-418.802) (-416.383) * [-415.735] (-419.419) (-419.753) (-415.873) -- 0:00:51
89000 -- (-418.100) (-417.558) [-416.310] (-417.887) * (-418.157) [-418.230] (-416.015) (-416.451) -- 0:00:51
89500 -- [-416.562] (-416.626) (-415.273) (-418.837) * [-415.749] (-418.359) (-415.676) (-415.673) -- 0:00:50
90000 -- (-418.748) (-416.542) (-415.189) [-417.891] * [-416.165] (-417.368) (-417.552) (-416.129) -- 0:00:50
Average standard deviation of split frequencies: 0.033276
90500 -- (-416.551) (-420.191) (-415.768) [-415.076] * (-416.479) [-415.921] (-419.733) (-415.743) -- 0:00:50
91000 -- [-418.387] (-417.041) (-414.781) (-416.223) * (-418.417) [-417.064] (-421.062) (-416.887) -- 0:00:49
91500 -- [-415.955] (-416.011) (-415.917) (-415.336) * [-417.140] (-417.165) (-416.935) (-418.696) -- 0:00:49
92000 -- (-417.120) (-415.675) [-420.382] (-416.913) * (-420.939) (-419.740) [-417.369] (-418.380) -- 0:00:59
92500 -- (-421.010) [-418.275] (-416.893) (-416.570) * [-419.490] (-419.730) (-417.141) (-417.143) -- 0:00:58
93000 -- (-422.373) (-416.148) [-417.184] (-417.252) * [-415.355] (-418.521) (-415.898) (-418.162) -- 0:00:58
93500 -- (-420.984) (-415.977) (-415.164) [-414.773] * [-415.342] (-415.991) (-415.992) (-420.116) -- 0:00:58
94000 -- [-419.272] (-418.218) (-416.265) (-416.247) * (-418.588) [-416.809] (-416.789) (-415.845) -- 0:00:57
94500 -- (-416.573) (-417.499) (-415.830) [-418.298] * [-415.355] (-414.919) (-418.688) (-415.603) -- 0:00:57
95000 -- (-416.973) [-416.013] (-416.169) (-417.802) * [-417.482] (-414.603) (-416.579) (-420.747) -- 0:00:57
Average standard deviation of split frequencies: 0.028294
95500 -- (-417.798) (-417.691) (-415.903) [-418.351] * (-416.533) [-415.582] (-417.642) (-418.374) -- 0:00:56
96000 -- [-418.038] (-420.046) (-415.686) (-419.028) * (-417.315) [-415.099] (-417.003) (-416.513) -- 0:00:56
96500 -- (-417.194) (-416.702) (-421.467) [-417.975] * [-415.724] (-419.470) (-418.286) (-415.466) -- 0:00:56
97000 -- [-416.447] (-420.529) (-419.523) (-419.349) * (-415.309) (-418.503) (-418.604) [-414.929] -- 0:00:55
97500 -- (-415.279) (-421.808) (-415.467) [-416.087] * (-416.817) (-415.213) (-423.640) [-415.722] -- 0:00:55
98000 -- (-416.331) (-419.684) (-417.011) [-416.349] * (-415.843) (-415.807) [-414.922] (-417.591) -- 0:00:55
98500 -- (-419.435) [-416.035] (-418.195) (-417.887) * (-420.062) (-419.700) (-415.855) [-415.869] -- 0:00:54
99000 -- (-416.462) [-418.038] (-417.462) (-415.711) * (-415.872) (-423.429) (-417.184) [-414.912] -- 0:00:54
99500 -- [-418.358] (-415.349) (-418.125) (-416.551) * (-417.852) (-420.014) (-415.528) [-416.923] -- 0:00:54
100000 -- (-415.086) [-416.399] (-415.354) (-416.081) * (-419.728) [-419.014] (-416.670) (-415.803) -- 0:00:54
Average standard deviation of split frequencies: 0.030204
100500 -- (-415.929) [-417.405] (-414.580) (-414.746) * [-416.844] (-419.265) (-417.361) (-417.781) -- 0:00:53
101000 -- (-415.390) (-417.365) [-423.696] (-415.271) * (-417.238) [-417.539] (-417.011) (-417.168) -- 0:00:53
101500 -- (-415.516) [-416.573] (-415.198) (-419.208) * [-415.795] (-415.882) (-415.619) (-416.213) -- 0:00:53
102000 -- (-414.841) (-416.063) [-415.820] (-417.641) * (-421.235) [-417.280] (-416.422) (-416.098) -- 0:00:52
102500 -- [-416.270] (-415.298) (-416.855) (-417.424) * (-415.513) (-420.470) (-416.963) [-418.129] -- 0:00:52
103000 -- (-417.072) (-418.484) [-417.156] (-416.847) * (-417.838) (-416.575) [-415.505] (-417.706) -- 0:00:52
103500 -- [-416.527] (-415.731) (-416.124) (-415.936) * [-420.504] (-415.049) (-415.201) (-414.993) -- 0:00:51
104000 -- (-416.447) [-419.657] (-418.336) (-415.154) * (-420.976) (-418.209) [-416.992] (-416.262) -- 0:00:51
104500 -- (-415.362) (-415.947) [-415.927] (-416.487) * (-416.673) (-417.302) (-419.938) [-417.647] -- 0:00:51
105000 -- [-415.400] (-414.811) (-417.492) (-415.878) * (-419.247) (-415.937) (-418.935) [-422.054] -- 0:00:51
Average standard deviation of split frequencies: 0.030908
105500 -- [-416.985] (-415.261) (-417.849) (-415.490) * (-417.034) [-415.148] (-415.115) (-418.567) -- 0:00:50
106000 -- [-416.668] (-417.880) (-419.382) (-419.938) * (-419.786) [-417.908] (-415.726) (-416.539) -- 0:00:50
106500 -- (-417.746) [-418.451] (-418.331) (-414.880) * (-422.116) [-415.147] (-415.269) (-417.976) -- 0:00:50
107000 -- (-414.683) (-420.357) [-416.526] (-417.218) * [-418.936] (-418.027) (-418.294) (-417.100) -- 0:00:50
107500 -- (-415.566) (-414.950) (-422.316) [-415.649] * (-415.814) [-417.203] (-416.924) (-415.596) -- 0:00:49
108000 -- [-416.367] (-416.223) (-415.969) (-415.317) * (-416.176) (-416.051) [-417.615] (-417.011) -- 0:00:49
108500 -- [-416.514] (-416.806) (-415.177) (-419.020) * [-415.571] (-416.311) (-422.047) (-416.629) -- 0:00:57
109000 -- (-416.368) [-419.209] (-416.297) (-417.253) * (-415.347) [-417.499] (-415.606) (-416.466) -- 0:00:57
109500 -- [-417.727] (-417.729) (-415.994) (-418.040) * (-418.183) (-417.336) [-416.189] (-417.295) -- 0:00:56
110000 -- [-417.163] (-416.016) (-415.869) (-417.508) * [-415.460] (-418.500) (-418.855) (-423.728) -- 0:00:56
Average standard deviation of split frequencies: 0.029605
110500 -- (-416.389) [-415.024] (-415.117) (-418.631) * [-415.745] (-417.996) (-416.963) (-417.105) -- 0:00:56
111000 -- (-417.909) (-415.631) [-416.131] (-415.815) * [-417.016] (-416.450) (-415.119) (-417.088) -- 0:00:56
111500 -- (-419.577) [-417.082] (-418.894) (-416.542) * (-417.575) (-421.904) (-416.108) [-415.131] -- 0:00:55
112000 -- (-416.978) [-419.546] (-419.529) (-419.522) * [-417.600] (-422.503) (-415.640) (-417.250) -- 0:00:55
112500 -- (-415.397) (-417.063) (-415.341) [-418.252] * [-416.312] (-418.068) (-416.683) (-417.489) -- 0:00:55
113000 -- (-417.215) [-416.863] (-416.388) (-416.927) * (-415.757) (-417.331) (-415.211) [-415.942] -- 0:00:54
113500 -- (-415.392) [-418.072] (-415.830) (-414.867) * (-414.584) (-417.502) [-415.106] (-416.860) -- 0:00:54
114000 -- (-415.728) (-416.281) (-417.221) [-414.692] * (-421.541) [-416.685] (-416.895) (-415.097) -- 0:00:54
114500 -- [-416.170] (-415.967) (-420.338) (-416.855) * (-416.467) (-415.388) (-418.280) [-418.852] -- 0:00:54
115000 -- (-416.241) [-415.568] (-417.991) (-418.907) * (-422.883) [-416.851] (-415.568) (-420.262) -- 0:00:53
Average standard deviation of split frequencies: 0.029056
115500 -- (-420.633) (-419.440) [-414.800] (-416.189) * (-415.995) (-418.173) (-415.768) [-414.709] -- 0:00:53
116000 -- (-418.900) (-417.604) (-417.618) [-416.727] * (-419.057) (-416.683) (-416.694) [-415.300] -- 0:00:53
116500 -- (-417.079) [-415.216] (-417.502) (-416.589) * (-424.475) [-419.294] (-418.248) (-421.383) -- 0:00:53
117000 -- (-420.585) (-416.827) (-419.181) [-416.549] * (-416.638) (-415.425) [-414.720] (-419.926) -- 0:00:52
117500 -- (-415.715) (-415.359) (-418.518) [-414.815] * (-416.123) (-416.307) [-416.228] (-417.104) -- 0:00:52
118000 -- (-417.679) [-415.015] (-418.858) (-421.153) * [-415.800] (-417.202) (-416.224) (-416.348) -- 0:00:52
118500 -- [-416.456] (-418.030) (-417.581) (-417.081) * (-420.838) (-416.133) [-416.776] (-416.265) -- 0:00:52
119000 -- (-416.125) [-414.545] (-415.418) (-417.477) * (-420.518) [-416.449] (-416.273) (-415.850) -- 0:00:51
119500 -- (-418.976) (-416.005) (-418.401) [-416.577] * (-416.882) [-417.152] (-418.977) (-415.940) -- 0:00:51
120000 -- [-416.656] (-414.967) (-416.799) (-414.812) * (-418.640) (-420.815) [-418.361] (-418.168) -- 0:00:51
Average standard deviation of split frequencies: 0.028128
120500 -- (-417.965) (-415.565) (-420.790) [-416.903] * (-416.785) [-415.719] (-417.390) (-422.545) -- 0:00:51
121000 -- (-418.991) [-416.044] (-415.079) (-416.856) * (-416.628) (-415.069) (-414.662) [-417.765] -- 0:00:50
121500 -- (-417.374) (-416.397) [-417.022] (-419.148) * [-420.113] (-415.256) (-415.097) (-416.517) -- 0:00:50
122000 -- (-422.543) (-421.285) (-418.636) [-416.001] * (-422.456) [-415.486] (-418.578) (-416.750) -- 0:00:50
122500 -- (-418.076) [-417.435] (-415.491) (-416.482) * (-416.028) (-417.495) (-416.075) [-417.829] -- 0:00:50
123000 -- (-420.457) [-415.839] (-416.304) (-419.997) * [-416.373] (-418.622) (-417.980) (-415.394) -- 0:00:49
123500 -- (-417.818) [-416.586] (-417.212) (-415.692) * (-416.607) (-418.236) (-419.053) [-416.435] -- 0:00:49
124000 -- (-415.633) [-414.719] (-420.905) (-416.001) * (-416.445) (-417.799) (-419.038) [-417.586] -- 0:00:49
124500 -- (-416.071) [-417.902] (-424.365) (-419.555) * (-416.595) (-422.306) (-417.827) [-416.663] -- 0:00:49
125000 -- (-421.756) (-419.752) (-418.987) [-415.465] * (-416.746) (-417.532) (-419.580) [-417.587] -- 0:00:49
Average standard deviation of split frequencies: 0.025679
125500 -- (-417.165) (-416.600) (-415.723) [-416.097] * [-415.416] (-416.190) (-416.913) (-416.065) -- 0:00:55
126000 -- (-416.970) (-418.925) (-418.888) [-416.728] * (-415.357) (-415.738) [-415.366] (-418.190) -- 0:00:55
126500 -- [-416.160] (-418.571) (-416.757) (-416.291) * (-416.454) (-417.019) [-416.382] (-415.048) -- 0:00:55
127000 -- (-415.809) (-417.241) (-415.639) [-415.992] * (-416.475) (-417.862) [-416.650] (-416.152) -- 0:00:54
127500 -- (-419.486) (-416.793) [-417.116] (-422.603) * (-414.887) (-426.056) [-416.444] (-416.561) -- 0:00:54
128000 -- (-415.731) [-415.026] (-416.318) (-423.987) * (-419.405) [-417.539] (-417.875) (-414.651) -- 0:00:54
128500 -- (-415.514) (-414.601) (-418.235) [-421.565] * (-421.699) (-418.364) (-416.484) [-414.611] -- 0:00:54
129000 -- (-415.928) (-418.461) (-418.389) [-414.989] * [-417.746] (-415.522) (-420.774) (-417.249) -- 0:00:54
129500 -- (-415.901) (-419.670) (-416.212) [-415.360] * (-418.771) (-415.783) (-418.128) [-415.276] -- 0:00:53
130000 -- [-418.432] (-418.468) (-416.618) (-417.134) * [-416.458] (-416.789) (-418.686) (-414.844) -- 0:00:53
Average standard deviation of split frequencies: 0.026697
130500 -- (-420.472) (-416.564) [-415.480] (-417.192) * (-417.399) (-416.337) (-419.877) [-415.573] -- 0:00:53
131000 -- (-416.153) [-415.719] (-415.743) (-417.482) * (-418.027) [-418.576] (-416.498) (-415.718) -- 0:00:53
131500 -- (-415.989) [-416.370] (-417.319) (-415.355) * (-414.631) (-418.628) [-417.751] (-416.570) -- 0:00:52
132000 -- [-416.679] (-414.801) (-416.526) (-416.393) * (-416.454) [-417.395] (-416.479) (-416.487) -- 0:00:52
132500 -- (-417.399) (-425.775) [-415.962] (-416.075) * (-414.663) (-418.055) [-417.419] (-417.043) -- 0:00:52
133000 -- [-415.679] (-419.779) (-417.730) (-420.834) * (-421.009) (-417.601) (-420.484) [-414.986] -- 0:00:52
133500 -- (-416.426) (-423.944) [-416.465] (-420.756) * (-417.012) (-418.697) [-417.662] (-415.748) -- 0:00:51
134000 -- (-416.188) [-417.845] (-416.702) (-415.273) * (-417.767) (-419.489) [-419.100] (-418.948) -- 0:00:51
134500 -- (-419.761) [-416.793] (-420.182) (-416.713) * (-416.451) (-417.663) (-416.574) [-418.588] -- 0:00:51
135000 -- (-417.938) (-417.278) (-415.585) [-418.762] * (-416.200) [-420.288] (-415.733) (-422.014) -- 0:00:51
Average standard deviation of split frequencies: 0.028824
135500 -- (-415.748) (-415.361) (-416.196) [-418.251] * (-416.125) (-415.736) [-416.885] (-421.382) -- 0:00:51
136000 -- (-416.674) (-415.257) (-416.321) [-417.131] * [-415.903] (-418.661) (-416.297) (-416.891) -- 0:00:50
136500 -- (-415.540) (-415.422) (-415.962) [-415.794] * [-416.067] (-418.772) (-418.194) (-418.915) -- 0:00:50
137000 -- (-415.658) [-415.729] (-417.582) (-417.891) * [-422.029] (-425.322) (-417.653) (-420.307) -- 0:00:50
137500 -- (-417.146) (-416.004) [-415.215] (-416.610) * (-416.777) (-415.360) (-415.495) [-415.984] -- 0:00:50
138000 -- (-415.360) (-417.039) [-414.958] (-417.112) * (-424.975) (-416.113) (-417.213) [-418.293] -- 0:00:49
138500 -- (-414.710) (-416.064) [-417.021] (-417.499) * (-415.825) (-419.429) [-417.253] (-422.687) -- 0:00:49
139000 -- (-416.294) (-416.310) [-416.362] (-417.022) * (-418.287) (-417.335) (-416.660) [-415.731] -- 0:00:49
139500 -- (-415.410) (-416.296) [-415.735] (-416.212) * [-415.970] (-418.653) (-416.688) (-415.259) -- 0:00:49
140000 -- (-416.016) [-416.458] (-416.971) (-418.514) * (-417.973) [-418.836] (-417.083) (-417.804) -- 0:00:49
Average standard deviation of split frequencies: 0.026810
140500 -- (-414.934) (-418.495) [-415.672] (-414.658) * (-415.409) [-418.106] (-415.615) (-420.229) -- 0:00:48
141000 -- (-415.400) (-416.741) [-415.154] (-417.394) * [-421.482] (-414.903) (-416.780) (-415.926) -- 0:00:48
141500 -- [-414.886] (-416.334) (-416.357) (-417.242) * (-420.653) [-414.771] (-416.533) (-416.365) -- 0:00:48
142000 -- (-416.937) (-417.838) (-423.623) [-416.968] * (-419.305) (-417.156) [-415.058] (-419.812) -- 0:00:48
142500 -- (-419.948) [-415.153] (-421.846) (-416.193) * (-416.342) (-419.312) (-415.090) [-415.028] -- 0:00:54
143000 -- (-417.317) (-415.122) (-421.638) [-420.302] * [-417.043] (-421.007) (-416.674) (-420.899) -- 0:00:53
143500 -- (-416.270) (-416.072) [-420.797] (-416.761) * [-415.554] (-416.649) (-415.341) (-417.326) -- 0:00:53
144000 -- (-418.801) [-418.372] (-420.372) (-423.074) * (-417.367) [-416.286] (-417.648) (-418.566) -- 0:00:53
144500 -- (-414.910) [-416.840] (-417.623) (-415.545) * (-416.409) [-416.668] (-417.650) (-418.418) -- 0:00:53
145000 -- [-416.508] (-417.471) (-419.917) (-415.754) * [-417.103] (-417.069) (-416.166) (-419.755) -- 0:00:53
Average standard deviation of split frequencies: 0.026153
145500 -- (-417.444) [-417.490] (-417.527) (-417.446) * (-415.772) [-417.232] (-420.860) (-417.310) -- 0:00:52
146000 -- (-418.671) (-415.892) [-416.334] (-419.360) * [-416.865] (-416.813) (-415.149) (-419.573) -- 0:00:52
146500 -- (-416.047) (-416.621) (-415.746) [-415.393] * (-418.022) (-414.937) [-415.898] (-415.554) -- 0:00:52
147000 -- [-414.563] (-416.889) (-418.857) (-416.198) * (-415.948) (-414.906) [-415.162] (-416.941) -- 0:00:52
147500 -- (-416.314) (-417.435) [-415.738] (-416.905) * (-419.544) [-415.207] (-415.967) (-418.438) -- 0:00:52
148000 -- [-414.699] (-417.460) (-416.590) (-416.253) * (-415.582) (-415.068) [-416.065] (-414.552) -- 0:00:51
148500 -- [-416.397] (-415.623) (-416.204) (-415.983) * [-415.622] (-415.645) (-416.286) (-415.316) -- 0:00:51
149000 -- [-418.489] (-420.248) (-416.191) (-417.479) * (-416.712) [-415.479] (-416.350) (-420.357) -- 0:00:51
149500 -- (-415.330) (-422.256) (-417.928) [-415.638] * (-417.298) (-418.774) [-416.810] (-416.765) -- 0:00:51
150000 -- (-418.807) (-418.243) (-415.967) [-419.575] * [-417.339] (-418.412) (-416.005) (-414.901) -- 0:00:51
Average standard deviation of split frequencies: 0.026282
150500 -- (-419.608) (-418.363) [-416.575] (-417.881) * (-418.652) [-418.031] (-416.042) (-416.329) -- 0:00:50
151000 -- (-419.359) (-416.713) (-417.316) [-415.166] * (-419.521) (-415.693) [-417.706] (-415.016) -- 0:00:50
151500 -- (-416.744) (-416.611) (-419.092) [-415.176] * (-414.961) (-419.788) (-416.237) [-414.524] -- 0:00:50
152000 -- (-417.608) (-416.377) (-418.942) [-420.050] * [-417.130] (-417.403) (-418.127) (-417.560) -- 0:00:50
152500 -- (-417.256) [-416.601] (-418.794) (-417.677) * (-417.101) [-424.081] (-419.089) (-415.759) -- 0:00:50
153000 -- (-418.958) [-415.940] (-417.150) (-416.576) * (-421.354) (-417.359) [-418.983] (-416.004) -- 0:00:49
153500 -- [-416.243] (-416.993) (-416.680) (-416.030) * (-416.414) (-415.565) (-418.763) [-415.363] -- 0:00:49
154000 -- [-416.782] (-418.567) (-417.105) (-415.617) * (-417.190) (-419.216) [-416.345] (-414.565) -- 0:00:49
154500 -- (-415.529) [-416.314] (-416.274) (-415.494) * (-418.164) (-415.737) (-417.131) [-415.740] -- 0:00:49
155000 -- (-414.651) (-419.218) (-415.692) [-415.677] * (-416.104) (-419.540) [-420.476] (-415.244) -- 0:00:49
Average standard deviation of split frequencies: 0.025837
155500 -- (-415.586) (-416.884) (-415.373) [-418.152] * (-414.886) [-416.105] (-417.582) (-416.070) -- 0:00:48
156000 -- (-416.431) (-419.506) (-418.285) [-417.382] * [-417.183] (-416.806) (-416.415) (-416.291) -- 0:00:48
156500 -- (-419.366) (-419.433) [-415.229] (-416.504) * [-418.516] (-417.743) (-416.168) (-416.789) -- 0:00:48
157000 -- [-415.326] (-417.296) (-415.041) (-418.356) * [-416.144] (-415.114) (-418.528) (-415.652) -- 0:00:48
157500 -- [-415.154] (-419.225) (-415.140) (-420.055) * (-417.447) (-418.517) [-415.767] (-415.683) -- 0:00:48
158000 -- (-416.525) [-416.051] (-415.950) (-420.092) * (-420.731) (-415.653) [-414.947] (-415.161) -- 0:00:47
158500 -- [-418.057] (-418.267) (-416.057) (-418.122) * (-418.437) (-415.665) [-417.374] (-416.453) -- 0:00:47
159000 -- (-415.275) [-416.299] (-416.140) (-417.707) * (-418.500) (-415.601) [-415.489] (-416.867) -- 0:00:52
159500 -- (-415.298) (-415.829) (-424.811) [-415.878] * (-417.102) (-418.267) [-416.075] (-416.989) -- 0:00:52
160000 -- (-416.233) (-417.030) (-416.924) [-417.457] * (-421.182) (-415.224) [-416.290] (-415.280) -- 0:00:52
Average standard deviation of split frequencies: 0.024206
160500 -- (-417.026) (-421.833) (-419.191) [-418.509] * (-419.927) (-418.945) [-417.259] (-418.441) -- 0:00:52
161000 -- [-416.590] (-416.722) (-416.644) (-417.057) * [-417.708] (-416.263) (-421.160) (-418.398) -- 0:00:52
161500 -- [-416.923] (-417.391) (-417.584) (-418.675) * [-417.568] (-417.688) (-418.197) (-422.470) -- 0:00:51
162000 -- (-417.357) [-415.340] (-417.076) (-415.896) * [-415.482] (-414.902) (-418.612) (-415.646) -- 0:00:51
162500 -- (-416.496) (-415.229) (-416.454) [-421.001] * (-419.573) (-415.850) (-415.987) [-415.725] -- 0:00:51
163000 -- (-416.811) [-416.083] (-414.979) (-419.910) * [-416.472] (-418.619) (-415.887) (-421.042) -- 0:00:51
163500 -- [-416.232] (-416.104) (-415.660) (-416.703) * (-414.619) (-421.406) [-416.520] (-417.340) -- 0:00:51
164000 -- [-415.899] (-421.482) (-417.262) (-416.742) * (-420.622) (-415.537) [-417.188] (-421.645) -- 0:00:50
164500 -- [-418.473] (-419.340) (-419.423) (-416.792) * (-418.143) (-415.745) [-416.100] (-417.297) -- 0:00:50
165000 -- (-417.796) (-416.976) (-415.919) [-419.059] * (-418.452) (-416.992) [-416.969] (-415.869) -- 0:00:50
Average standard deviation of split frequencies: 0.024138
165500 -- (-417.537) (-419.187) (-417.115) [-419.182] * (-417.792) [-417.758] (-419.962) (-417.201) -- 0:00:50
166000 -- (-414.981) [-416.651] (-419.711) (-416.234) * [-416.377] (-419.488) (-415.553) (-418.163) -- 0:00:50
166500 -- (-416.819) (-415.207) (-419.637) [-415.880] * (-416.425) [-417.699] (-418.052) (-417.045) -- 0:00:50
167000 -- (-424.183) (-416.022) (-417.273) [-419.051] * (-420.239) (-415.457) [-419.710] (-418.730) -- 0:00:49
167500 -- (-418.906) (-415.496) [-416.582] (-416.581) * (-418.178) (-416.000) [-418.263] (-421.202) -- 0:00:49
168000 -- (-417.789) (-414.722) [-418.112] (-417.430) * (-415.967) [-418.500] (-415.566) (-416.436) -- 0:00:49
168500 -- (-415.355) (-415.602) (-417.278) [-416.986] * [-417.092] (-415.118) (-416.938) (-418.516) -- 0:00:49
169000 -- (-415.778) [-415.462] (-417.548) (-417.813) * [-416.674] (-416.477) (-415.360) (-416.079) -- 0:00:49
169500 -- (-418.742) [-415.922] (-417.489) (-415.167) * (-418.711) (-416.826) (-416.215) [-417.796] -- 0:00:48
170000 -- [-417.627] (-415.117) (-418.603) (-417.296) * (-416.737) [-417.809] (-420.082) (-415.345) -- 0:00:48
Average standard deviation of split frequencies: 0.024991
170500 -- (-415.356) [-416.039] (-416.700) (-417.280) * [-418.846] (-414.955) (-417.421) (-415.636) -- 0:00:48
171000 -- (-416.809) [-418.308] (-418.503) (-416.388) * (-419.126) [-415.612] (-417.232) (-418.053) -- 0:00:48
171500 -- [-418.120] (-417.526) (-418.279) (-417.146) * [-416.561] (-417.048) (-416.187) (-419.638) -- 0:00:48
172000 -- (-415.471) [-416.888] (-416.581) (-416.364) * (-417.503) (-416.145) [-415.593] (-419.769) -- 0:00:48
172500 -- (-420.453) (-416.849) (-416.213) [-416.895] * (-418.248) (-415.624) (-417.935) [-415.741] -- 0:00:47
173000 -- (-416.849) (-417.052) [-417.433] (-418.406) * (-416.966) (-416.650) (-420.779) [-417.965] -- 0:00:47
173500 -- [-416.680] (-422.099) (-421.097) (-417.580) * (-419.641) (-415.792) (-417.057) [-415.419] -- 0:00:47
174000 -- (-415.998) (-416.287) (-421.948) [-417.827] * [-414.890] (-415.144) (-420.225) (-419.012) -- 0:00:47
174500 -- [-417.370] (-421.021) (-418.101) (-416.299) * (-417.069) (-417.053) [-416.218] (-419.533) -- 0:00:47
175000 -- (-415.290) [-416.643] (-417.428) (-416.084) * (-416.483) (-418.462) [-416.399] (-418.257) -- 0:00:47
Average standard deviation of split frequencies: 0.024106
175500 -- (-415.602) [-419.945] (-417.406) (-420.082) * (-414.932) (-419.515) (-416.484) [-417.599] -- 0:00:51
176000 -- [-416.118] (-416.434) (-420.730) (-417.732) * (-415.303) [-416.579] (-416.149) (-416.211) -- 0:00:51
176500 -- (-417.452) [-416.411] (-416.795) (-416.116) * (-416.964) [-415.997] (-414.807) (-417.975) -- 0:00:51
177000 -- [-416.131] (-417.611) (-415.775) (-416.252) * (-416.038) [-417.459] (-414.792) (-416.631) -- 0:00:51
177500 -- [-415.330] (-419.551) (-416.476) (-417.702) * [-416.550] (-414.874) (-416.415) (-416.527) -- 0:00:50
178000 -- [-414.712] (-415.848) (-416.198) (-416.465) * [-417.003] (-416.717) (-416.125) (-416.883) -- 0:00:50
178500 -- (-417.048) [-416.021] (-416.809) (-416.282) * (-417.941) (-421.817) [-417.603] (-419.282) -- 0:00:50
179000 -- [-415.912] (-414.746) (-416.445) (-418.278) * (-416.162) (-422.305) (-416.802) [-417.007] -- 0:00:50
179500 -- (-417.014) (-416.244) [-415.012] (-417.463) * (-415.242) (-418.067) (-415.169) [-417.431] -- 0:00:50
180000 -- (-416.436) [-416.860] (-415.341) (-416.122) * (-414.699) [-415.973] (-415.399) (-417.085) -- 0:00:50
Average standard deviation of split frequencies: 0.022831
180500 -- (-415.363) (-423.648) [-415.373] (-415.604) * [-416.129] (-414.860) (-417.249) (-416.980) -- 0:00:49
181000 -- (-415.572) (-423.689) (-416.300) [-419.202] * [-418.579] (-421.800) (-416.168) (-417.179) -- 0:00:49
181500 -- [-416.534] (-422.880) (-415.674) (-421.214) * (-415.747) (-418.812) (-419.085) [-415.341] -- 0:00:49
182000 -- [-417.236] (-416.456) (-417.473) (-420.527) * (-415.382) (-417.821) (-415.328) [-416.424] -- 0:00:49
182500 -- (-416.520) [-416.910] (-415.838) (-417.937) * [-415.933] (-418.176) (-416.801) (-416.162) -- 0:00:49
183000 -- (-415.065) [-416.859] (-419.901) (-420.055) * (-416.593) (-416.903) (-417.346) [-417.289] -- 0:00:49
183500 -- (-415.228) [-416.077] (-418.226) (-417.245) * [-415.941] (-417.345) (-421.132) (-415.917) -- 0:00:48
184000 -- (-416.656) (-416.673) (-417.018) [-415.206] * [-417.876] (-420.157) (-416.486) (-416.836) -- 0:00:48
184500 -- (-417.872) (-418.164) [-418.189] (-417.026) * (-416.331) [-418.054] (-416.789) (-419.738) -- 0:00:48
185000 -- (-415.929) (-417.103) [-418.179] (-416.548) * (-415.580) (-422.188) [-416.309] (-416.232) -- 0:00:48
Average standard deviation of split frequencies: 0.021543
185500 -- (-417.506) [-418.923] (-414.985) (-420.294) * (-418.717) [-415.637] (-415.536) (-417.148) -- 0:00:48
186000 -- [-416.941] (-416.657) (-423.909) (-418.458) * (-418.748) [-416.251] (-418.072) (-417.107) -- 0:00:48
186500 -- (-416.373) (-416.246) (-424.433) [-416.348] * (-416.097) (-416.239) (-420.336) [-421.026] -- 0:00:47
187000 -- [-415.776] (-415.628) (-421.725) (-416.563) * (-416.106) (-416.943) (-418.810) [-418.247] -- 0:00:47
187500 -- (-415.675) (-416.269) [-418.486] (-415.781) * [-417.913] (-416.559) (-417.676) (-416.640) -- 0:00:47
188000 -- (-416.473) (-419.708) [-416.664] (-417.700) * (-415.112) [-414.629] (-416.454) (-416.474) -- 0:00:47
188500 -- [-415.457] (-431.819) (-415.633) (-418.893) * (-416.547) [-420.758] (-417.958) (-417.720) -- 0:00:47
189000 -- (-419.857) (-418.077) [-415.352] (-416.916) * (-416.983) (-420.178) (-416.498) [-415.106] -- 0:00:47
189500 -- [-423.648] (-416.790) (-415.576) (-416.075) * (-417.576) [-417.768] (-417.011) (-416.925) -- 0:00:47
190000 -- [-415.339] (-417.649) (-414.432) (-414.766) * (-415.390) (-415.554) (-415.446) [-416.002] -- 0:00:46
Average standard deviation of split frequencies: 0.020026
190500 -- (-416.121) (-417.171) [-415.526] (-415.998) * [-417.279] (-419.211) (-417.073) (-416.176) -- 0:00:46
191000 -- (-415.503) [-417.384] (-417.680) (-416.814) * (-415.550) (-416.059) (-419.572) [-415.282] -- 0:00:46
191500 -- (-415.384) [-415.289] (-416.189) (-415.943) * (-416.840) (-415.826) [-416.473] (-415.165) -- 0:00:46
192000 -- (-415.094) (-416.322) [-415.645] (-418.532) * [-416.222] (-416.611) (-416.880) (-416.205) -- 0:00:50
192500 -- (-415.502) (-416.550) (-417.034) [-418.203] * (-416.761) [-415.767] (-417.030) (-415.834) -- 0:00:50
193000 -- (-421.140) [-415.886] (-421.461) (-417.708) * (-418.570) (-422.338) (-419.951) [-414.824] -- 0:00:50
193500 -- (-421.130) (-418.845) (-414.774) [-417.349] * (-415.523) (-418.540) (-418.380) [-418.013] -- 0:00:50
194000 -- (-417.684) (-418.278) (-415.557) [-417.491] * [-415.418] (-415.610) (-418.525) (-418.913) -- 0:00:49
194500 -- (-416.957) [-417.609] (-416.968) (-415.251) * (-416.698) (-415.621) [-416.417] (-417.406) -- 0:00:49
195000 -- (-418.074) (-416.410) (-418.059) [-420.116] * (-416.567) (-418.778) (-415.813) [-415.054] -- 0:00:49
Average standard deviation of split frequencies: 0.020083
195500 -- (-417.184) [-416.405] (-416.292) (-417.313) * (-418.226) (-417.948) [-418.747] (-418.612) -- 0:00:49
196000 -- (-417.488) (-415.338) (-416.099) [-416.482] * (-420.951) (-419.094) (-420.142) [-420.449] -- 0:00:49
196500 -- (-425.724) [-418.198] (-415.980) (-416.019) * (-420.243) [-416.858] (-419.278) (-421.294) -- 0:00:49
197000 -- [-417.337] (-419.413) (-417.200) (-415.918) * [-416.199] (-415.401) (-415.766) (-414.740) -- 0:00:48
197500 -- [-417.452] (-415.520) (-416.104) (-414.927) * (-417.546) [-416.213] (-416.435) (-414.842) -- 0:00:48
198000 -- (-415.639) (-420.865) (-418.248) [-414.675] * (-417.713) (-416.889) (-418.239) [-415.136] -- 0:00:48
198500 -- (-419.879) (-415.579) (-415.989) [-417.443] * (-418.347) (-415.912) (-421.773) [-416.904] -- 0:00:48
199000 -- (-417.643) (-417.666) [-416.626] (-417.063) * (-419.703) [-415.782] (-419.116) (-418.148) -- 0:00:48
199500 -- (-416.407) (-418.630) (-418.136) [-417.963] * (-417.622) (-416.926) [-415.512] (-419.299) -- 0:00:48
200000 -- (-415.986) (-417.544) [-416.355] (-415.791) * [-416.540] (-418.805) (-416.001) (-416.214) -- 0:00:48
Average standard deviation of split frequencies: 0.019263
200500 -- (-415.691) (-416.468) [-415.403] (-415.400) * (-414.861) (-416.385) [-415.386] (-417.742) -- 0:00:47
201000 -- (-416.074) (-417.078) (-420.671) [-414.615] * (-418.538) [-418.084] (-416.182) (-418.619) -- 0:00:47
201500 -- [-415.818] (-416.863) (-419.633) (-417.988) * (-417.360) [-416.812] (-416.368) (-417.534) -- 0:00:47
202000 -- (-414.518) [-415.833] (-415.426) (-418.976) * [-415.245] (-416.626) (-416.468) (-419.668) -- 0:00:47
202500 -- (-415.206) (-417.227) (-415.630) [-417.569] * (-415.420) [-416.280] (-421.126) (-415.496) -- 0:00:47
203000 -- [-416.171] (-416.007) (-418.191) (-415.841) * (-416.199) [-415.353] (-420.386) (-415.335) -- 0:00:47
203500 -- (-424.250) (-417.281) (-414.899) [-417.272] * (-415.537) (-415.405) [-420.478] (-415.416) -- 0:00:46
204000 -- (-418.132) [-415.246] (-415.756) (-415.877) * (-415.867) (-415.512) (-417.083) [-416.134] -- 0:00:46
204500 -- [-417.667] (-415.993) (-414.985) (-415.283) * (-419.756) [-418.240] (-416.361) (-417.559) -- 0:00:46
205000 -- (-419.155) (-419.450) [-415.993] (-416.258) * [-417.852] (-416.111) (-416.756) (-415.859) -- 0:00:46
Average standard deviation of split frequencies: 0.017964
205500 -- (-417.823) [-415.829] (-415.231) (-416.999) * (-417.232) [-415.548] (-415.728) (-416.133) -- 0:00:46
206000 -- (-417.734) (-418.652) [-417.392] (-415.132) * (-417.030) (-418.274) [-416.051] (-415.405) -- 0:00:46
206500 -- (-418.494) [-417.001] (-417.963) (-415.609) * [-416.267] (-419.629) (-415.347) (-418.254) -- 0:00:46
207000 -- (-415.941) (-415.575) (-417.184) [-416.097] * (-416.671) (-415.800) [-415.383] (-420.209) -- 0:00:45
207500 -- [-416.230] (-417.325) (-416.925) (-415.264) * (-415.564) (-415.527) (-414.990) [-416.636] -- 0:00:45
208000 -- (-417.745) (-416.498) [-417.443] (-415.561) * [-414.569] (-417.251) (-417.274) (-419.508) -- 0:00:45
208500 -- (-421.810) (-417.988) [-418.952] (-416.196) * (-414.560) (-420.472) (-418.065) [-417.760] -- 0:00:45
209000 -- (-416.188) (-417.197) [-420.673] (-417.802) * (-415.040) (-421.265) (-419.097) [-417.836] -- 0:00:49
209500 -- (-416.038) (-417.666) [-417.460] (-415.750) * [-415.966] (-414.892) (-415.706) (-417.185) -- 0:00:49
210000 -- (-415.024) (-415.439) [-416.424] (-416.482) * (-418.984) (-416.755) [-416.489] (-415.893) -- 0:00:48
Average standard deviation of split frequencies: 0.017901
210500 -- (-417.788) [-416.120] (-416.735) (-416.802) * (-417.096) (-416.250) (-418.689) [-416.184] -- 0:00:48
211000 -- (-415.504) (-421.262) [-416.637] (-417.218) * (-415.441) [-418.547] (-415.845) (-420.045) -- 0:00:48
211500 -- (-416.015) (-419.213) [-415.360] (-414.708) * [-418.341] (-416.956) (-415.363) (-417.309) -- 0:00:48
212000 -- (-415.966) [-416.563] (-415.133) (-415.029) * [-414.930] (-416.522) (-417.649) (-415.922) -- 0:00:48
212500 -- [-419.240] (-420.671) (-416.080) (-418.314) * [-416.151] (-417.704) (-416.408) (-420.218) -- 0:00:48
213000 -- (-419.925) (-421.398) (-416.575) [-415.811] * [-417.417] (-415.623) (-416.674) (-414.959) -- 0:00:48
213500 -- [-419.295] (-417.629) (-416.167) (-417.089) * (-418.024) (-415.018) (-418.708) [-416.656] -- 0:00:47
214000 -- (-416.275) [-416.080] (-415.777) (-421.079) * (-420.012) (-417.011) [-419.242] (-416.832) -- 0:00:47
214500 -- (-417.584) (-416.688) (-419.505) [-418.775] * (-415.794) (-418.479) (-418.347) [-415.417] -- 0:00:47
215000 -- (-416.830) [-417.141] (-416.065) (-418.095) * (-415.601) [-415.539] (-417.331) (-417.339) -- 0:00:47
Average standard deviation of split frequencies: 0.018987
215500 -- (-415.891) (-420.086) [-416.650] (-417.162) * (-416.722) [-415.432] (-418.143) (-416.090) -- 0:00:47
216000 -- (-424.509) [-418.084] (-415.198) (-416.900) * [-419.803] (-417.622) (-420.241) (-414.818) -- 0:00:47
216500 -- (-416.231) (-417.582) (-415.137) [-415.650] * [-415.584] (-415.715) (-420.537) (-418.959) -- 0:00:47
217000 -- (-416.376) [-415.909] (-421.127) (-414.938) * (-416.824) (-416.373) (-416.592) [-414.868] -- 0:00:46
217500 -- [-420.065] (-417.354) (-416.643) (-416.572) * (-415.883) [-415.563] (-416.370) (-415.521) -- 0:00:46
218000 -- (-417.967) [-415.544] (-417.211) (-415.030) * (-416.232) (-416.125) [-415.185] (-417.858) -- 0:00:46
218500 -- [-416.965] (-419.779) (-418.672) (-415.659) * (-418.003) (-420.220) (-418.355) [-415.960] -- 0:00:46
219000 -- [-417.990] (-416.689) (-418.620) (-418.676) * [-416.371] (-415.813) (-416.296) (-418.740) -- 0:00:46
219500 -- (-417.105) [-415.497] (-417.636) (-415.182) * [-416.815] (-416.078) (-416.146) (-419.969) -- 0:00:46
220000 -- (-422.364) (-417.128) [-416.926] (-416.515) * [-417.620] (-418.404) (-416.566) (-416.051) -- 0:00:46
Average standard deviation of split frequencies: 0.019974
220500 -- (-419.151) [-415.192] (-415.768) (-423.731) * (-415.386) (-416.018) (-418.001) [-417.231] -- 0:00:45
221000 -- [-416.010] (-414.715) (-421.202) (-420.296) * [-416.251] (-418.886) (-416.755) (-417.094) -- 0:00:45
221500 -- [-415.920] (-416.535) (-417.048) (-421.826) * (-417.488) (-414.932) (-416.972) [-416.033] -- 0:00:45
222000 -- (-416.924) (-414.588) [-417.716] (-417.222) * (-420.058) [-415.591] (-417.043) (-416.003) -- 0:00:45
222500 -- [-416.009] (-415.353) (-416.135) (-415.088) * (-416.060) [-415.576] (-414.593) (-414.943) -- 0:00:45
223000 -- (-417.170) [-416.017] (-415.066) (-417.230) * (-415.129) [-417.182] (-417.364) (-418.102) -- 0:00:45
223500 -- (-418.086) [-421.692] (-419.391) (-414.862) * (-414.945) [-415.590] (-417.875) (-420.650) -- 0:00:45
224000 -- (-421.249) [-422.952] (-419.237) (-416.136) * [-419.064] (-415.071) (-416.707) (-416.266) -- 0:00:45
224500 -- (-415.704) [-416.769] (-419.472) (-415.195) * (-416.768) (-417.206) (-421.540) [-420.528] -- 0:00:44
225000 -- (-414.994) (-419.340) [-417.877] (-417.512) * (-415.786) [-416.878] (-415.740) (-416.083) -- 0:00:44
Average standard deviation of split frequencies: 0.019816
225500 -- [-417.169] (-417.627) (-414.797) (-415.360) * (-415.382) (-417.151) [-418.702] (-415.947) -- 0:00:48
226000 -- [-418.353] (-415.417) (-415.082) (-417.644) * (-423.422) (-415.359) (-419.324) [-420.543] -- 0:00:47
226500 -- (-416.534) (-415.944) [-419.871] (-417.126) * (-418.874) (-425.352) [-415.466] (-416.602) -- 0:00:47
227000 -- (-417.037) (-416.966) [-421.884] (-414.648) * [-421.247] (-422.545) (-417.583) (-421.797) -- 0:00:47
227500 -- (-416.749) [-418.824] (-414.975) (-414.764) * (-416.682) (-419.148) [-415.825] (-417.429) -- 0:00:47
228000 -- (-415.613) [-414.739] (-415.560) (-418.069) * (-422.834) [-414.831] (-416.613) (-418.486) -- 0:00:47
228500 -- (-415.941) (-415.386) (-416.259) [-418.395] * (-417.009) (-415.848) (-420.877) [-417.964] -- 0:00:47
229000 -- (-414.806) (-418.229) [-415.624] (-416.154) * (-415.707) (-414.567) (-415.901) [-418.248] -- 0:00:47
229500 -- (-420.338) (-415.727) (-416.474) [-415.590] * [-416.547] (-415.613) (-416.609) (-427.195) -- 0:00:47
230000 -- [-415.102] (-415.537) (-416.596) (-414.925) * (-414.658) [-416.557] (-421.133) (-416.730) -- 0:00:46
Average standard deviation of split frequencies: 0.020550
230500 -- (-415.450) [-419.352] (-417.624) (-416.324) * (-415.469) (-416.480) (-419.843) [-415.590] -- 0:00:46
231000 -- [-414.716] (-417.621) (-420.179) (-420.466) * (-415.806) (-420.283) (-419.557) [-415.485] -- 0:00:46
231500 -- (-416.360) (-415.842) (-417.921) [-417.318] * [-415.558] (-415.317) (-414.697) (-422.400) -- 0:00:46
232000 -- (-416.388) [-415.539] (-416.301) (-420.082) * [-416.227] (-415.379) (-414.806) (-417.937) -- 0:00:46
232500 -- (-416.697) [-418.919] (-419.538) (-418.657) * (-418.126) (-417.195) [-416.640] (-417.285) -- 0:00:46
233000 -- [-415.245] (-418.438) (-416.515) (-416.562) * (-418.942) (-416.638) (-416.975) [-415.856] -- 0:00:46
233500 -- (-417.752) (-417.003) [-415.420] (-414.565) * (-415.201) (-416.121) [-415.728] (-416.571) -- 0:00:45
234000 -- (-416.519) (-416.301) [-415.028] (-414.999) * (-415.081) (-415.645) [-416.343] (-417.693) -- 0:00:45
234500 -- (-416.457) [-415.959] (-417.121) (-414.923) * (-423.401) (-416.268) [-418.223] (-416.314) -- 0:00:45
235000 -- [-417.651] (-416.457) (-415.724) (-417.130) * (-414.973) (-419.180) [-418.841] (-423.405) -- 0:00:45
Average standard deviation of split frequencies: 0.020197
235500 -- [-415.942] (-416.890) (-416.882) (-418.469) * (-416.568) [-419.110] (-418.003) (-417.897) -- 0:00:45
236000 -- (-422.140) [-417.025] (-418.403) (-418.690) * (-417.894) (-417.481) (-415.252) [-416.309] -- 0:00:45
236500 -- (-421.552) [-415.171] (-416.834) (-415.902) * (-416.709) [-417.465] (-417.766) (-417.113) -- 0:00:45
237000 -- (-417.247) [-415.825] (-417.134) (-416.729) * (-416.770) (-415.986) (-415.567) [-416.459] -- 0:00:45
237500 -- (-417.593) [-415.389] (-415.896) (-416.280) * (-421.546) (-416.152) [-417.335] (-419.655) -- 0:00:44
238000 -- (-416.395) [-414.698] (-415.295) (-415.712) * (-421.118) (-418.891) (-417.227) [-417.241] -- 0:00:44
238500 -- (-416.837) (-416.691) [-418.446] (-414.977) * (-415.406) [-415.895] (-415.661) (-417.654) -- 0:00:44
239000 -- (-415.533) [-414.625] (-418.960) (-415.216) * (-415.801) (-417.552) [-414.999] (-416.555) -- 0:00:44
239500 -- (-418.246) (-414.627) (-416.224) [-416.450] * (-415.419) (-419.354) (-416.076) [-419.799] -- 0:00:44
240000 -- (-419.964) [-419.838] (-418.315) (-416.320) * (-420.425) [-415.933] (-415.834) (-419.061) -- 0:00:44
Average standard deviation of split frequencies: 0.019278
240500 -- (-416.488) (-416.893) (-417.418) [-415.700] * (-417.106) [-415.867] (-415.332) (-416.614) -- 0:00:44
241000 -- (-417.001) (-418.021) [-417.111] (-415.822) * (-417.816) [-416.192] (-416.292) (-416.304) -- 0:00:44
241500 -- (-415.769) (-421.702) [-417.289] (-415.282) * (-417.672) [-420.757] (-415.000) (-417.903) -- 0:00:43
242000 -- [-419.898] (-418.673) (-417.784) (-415.197) * [-417.232] (-419.028) (-417.160) (-419.349) -- 0:00:43
242500 -- [-418.969] (-415.139) (-415.438) (-416.919) * (-417.979) (-418.983) (-421.676) [-416.516] -- 0:00:46
243000 -- (-417.594) [-418.366] (-418.658) (-422.027) * (-418.397) (-416.711) (-418.993) [-416.668] -- 0:00:46
243500 -- (-414.555) (-417.045) (-419.116) [-417.297] * (-415.776) (-418.513) (-418.736) [-416.873] -- 0:00:46
244000 -- [-415.496] (-417.014) (-419.302) (-417.117) * (-415.597) [-415.263] (-416.192) (-418.001) -- 0:00:46
244500 -- (-422.669) (-416.454) [-415.890] (-417.311) * (-415.022) (-421.333) (-417.884) [-418.318] -- 0:00:46
245000 -- (-421.235) (-422.188) [-416.579] (-416.694) * (-416.953) [-419.263] (-415.700) (-415.812) -- 0:00:46
Average standard deviation of split frequencies: 0.018356
245500 -- [-418.612] (-417.196) (-417.900) (-416.808) * (-417.586) (-419.988) [-417.920] (-415.502) -- 0:00:46
246000 -- (-416.730) [-417.576] (-417.344) (-417.154) * (-417.827) [-416.192] (-416.597) (-416.701) -- 0:00:45
246500 -- (-418.210) [-418.039] (-417.710) (-417.984) * (-416.037) (-415.624) (-417.513) [-417.303] -- 0:00:45
247000 -- (-422.614) (-416.145) [-415.947] (-417.515) * (-416.119) [-416.230] (-417.048) (-420.518) -- 0:00:45
247500 -- (-418.010) (-417.246) (-414.858) [-417.142] * [-417.588] (-417.179) (-417.669) (-416.971) -- 0:00:45
248000 -- (-417.935) [-418.014] (-417.220) (-418.817) * [-415.991] (-417.069) (-417.002) (-415.628) -- 0:00:45
248500 -- (-417.156) (-416.795) [-416.352] (-417.926) * (-416.855) (-416.724) [-417.205] (-417.793) -- 0:00:45
249000 -- (-423.460) [-414.809] (-415.668) (-415.313) * (-419.997) [-421.743] (-415.644) (-418.639) -- 0:00:45
249500 -- (-418.929) (-416.634) [-415.429] (-418.835) * (-414.578) [-416.743] (-415.535) (-421.181) -- 0:00:45
250000 -- (-415.989) (-416.729) [-416.407] (-420.232) * (-417.712) (-419.450) (-416.152) [-416.559] -- 0:00:45
Average standard deviation of split frequencies: 0.017239
250500 -- (-416.506) (-417.147) [-419.579] (-418.284) * (-415.801) (-417.829) (-417.903) [-416.429] -- 0:00:44
251000 -- (-416.445) [-415.969] (-417.795) (-415.526) * (-417.832) [-417.238] (-417.853) (-417.061) -- 0:00:44
251500 -- [-419.747] (-420.657) (-415.192) (-416.786) * (-419.227) (-421.311) [-419.730] (-414.438) -- 0:00:44
252000 -- (-422.212) [-416.564] (-419.730) (-418.192) * (-418.103) (-415.954) (-418.317) [-416.651] -- 0:00:44
252500 -- (-417.551) [-418.455] (-420.443) (-416.063) * (-418.006) (-415.912) (-416.704) [-415.901] -- 0:00:44
253000 -- (-414.704) (-416.657) [-415.745] (-415.603) * (-415.283) [-415.917] (-415.740) (-418.832) -- 0:00:44
253500 -- (-415.090) [-415.729] (-417.614) (-417.158) * (-416.867) [-415.298] (-416.543) (-415.912) -- 0:00:44
254000 -- (-416.900) [-416.785] (-414.675) (-415.431) * (-420.492) [-415.388] (-420.203) (-416.952) -- 0:00:44
254500 -- [-416.816] (-416.724) (-419.035) (-415.638) * (-422.310) (-416.692) [-419.233] (-418.470) -- 0:00:43
255000 -- (-416.191) (-417.074) [-416.032] (-420.540) * (-415.388) (-416.973) [-417.434] (-416.808) -- 0:00:43
Average standard deviation of split frequencies: 0.016061
255500 -- [-417.787] (-417.310) (-417.699) (-423.665) * [-415.511] (-416.479) (-417.417) (-417.513) -- 0:00:43
256000 -- (-420.120) (-417.587) [-417.126] (-416.836) * (-417.087) [-414.899] (-415.390) (-415.931) -- 0:00:43
256500 -- (-419.078) (-414.890) (-417.132) [-416.186] * [-416.980] (-419.979) (-415.768) (-415.229) -- 0:00:43
257000 -- (-418.729) [-415.470] (-414.975) (-416.622) * (-415.407) [-417.365] (-417.500) (-418.419) -- 0:00:43
257500 -- (-416.845) (-417.779) (-418.373) [-417.295] * [-417.142] (-420.667) (-418.652) (-417.696) -- 0:00:43
258000 -- (-417.718) [-418.004] (-421.236) (-419.712) * [-417.964] (-418.077) (-416.496) (-417.691) -- 0:00:43
258500 -- (-418.295) [-416.930] (-421.548) (-417.996) * (-417.521) [-415.958] (-417.007) (-415.534) -- 0:00:43
259000 -- (-415.561) (-415.773) (-419.758) [-417.190] * (-416.859) [-417.390] (-417.354) (-415.733) -- 0:00:42
259500 -- (-416.881) [-417.151] (-420.605) (-419.244) * (-427.238) [-420.010] (-417.225) (-416.628) -- 0:00:45
260000 -- [-414.724] (-416.222) (-416.459) (-416.462) * (-416.669) [-418.100] (-416.057) (-417.334) -- 0:00:45
Average standard deviation of split frequencies: 0.015271
260500 -- (-416.144) [-417.402] (-418.270) (-416.588) * [-418.582] (-420.749) (-418.642) (-415.173) -- 0:00:45
261000 -- (-415.018) [-416.912] (-416.068) (-419.849) * (-420.016) [-416.026] (-415.796) (-417.281) -- 0:00:45
261500 -- [-418.218] (-420.791) (-417.497) (-420.992) * [-415.895] (-423.710) (-414.879) (-415.106) -- 0:00:45
262000 -- (-416.500) [-420.636] (-418.982) (-419.491) * (-419.938) (-417.769) (-415.602) [-415.491] -- 0:00:45
262500 -- [-415.172] (-418.887) (-417.554) (-416.368) * (-417.340) [-416.144] (-415.599) (-417.266) -- 0:00:44
263000 -- [-414.652] (-417.884) (-417.060) (-419.026) * [-415.657] (-421.224) (-417.320) (-418.573) -- 0:00:44
263500 -- (-414.752) (-419.822) (-420.419) [-416.157] * (-416.925) [-419.946] (-416.911) (-419.644) -- 0:00:44
264000 -- [-419.167] (-417.925) (-415.928) (-416.762) * (-417.800) (-418.031) [-417.159] (-416.421) -- 0:00:44
264500 -- [-416.119] (-416.052) (-415.848) (-417.586) * [-416.043] (-417.553) (-416.035) (-416.618) -- 0:00:44
265000 -- (-415.774) (-415.598) (-416.696) [-418.318] * [-421.126] (-418.854) (-418.681) (-419.999) -- 0:00:44
Average standard deviation of split frequencies: 0.015851
265500 -- (-418.435) (-414.916) (-416.542) [-418.992] * (-415.009) (-423.991) [-416.181] (-416.421) -- 0:00:44
266000 -- (-415.797) (-416.992) [-417.419] (-421.600) * (-416.337) [-418.150] (-417.999) (-417.310) -- 0:00:44
266500 -- (-418.088) [-415.845] (-415.211) (-421.902) * (-415.603) (-418.417) [-414.788] (-415.718) -- 0:00:44
267000 -- (-415.482) (-417.154) [-415.363] (-417.236) * (-415.971) [-417.431] (-415.039) (-417.927) -- 0:00:43
267500 -- (-415.791) (-418.123) [-416.523] (-419.773) * [-415.862] (-415.610) (-414.976) (-416.428) -- 0:00:43
268000 -- (-416.867) [-417.016] (-418.764) (-421.846) * (-417.420) [-419.851] (-420.403) (-416.846) -- 0:00:43
268500 -- (-417.939) (-419.001) [-416.094] (-421.520) * [-415.820] (-420.628) (-416.237) (-415.709) -- 0:00:43
269000 -- (-417.401) [-416.505] (-416.008) (-416.956) * (-416.235) [-415.064] (-416.234) (-414.636) -- 0:00:43
269500 -- (-417.248) (-420.363) (-418.423) [-416.554] * [-415.893] (-416.384) (-417.741) (-414.789) -- 0:00:43
270000 -- (-417.405) [-415.188] (-417.353) (-414.693) * (-417.045) (-417.200) [-416.639] (-416.229) -- 0:00:43
Average standard deviation of split frequencies: 0.013016
270500 -- [-416.787] (-416.465) (-418.664) (-417.883) * (-417.230) (-416.331) (-415.760) [-416.236] -- 0:00:43
271000 -- (-417.019) (-415.436) (-417.841) [-416.642] * (-416.998) (-416.616) (-417.506) [-416.246] -- 0:00:43
271500 -- (-417.354) (-416.017) (-416.614) [-416.923] * (-416.376) [-415.391] (-416.051) (-415.164) -- 0:00:42
272000 -- (-418.646) (-417.882) [-414.975] (-416.771) * [-415.617] (-415.628) (-418.214) (-418.662) -- 0:00:42
272500 -- (-421.716) (-416.261) (-417.239) [-416.017] * (-417.702) [-416.237] (-415.491) (-420.583) -- 0:00:42
273000 -- [-418.070] (-416.788) (-416.234) (-416.263) * (-418.946) (-414.998) (-416.620) [-417.555] -- 0:00:42
273500 -- (-415.709) (-418.008) [-415.768] (-419.488) * (-420.551) [-417.381] (-416.851) (-417.594) -- 0:00:42
274000 -- (-414.633) [-419.632] (-416.254) (-418.171) * (-417.076) (-419.774) [-416.155] (-417.556) -- 0:00:42
274500 -- [-415.347] (-419.719) (-418.485) (-415.444) * [-414.842] (-416.191) (-414.893) (-418.664) -- 0:00:42
275000 -- (-415.714) (-415.746) (-417.715) [-414.829] * (-414.885) (-417.774) (-417.785) [-415.307] -- 0:00:42
Average standard deviation of split frequencies: 0.012495
275500 -- [-417.137] (-415.865) (-415.031) (-415.785) * [-415.313] (-416.511) (-417.239) (-416.971) -- 0:00:42
276000 -- (-416.590) (-416.712) (-418.029) [-415.199] * (-417.691) [-417.437] (-418.377) (-420.185) -- 0:00:41
276500 -- (-416.524) (-415.392) (-415.871) [-419.777] * [-419.644] (-417.422) (-418.044) (-420.966) -- 0:00:44
277000 -- (-417.030) (-419.486) (-416.001) [-418.404] * (-416.166) (-417.630) [-417.272] (-416.074) -- 0:00:44
277500 -- [-417.270] (-417.148) (-415.230) (-419.244) * (-416.601) (-421.978) (-416.352) [-414.967] -- 0:00:44
278000 -- [-416.856] (-417.626) (-417.509) (-419.397) * (-418.598) (-420.702) [-416.199] (-415.375) -- 0:00:44
278500 -- (-418.167) (-416.817) [-417.979] (-415.517) * [-416.911] (-420.061) (-416.755) (-415.844) -- 0:00:44
279000 -- (-419.770) (-419.651) (-419.509) [-415.930] * (-424.122) (-418.325) [-416.367] (-415.338) -- 0:00:43
279500 -- [-420.005] (-417.476) (-419.568) (-418.554) * (-423.132) [-418.390] (-415.542) (-417.192) -- 0:00:43
280000 -- (-419.919) (-416.798) (-419.037) [-416.099] * [-417.504] (-416.745) (-417.939) (-416.157) -- 0:00:43
Average standard deviation of split frequencies: 0.010696
280500 -- (-420.590) (-415.039) (-419.854) [-415.211] * (-417.928) (-416.769) (-416.583) [-418.435] -- 0:00:43
281000 -- (-416.937) (-415.519) [-416.502] (-416.361) * (-424.674) [-419.037] (-421.424) (-416.917) -- 0:00:43
281500 -- (-424.540) [-415.476] (-421.821) (-415.394) * (-419.603) (-414.741) [-417.311] (-420.186) -- 0:00:43
282000 -- (-418.667) (-418.367) [-415.461] (-417.276) * (-418.101) (-415.810) (-417.897) [-415.781] -- 0:00:43
282500 -- (-415.922) (-418.040) [-415.031] (-416.379) * [-418.009] (-417.156) (-416.142) (-418.503) -- 0:00:43
283000 -- (-422.686) (-415.956) [-415.444] (-414.955) * (-420.912) [-417.410] (-419.935) (-416.622) -- 0:00:43
283500 -- (-418.783) (-416.986) (-418.946) [-416.185] * (-417.235) (-420.402) (-416.320) [-417.082] -- 0:00:42
284000 -- (-416.915) [-416.629] (-424.079) (-417.316) * (-415.287) (-415.965) [-417.355] (-417.213) -- 0:00:42
284500 -- (-415.441) [-415.223] (-417.505) (-415.582) * [-416.174] (-422.313) (-415.922) (-417.777) -- 0:00:42
285000 -- (-416.054) (-416.514) (-415.772) [-417.375] * (-415.594) [-416.064] (-418.597) (-416.017) -- 0:00:42
Average standard deviation of split frequencies: 0.010584
285500 -- [-416.185] (-415.061) (-419.158) (-420.501) * (-420.062) [-416.530] (-414.835) (-418.385) -- 0:00:42
286000 -- (-415.534) (-417.556) (-421.490) [-417.968] * [-415.484] (-417.770) (-415.043) (-416.136) -- 0:00:42
286500 -- [-415.155] (-416.023) (-422.403) (-416.862) * (-419.263) (-415.463) [-417.894] (-417.177) -- 0:00:42
287000 -- (-418.182) [-415.825] (-420.768) (-417.237) * (-417.647) (-415.053) (-419.526) [-415.419] -- 0:00:42
287500 -- (-418.409) [-416.683] (-416.730) (-417.156) * (-414.662) (-414.779) [-416.349] (-423.226) -- 0:00:42
288000 -- [-414.780] (-415.067) (-417.721) (-422.104) * [-416.365] (-414.957) (-418.716) (-417.148) -- 0:00:42
288500 -- (-414.833) (-417.700) [-418.117] (-416.496) * (-415.134) (-419.732) [-416.075] (-415.262) -- 0:00:41
289000 -- (-414.956) [-415.877] (-415.489) (-419.002) * (-415.788) (-418.808) [-421.117] (-417.889) -- 0:00:41
289500 -- [-415.154] (-415.404) (-416.841) (-416.192) * [-415.264] (-416.054) (-418.569) (-418.612) -- 0:00:41
290000 -- (-414.780) (-418.359) [-416.269] (-415.913) * (-415.355) (-416.017) (-415.681) [-415.285] -- 0:00:41
Average standard deviation of split frequencies: 0.011523
290500 -- (-417.710) [-415.700] (-417.891) (-415.516) * (-420.391) (-420.842) (-417.928) [-416.135] -- 0:00:41
291000 -- (-419.804) (-415.688) (-415.720) [-418.609] * (-416.827) [-418.319] (-416.607) (-417.450) -- 0:00:41
291500 -- (-416.814) (-417.191) (-415.077) [-416.981] * (-418.900) (-417.713) (-415.734) [-420.284] -- 0:00:41
292000 -- [-416.136] (-415.892) (-416.290) (-415.122) * [-416.706] (-416.168) (-417.290) (-415.928) -- 0:00:41
292500 -- (-415.636) (-419.265) (-416.785) [-416.995] * [-417.174] (-417.320) (-414.967) (-416.601) -- 0:00:41
293000 -- [-416.646] (-419.306) (-417.946) (-417.124) * (-418.104) (-417.880) (-414.968) [-417.311] -- 0:00:43
293500 -- (-418.099) (-415.017) (-414.790) [-417.279] * (-417.602) [-415.042] (-418.402) (-417.865) -- 0:00:43
294000 -- (-416.613) (-416.484) [-416.443] (-418.205) * (-415.387) (-418.648) [-417.339] (-416.746) -- 0:00:43
294500 -- (-416.200) (-416.190) [-415.320] (-420.128) * (-415.881) (-418.646) [-417.333] (-418.854) -- 0:00:43
295000 -- [-415.780] (-418.189) (-415.474) (-418.839) * (-416.918) (-417.683) (-416.745) [-414.820] -- 0:00:43
Average standard deviation of split frequencies: 0.011767
295500 -- (-418.846) (-419.592) [-415.551] (-421.072) * (-416.122) (-417.765) [-416.372] (-416.329) -- 0:00:42
296000 -- (-415.177) (-415.835) [-415.739] (-417.773) * (-414.888) [-419.870] (-415.672) (-417.885) -- 0:00:42
296500 -- (-418.287) [-416.552] (-416.707) (-415.905) * [-417.980] (-416.615) (-415.643) (-415.574) -- 0:00:42
297000 -- [-418.896] (-416.790) (-416.137) (-417.381) * (-415.321) (-418.513) [-417.946] (-420.240) -- 0:00:42
297500 -- (-417.177) [-416.572] (-416.979) (-417.625) * [-416.217] (-415.866) (-418.738) (-416.522) -- 0:00:42
298000 -- (-415.237) (-416.803) [-416.692] (-417.448) * (-422.358) (-417.172) (-416.649) [-416.240] -- 0:00:42
298500 -- (-418.796) (-416.815) (-417.395) [-415.962] * (-421.730) (-416.542) [-420.024] (-416.654) -- 0:00:42
299000 -- (-417.340) (-417.821) [-416.597] (-416.417) * (-421.525) [-416.916] (-420.305) (-416.033) -- 0:00:42
299500 -- (-417.062) [-418.591] (-418.865) (-415.696) * (-416.139) [-415.147] (-417.712) (-416.317) -- 0:00:42
300000 -- (-419.716) (-415.951) [-419.131] (-416.078) * (-418.778) [-415.828] (-417.098) (-418.439) -- 0:00:42
Average standard deviation of split frequencies: 0.010801
300500 -- (-415.895) [-416.774] (-415.006) (-418.948) * (-417.125) [-416.899] (-416.668) (-421.993) -- 0:00:41
301000 -- (-416.794) (-418.792) (-415.892) [-416.209] * (-417.019) (-414.959) (-416.623) [-417.678] -- 0:00:41
301500 -- (-418.338) [-418.843] (-416.885) (-416.440) * (-424.184) [-416.284] (-416.836) (-418.002) -- 0:00:41
302000 -- (-417.765) (-416.162) (-418.771) [-418.616] * [-416.572] (-416.956) (-415.561) (-414.723) -- 0:00:41
302500 -- (-419.078) (-416.699) (-416.271) [-418.041] * (-415.618) (-417.799) (-417.557) [-416.037] -- 0:00:41
303000 -- (-420.319) (-417.657) [-415.919] (-418.394) * [-416.360] (-418.167) (-417.592) (-418.807) -- 0:00:41
303500 -- [-419.698] (-416.452) (-419.680) (-415.518) * (-415.426) (-416.906) (-416.748) [-415.059] -- 0:00:41
304000 -- [-417.691] (-419.604) (-415.762) (-415.261) * (-416.152) [-417.186] (-417.911) (-418.634) -- 0:00:41
304500 -- (-414.703) (-418.283) (-419.130) [-416.177] * [-418.028] (-416.931) (-417.366) (-418.248) -- 0:00:41
305000 -- (-417.226) (-418.410) (-415.805) [-416.071] * [-415.149] (-417.541) (-417.437) (-415.087) -- 0:00:41
Average standard deviation of split frequencies: 0.010703
305500 -- (-419.195) [-418.906] (-420.274) (-418.856) * [-415.086] (-418.814) (-416.149) (-415.655) -- 0:00:40
306000 -- (-418.468) (-417.571) [-417.753] (-417.406) * (-416.431) [-416.484] (-416.304) (-415.878) -- 0:00:40
306500 -- (-417.432) (-417.070) [-418.452] (-418.074) * (-418.575) (-414.768) [-421.012] (-418.388) -- 0:00:40
307000 -- (-416.733) (-417.069) [-417.534] (-419.528) * [-415.977] (-416.202) (-416.326) (-416.683) -- 0:00:40
307500 -- (-417.208) (-419.239) (-419.929) [-417.240] * (-414.863) (-414.768) [-416.301] (-416.668) -- 0:00:40
308000 -- (-418.001) (-416.833) [-416.838] (-417.802) * (-417.792) (-415.157) (-419.294) [-414.753] -- 0:00:40
308500 -- (-419.021) (-415.800) [-415.405] (-414.450) * (-414.919) (-414.583) [-417.972] (-417.368) -- 0:00:40
309000 -- [-417.386] (-416.267) (-417.359) (-418.651) * (-415.048) (-416.149) (-419.231) [-416.716] -- 0:00:40
309500 -- (-417.662) [-417.016] (-419.589) (-416.346) * (-415.461) [-415.249] (-417.478) (-423.296) -- 0:00:40
310000 -- (-416.695) [-421.178] (-418.692) (-418.138) * (-416.490) (-415.219) [-418.732] (-420.306) -- 0:00:42
Average standard deviation of split frequencies: 0.009694
310500 -- (-416.056) (-417.550) (-416.887) [-418.192] * (-418.785) (-416.039) [-417.281] (-416.164) -- 0:00:42
311000 -- (-416.260) (-415.521) (-416.361) [-417.862] * (-415.275) [-415.789] (-415.652) (-417.906) -- 0:00:42
311500 -- (-417.428) (-415.842) [-416.699] (-418.753) * [-417.780] (-415.741) (-415.400) (-416.824) -- 0:00:41
312000 -- [-416.462] (-416.840) (-418.303) (-415.954) * (-417.396) [-417.661] (-417.503) (-416.616) -- 0:00:41
312500 -- (-415.084) (-416.231) [-416.720] (-416.936) * (-419.588) (-418.059) (-418.729) [-417.258] -- 0:00:41
313000 -- (-415.129) [-417.025] (-418.635) (-421.188) * (-415.429) (-415.448) [-416.330] (-415.120) -- 0:00:41
313500 -- (-416.384) (-416.485) [-418.714] (-416.083) * (-415.564) [-416.394] (-417.035) (-416.508) -- 0:00:41
314000 -- (-416.099) (-415.670) [-417.021] (-417.678) * (-422.837) [-420.538] (-416.663) (-415.308) -- 0:00:41
314500 -- (-417.131) [-416.307] (-415.695) (-418.654) * (-415.492) (-420.716) [-417.522] (-418.634) -- 0:00:41
315000 -- (-417.030) (-417.250) (-414.819) [-416.219] * (-415.551) [-415.856] (-415.421) (-415.795) -- 0:00:41
Average standard deviation of split frequencies: 0.009214
315500 -- (-415.899) [-416.998] (-416.686) (-422.265) * (-415.512) (-416.933) [-417.588] (-417.169) -- 0:00:41
316000 -- [-416.544] (-417.813) (-418.822) (-422.969) * (-418.428) (-417.012) [-418.330] (-416.008) -- 0:00:41
316500 -- [-415.525] (-417.955) (-418.293) (-419.949) * (-416.947) [-416.392] (-417.172) (-415.915) -- 0:00:41
317000 -- (-414.599) [-415.586] (-417.574) (-415.747) * [-421.900] (-417.438) (-420.080) (-417.356) -- 0:00:40
317500 -- [-416.478] (-415.130) (-416.456) (-416.363) * [-415.726] (-417.233) (-416.986) (-418.231) -- 0:00:40
318000 -- [-419.261] (-416.370) (-414.852) (-418.320) * (-415.133) (-417.520) [-418.141] (-415.128) -- 0:00:40
318500 -- (-423.417) (-416.171) [-416.158] (-418.540) * (-415.904) (-415.726) (-421.730) [-417.595] -- 0:00:40
319000 -- (-416.912) (-416.257) [-417.862] (-424.009) * (-417.675) (-417.513) (-417.215) [-415.328] -- 0:00:40
319500 -- (-416.582) [-415.464] (-417.260) (-418.118) * (-418.102) [-415.559] (-416.924) (-416.441) -- 0:00:40
320000 -- (-414.715) (-416.659) (-416.789) [-416.812] * (-415.906) (-416.777) (-418.021) [-416.949] -- 0:00:40
Average standard deviation of split frequencies: 0.009858
320500 -- (-415.738) [-415.830] (-417.320) (-417.355) * (-417.458) [-417.931] (-418.571) (-416.039) -- 0:00:40
321000 -- (-420.347) (-417.072) [-414.679] (-421.649) * (-418.806) (-416.024) (-421.121) [-415.639] -- 0:00:40
321500 -- (-416.450) [-415.923] (-417.632) (-417.499) * (-419.451) [-414.819] (-416.380) (-417.042) -- 0:00:40
322000 -- (-416.619) (-418.603) [-417.363] (-421.769) * (-416.563) (-415.547) [-416.469] (-418.353) -- 0:00:40
322500 -- (-417.346) [-419.714] (-416.537) (-418.735) * (-415.967) (-416.521) (-416.335) [-414.611] -- 0:00:39
323000 -- (-415.214) (-415.309) [-417.989] (-416.002) * (-418.628) (-417.327) [-417.357] (-415.403) -- 0:00:39
323500 -- (-416.341) (-416.982) (-417.113) [-416.116] * [-416.575] (-416.775) (-421.002) (-417.203) -- 0:00:39
324000 -- (-416.602) (-415.771) [-416.122] (-416.109) * (-415.840) (-415.022) (-416.994) [-415.970] -- 0:00:39
324500 -- (-415.460) (-419.961) [-420.145] (-415.920) * (-416.235) (-415.809) (-417.687) [-417.093] -- 0:00:39
325000 -- (-417.685) (-416.990) (-416.360) [-418.554] * [-415.493] (-417.805) (-419.405) (-417.143) -- 0:00:39
Average standard deviation of split frequencies: 0.009782
325500 -- (-418.459) (-414.965) (-417.405) [-419.296] * (-415.546) (-419.856) (-417.597) [-419.963] -- 0:00:41
326000 -- (-421.292) [-416.655] (-421.392) (-418.181) * [-415.237] (-418.266) (-416.729) (-417.846) -- 0:00:41
326500 -- [-415.715] (-414.901) (-416.784) (-416.187) * (-422.194) (-416.218) [-416.476] (-420.011) -- 0:00:41
327000 -- (-418.268) (-416.528) (-417.023) [-417.476] * (-417.789) (-415.963) [-417.148] (-415.837) -- 0:00:41
327500 -- (-418.052) [-415.000] (-417.125) (-416.527) * (-419.445) (-415.252) [-415.842] (-415.312) -- 0:00:41
328000 -- (-418.877) (-414.701) [-421.506] (-418.071) * (-418.694) (-417.009) (-416.204) [-416.296] -- 0:00:40
328500 -- (-422.243) (-416.803) (-417.832) [-416.516] * (-417.169) (-420.288) [-415.813] (-417.616) -- 0:00:40
329000 -- (-416.085) (-416.311) [-416.413] (-416.302) * [-415.056] (-417.737) (-417.509) (-415.776) -- 0:00:40
329500 -- (-416.772) (-417.248) (-417.375) [-423.739] * (-418.405) (-420.536) (-417.453) [-416.251] -- 0:00:40
330000 -- (-419.562) [-419.400] (-416.938) (-416.891) * (-419.756) (-416.386) (-423.304) [-415.273] -- 0:00:40
Average standard deviation of split frequencies: 0.010482
330500 -- (-416.391) (-417.202) (-415.133) [-422.728] * (-419.241) (-416.332) (-425.876) [-416.063] -- 0:00:40
331000 -- (-416.401) (-416.379) (-420.493) [-421.514] * (-416.259) (-418.360) (-425.760) [-416.456] -- 0:00:40
331500 -- (-417.997) (-417.658) (-417.574) [-416.244] * (-416.381) (-416.025) [-415.460] (-415.360) -- 0:00:40
332000 -- (-416.601) (-415.845) [-418.539] (-420.098) * (-418.083) [-416.289] (-415.182) (-416.250) -- 0:00:40
332500 -- [-415.966] (-417.222) (-415.810) (-415.514) * (-415.954) (-420.130) [-416.221] (-418.746) -- 0:00:40
333000 -- (-417.101) [-418.350] (-419.331) (-415.082) * (-415.320) (-416.760) (-415.979) [-417.863] -- 0:00:40
333500 -- [-416.619] (-416.338) (-416.798) (-414.759) * (-415.304) (-415.037) [-416.708] (-419.116) -- 0:00:39
334000 -- (-415.119) [-416.156] (-416.608) (-415.982) * (-416.145) (-420.520) (-418.065) [-416.865] -- 0:00:39
334500 -- [-414.767] (-416.444) (-415.422) (-420.051) * (-415.676) (-416.882) [-416.786] (-417.300) -- 0:00:39
335000 -- (-415.814) (-418.869) (-414.896) [-415.944] * (-415.390) (-417.972) (-417.757) [-416.700] -- 0:00:39
Average standard deviation of split frequencies: 0.010069
335500 -- (-416.068) (-416.613) [-415.394] (-415.267) * [-419.710] (-417.011) (-416.071) (-419.114) -- 0:00:39
336000 -- (-417.682) (-415.555) (-417.321) [-414.807] * (-417.897) (-414.682) [-417.536] (-418.199) -- 0:00:39
336500 -- (-422.732) (-415.408) [-418.504] (-415.330) * [-417.182] (-419.893) (-415.688) (-415.973) -- 0:00:39
337000 -- (-416.375) [-415.745] (-418.172) (-414.920) * [-415.652] (-415.548) (-416.094) (-417.782) -- 0:00:39
337500 -- [-416.105] (-417.140) (-416.276) (-415.558) * (-416.815) [-416.593] (-417.512) (-418.074) -- 0:00:39
338000 -- (-414.788) [-417.656] (-416.074) (-415.836) * (-416.418) (-417.201) [-421.135] (-416.202) -- 0:00:39
338500 -- (-420.174) (-418.483) [-417.147] (-416.317) * [-415.146] (-416.324) (-419.477) (-416.257) -- 0:00:39
339000 -- (-416.109) (-417.122) [-416.511] (-417.312) * (-417.021) [-420.582] (-416.638) (-415.061) -- 0:00:38
339500 -- (-416.030) (-414.997) [-418.067] (-419.174) * (-416.796) (-416.913) [-415.236] (-415.075) -- 0:00:38
340000 -- [-415.714] (-418.547) (-418.815) (-420.542) * (-416.065) [-414.591] (-415.714) (-416.940) -- 0:00:38
Average standard deviation of split frequencies: 0.009686
340500 -- (-415.148) (-419.278) [-415.750] (-415.676) * (-415.834) [-418.572] (-415.310) (-415.989) -- 0:00:40
341000 -- [-416.814] (-416.569) (-419.455) (-418.368) * (-414.649) [-419.486] (-415.087) (-417.420) -- 0:00:40
341500 -- [-416.786] (-415.226) (-417.664) (-421.644) * (-414.744) (-416.826) [-418.766] (-417.504) -- 0:00:40
342000 -- [-419.652] (-418.908) (-415.909) (-417.233) * (-418.357) (-416.497) [-414.805] (-417.216) -- 0:00:40
342500 -- (-417.792) [-420.468] (-417.741) (-416.309) * (-415.786) (-416.949) [-416.620] (-418.640) -- 0:00:40
343000 -- [-415.360] (-417.718) (-415.626) (-418.735) * (-416.165) (-414.870) (-418.648) [-417.803] -- 0:00:40
343500 -- (-416.087) [-418.368] (-416.866) (-418.621) * [-415.977] (-415.192) (-417.713) (-418.899) -- 0:00:40
344000 -- (-416.394) (-415.393) (-417.352) [-417.903] * (-416.754) (-414.770) (-416.221) [-419.331] -- 0:00:40
344500 -- [-416.150] (-416.283) (-418.357) (-423.195) * (-416.021) [-415.296] (-416.241) (-416.916) -- 0:00:39
345000 -- [-417.902] (-416.618) (-421.316) (-418.079) * [-415.274] (-415.392) (-415.946) (-415.540) -- 0:00:39
Average standard deviation of split frequencies: 0.010499
345500 -- (-414.797) (-417.624) [-414.989] (-415.892) * [-416.152] (-414.903) (-416.148) (-418.548) -- 0:00:39
346000 -- (-417.193) (-417.270) (-418.387) [-415.365] * (-417.356) (-419.526) [-417.288] (-416.202) -- 0:00:39
346500 -- (-416.341) (-417.551) [-417.593] (-419.583) * (-417.365) (-419.147) (-416.488) [-414.644] -- 0:00:39
347000 -- [-416.152] (-418.109) (-417.846) (-415.933) * (-419.786) [-415.765] (-416.176) (-415.267) -- 0:00:39
347500 -- [-416.371] (-415.960) (-417.584) (-416.691) * (-417.790) [-417.201] (-419.188) (-416.110) -- 0:00:39
348000 -- (-416.219) (-419.004) [-422.333] (-416.822) * [-415.660] (-420.046) (-419.073) (-416.706) -- 0:00:39
348500 -- (-415.677) (-415.934) [-416.757] (-414.733) * [-416.948] (-419.668) (-416.080) (-417.593) -- 0:00:39
349000 -- (-416.338) (-417.962) [-420.708] (-419.685) * (-422.623) [-415.909] (-421.369) (-417.347) -- 0:00:39
349500 -- (-414.905) [-416.677] (-421.823) (-417.828) * [-416.286] (-416.106) (-421.653) (-415.078) -- 0:00:39
350000 -- (-418.044) (-422.065) (-418.815) [-415.062] * (-418.082) (-422.991) (-418.313) [-414.947] -- 0:00:39
Average standard deviation of split frequencies: 0.009252
350500 -- [-419.232] (-416.792) (-419.614) (-414.841) * [-415.569] (-419.568) (-420.144) (-416.816) -- 0:00:38
351000 -- (-418.633) (-417.022) [-417.330] (-415.314) * (-416.264) (-416.766) (-417.040) [-416.282] -- 0:00:38
351500 -- [-416.204] (-416.481) (-416.990) (-415.879) * [-415.593] (-415.684) (-418.644) (-415.837) -- 0:00:38
352000 -- (-415.723) (-415.536) [-416.074] (-415.944) * (-416.823) (-416.196) [-419.223] (-415.497) -- 0:00:38
352500 -- (-418.842) [-415.944] (-419.273) (-416.491) * (-421.699) (-422.565) [-416.792] (-415.372) -- 0:00:38
353000 -- [-416.160] (-420.249) (-418.681) (-415.062) * (-429.115) (-417.557) [-418.885] (-416.957) -- 0:00:38
353500 -- (-418.720) (-417.151) (-417.630) [-415.062] * (-417.257) [-416.399] (-418.464) (-416.666) -- 0:00:38
354000 -- (-418.170) [-418.820] (-416.156) (-414.996) * [-418.225] (-414.833) (-416.309) (-419.935) -- 0:00:38
354500 -- (-419.158) (-417.150) [-420.483] (-417.412) * (-416.414) (-416.874) (-417.317) [-418.008] -- 0:00:38
355000 -- (-417.699) [-416.088] (-419.995) (-415.708) * (-418.817) (-417.183) (-418.010) [-416.754] -- 0:00:38
Average standard deviation of split frequencies: 0.009191
355500 -- (-415.582) (-419.069) (-420.374) [-417.287] * (-419.655) [-419.834] (-417.110) (-417.115) -- 0:00:38
356000 -- (-418.226) (-417.723) (-419.035) [-417.440] * (-417.300) (-417.268) [-417.034] (-419.513) -- 0:00:37
356500 -- (-418.310) (-417.251) [-415.105] (-416.739) * (-422.471) [-418.927] (-417.056) (-419.417) -- 0:00:37
357000 -- (-415.777) (-418.284) (-414.890) [-418.118] * (-416.053) (-418.345) (-417.251) [-415.407] -- 0:00:37
357500 -- [-415.713] (-417.883) (-417.162) (-417.816) * (-415.843) [-418.107] (-417.266) (-419.066) -- 0:00:39
358000 -- (-415.576) (-416.034) (-415.948) [-419.308] * (-415.003) (-416.950) [-415.348] (-420.439) -- 0:00:39
358500 -- (-424.023) (-416.363) (-415.953) [-416.992] * (-419.327) (-416.539) [-414.590] (-418.926) -- 0:00:39
359000 -- (-416.274) [-416.240] (-417.381) (-418.892) * [-418.110] (-420.117) (-419.011) (-414.814) -- 0:00:39
359500 -- [-416.236] (-416.069) (-415.068) (-415.762) * (-418.088) [-420.520] (-419.794) (-415.912) -- 0:00:39
360000 -- [-415.459] (-415.879) (-415.559) (-417.766) * (-416.070) [-416.486] (-416.343) (-417.262) -- 0:00:39
Average standard deviation of split frequencies: 0.009457
360500 -- [-416.567] (-421.045) (-415.657) (-423.389) * (-414.911) [-416.142] (-417.052) (-416.959) -- 0:00:39
361000 -- (-422.178) (-417.844) [-417.205] (-427.659) * (-419.303) (-415.283) [-415.495] (-419.038) -- 0:00:38
361500 -- (-422.960) (-418.194) [-417.013] (-416.572) * (-421.497) (-416.574) (-418.700) [-416.296] -- 0:00:38
362000 -- (-419.060) (-415.678) (-417.945) [-419.348] * [-417.069] (-418.150) (-414.983) (-417.614) -- 0:00:38
362500 -- (-415.687) (-417.452) (-418.960) [-416.783] * (-415.556) [-415.303] (-415.427) (-416.389) -- 0:00:38
363000 -- (-415.303) (-416.280) (-418.907) [-417.534] * (-417.509) (-414.954) (-416.618) [-419.635] -- 0:00:38
363500 -- (-421.644) [-418.494] (-418.563) (-416.301) * (-423.352) (-416.640) (-415.851) [-414.446] -- 0:00:38
364000 -- (-419.370) (-417.021) [-415.643] (-416.052) * (-419.579) (-417.823) [-416.129] (-417.635) -- 0:00:38
364500 -- (-420.151) (-419.258) [-415.113] (-416.691) * (-417.148) (-419.677) [-415.358] (-418.607) -- 0:00:38
365000 -- (-414.781) [-415.236] (-418.828) (-419.057) * [-418.654] (-421.850) (-426.679) (-416.630) -- 0:00:38
Average standard deviation of split frequencies: 0.009622
365500 -- (-417.502) (-416.671) [-417.083] (-416.577) * (-415.333) [-417.038] (-417.563) (-416.315) -- 0:00:38
366000 -- (-417.049) [-417.391] (-418.417) (-417.172) * (-417.014) (-418.473) (-416.269) [-415.994] -- 0:00:38
366500 -- (-415.422) [-415.644] (-415.031) (-415.176) * [-414.490] (-422.104) (-417.591) (-416.935) -- 0:00:38
367000 -- (-418.912) (-417.917) (-415.678) [-416.157] * (-415.983) (-415.327) (-416.845) [-417.911] -- 0:00:37
367500 -- [-418.017] (-418.387) (-416.284) (-416.982) * (-421.131) (-419.096) [-415.490] (-415.453) -- 0:00:37
368000 -- (-419.063) (-420.985) (-415.063) [-420.433] * (-417.130) (-415.247) [-417.965] (-418.734) -- 0:00:37
368500 -- (-419.370) (-421.951) (-417.053) [-416.802] * (-418.555) (-415.963) (-416.770) [-414.953] -- 0:00:37
369000 -- [-417.768] (-418.430) (-416.780) (-418.105) * (-418.105) (-415.849) [-417.621] (-417.833) -- 0:00:37
369500 -- (-416.193) [-415.728] (-416.575) (-416.548) * (-416.033) (-416.410) [-417.526] (-418.058) -- 0:00:37
370000 -- (-416.784) [-419.680] (-417.247) (-418.289) * (-415.586) (-415.716) [-415.886] (-417.306) -- 0:00:37
Average standard deviation of split frequencies: 0.009202
370500 -- (-416.838) [-416.130] (-417.803) (-416.955) * (-415.541) (-419.073) (-415.703) [-418.759] -- 0:00:37
371000 -- [-420.116] (-416.240) (-419.714) (-416.936) * (-416.713) (-415.653) (-419.337) [-417.233] -- 0:00:37
371500 -- (-415.695) [-417.044] (-418.229) (-415.965) * (-416.338) [-415.669] (-420.019) (-417.595) -- 0:00:37
372000 -- [-415.139] (-415.372) (-416.813) (-416.385) * [-416.496] (-418.755) (-416.304) (-416.972) -- 0:00:37
372500 -- (-418.279) (-415.895) [-419.297] (-416.826) * (-419.060) [-415.404] (-415.816) (-416.881) -- 0:00:37
373000 -- [-418.697] (-418.326) (-417.099) (-415.114) * (-416.746) [-417.203] (-414.925) (-417.181) -- 0:00:36
373500 -- (-417.959) (-415.447) [-416.451] (-416.502) * (-414.844) [-415.394] (-417.374) (-416.661) -- 0:00:36
374000 -- (-416.961) (-420.005) [-415.230] (-416.003) * (-415.475) (-416.035) [-416.273] (-417.854) -- 0:00:36
374500 -- [-417.409] (-415.745) (-416.115) (-416.447) * (-418.593) (-415.462) (-417.438) [-417.466] -- 0:00:38
375000 -- (-420.700) (-417.671) (-415.373) [-416.204] * (-419.281) [-417.337] (-415.477) (-416.996) -- 0:00:38
Average standard deviation of split frequencies: 0.009587
375500 -- (-419.654) (-419.738) [-416.950] (-420.632) * (-416.895) (-416.654) [-414.839] (-418.417) -- 0:00:38
376000 -- (-417.816) (-416.275) (-417.578) [-418.944] * (-417.287) [-416.162] (-416.670) (-419.985) -- 0:00:38
376500 -- (-418.729) (-417.498) [-416.362] (-415.143) * (-414.909) (-416.150) (-421.354) [-420.101] -- 0:00:38
377000 -- (-420.236) [-416.926] (-415.928) (-414.785) * (-420.609) [-415.852] (-422.954) (-416.356) -- 0:00:38
377500 -- (-418.773) [-420.501] (-417.817) (-418.704) * (-418.983) [-418.565] (-419.040) (-415.653) -- 0:00:37
378000 -- (-416.812) (-417.520) (-418.930) [-422.411] * (-415.496) (-416.186) [-418.055] (-416.301) -- 0:00:37
378500 -- (-418.323) (-420.950) [-417.565] (-416.024) * (-415.192) [-417.305] (-414.443) (-416.547) -- 0:00:37
379000 -- (-418.938) [-418.242] (-416.892) (-418.059) * [-416.218] (-417.413) (-420.041) (-416.674) -- 0:00:37
379500 -- (-416.255) (-415.950) [-415.821] (-416.689) * (-417.845) [-416.186] (-417.044) (-418.884) -- 0:00:37
380000 -- (-417.844) (-417.680) (-417.818) [-415.455] * (-414.924) [-416.522] (-415.888) (-418.752) -- 0:00:37
Average standard deviation of split frequencies: 0.010708
380500 -- (-415.833) (-415.369) [-415.825] (-416.666) * (-418.642) (-416.486) (-421.748) [-417.498] -- 0:00:37
381000 -- (-417.606) (-415.111) [-415.796] (-416.310) * (-415.352) [-418.233] (-416.298) (-415.439) -- 0:00:37
381500 -- (-415.364) [-414.576] (-415.064) (-416.118) * (-414.602) (-416.715) [-415.657] (-415.868) -- 0:00:37
382000 -- (-415.326) [-416.810] (-414.598) (-417.496) * (-416.782) [-415.333] (-416.151) (-419.130) -- 0:00:37
382500 -- [-418.519] (-417.550) (-416.987) (-418.329) * (-417.159) (-416.629) [-415.939] (-415.443) -- 0:00:37
383000 -- (-415.434) [-418.721] (-417.786) (-419.660) * (-419.498) (-420.068) [-415.088] (-414.967) -- 0:00:37
383500 -- (-421.020) (-415.774) [-417.440] (-415.811) * [-417.230] (-420.122) (-417.067) (-417.908) -- 0:00:36
384000 -- (-417.623) [-418.276] (-418.422) (-415.257) * (-416.566) [-417.630] (-416.610) (-417.123) -- 0:00:36
384500 -- (-416.168) [-416.264] (-417.665) (-416.290) * [-416.537] (-415.490) (-420.580) (-416.717) -- 0:00:36
385000 -- (-416.042) (-416.255) [-416.550] (-417.445) * (-422.073) [-416.763] (-416.973) (-420.802) -- 0:00:36
Average standard deviation of split frequencies: 0.010856
385500 -- (-416.125) (-418.172) (-415.250) [-415.205] * [-420.844] (-416.681) (-417.512) (-418.593) -- 0:00:36
386000 -- [-420.896] (-418.302) (-415.712) (-418.540) * (-417.819) [-418.686] (-415.486) (-416.230) -- 0:00:36
386500 -- (-421.040) (-416.637) (-417.780) [-419.391] * (-418.541) (-416.056) [-417.518] (-415.318) -- 0:00:36
387000 -- [-418.659] (-418.683) (-415.835) (-420.051) * [-415.861] (-415.743) (-415.597) (-414.897) -- 0:00:36
387500 -- (-421.620) (-418.579) (-419.714) [-417.028] * [-415.963] (-419.592) (-414.986) (-417.174) -- 0:00:36
388000 -- [-417.330] (-415.923) (-415.621) (-418.250) * [-415.542] (-420.168) (-415.229) (-418.237) -- 0:00:36
388500 -- (-417.717) (-416.712) (-414.987) [-417.892] * [-416.415] (-415.648) (-415.849) (-424.594) -- 0:00:36
389000 -- (-414.613) [-417.946] (-418.607) (-419.754) * [-416.942] (-415.439) (-418.328) (-416.091) -- 0:00:36
389500 -- (-416.391) (-417.670) (-423.043) [-418.253] * (-416.038) [-414.717] (-418.557) (-417.874) -- 0:00:36
390000 -- (-417.789) (-420.221) [-417.911] (-416.178) * (-414.814) [-415.813] (-418.049) (-416.239) -- 0:00:35
Average standard deviation of split frequencies: 0.011495
390500 -- (-418.668) [-418.970] (-415.671) (-417.870) * [-415.947] (-416.349) (-415.721) (-417.045) -- 0:00:35
391000 -- (-420.175) [-415.580] (-419.592) (-415.137) * (-416.132) (-414.900) [-416.390] (-416.062) -- 0:00:35
391500 -- [-417.167] (-416.385) (-415.547) (-417.421) * [-414.770] (-418.617) (-418.112) (-416.311) -- 0:00:37
392000 -- (-416.039) [-421.062] (-416.316) (-415.051) * [-417.475] (-419.695) (-417.129) (-415.621) -- 0:00:37
392500 -- (-416.435) (-418.647) (-417.220) [-419.666] * [-415.070] (-420.537) (-417.218) (-418.988) -- 0:00:37
393000 -- (-417.636) (-416.223) [-417.327] (-416.722) * [-418.464] (-415.887) (-416.882) (-416.334) -- 0:00:37
393500 -- (-421.524) (-416.898) (-417.625) [-417.391] * (-416.515) (-414.887) (-414.997) [-415.937] -- 0:00:36
394000 -- (-418.641) (-418.499) (-420.725) [-420.285] * [-417.134] (-416.610) (-416.223) (-417.672) -- 0:00:36
394500 -- (-415.999) (-415.860) (-415.827) [-421.842] * (-415.861) (-416.123) (-416.533) [-418.133] -- 0:00:36
395000 -- (-415.937) [-415.013] (-416.118) (-414.909) * (-417.557) (-417.635) (-419.216) [-414.751] -- 0:00:36
Average standard deviation of split frequencies: 0.010776
395500 -- (-416.269) (-415.633) [-415.827] (-419.736) * (-415.750) (-418.358) [-419.439] (-415.401) -- 0:00:36
396000 -- [-416.883] (-415.347) (-415.067) (-416.777) * (-415.851) [-415.797] (-415.481) (-420.054) -- 0:00:36
396500 -- (-420.842) (-416.276) [-414.923] (-418.780) * (-415.946) [-415.544] (-414.476) (-422.417) -- 0:00:36
397000 -- (-416.048) (-417.337) [-416.166] (-419.148) * (-417.360) (-417.645) (-416.712) [-416.399] -- 0:00:36
397500 -- [-417.999] (-417.963) (-417.171) (-415.002) * (-417.594) (-416.036) (-417.217) [-416.096] -- 0:00:36
398000 -- (-418.275) (-418.872) [-421.112] (-415.085) * (-420.119) (-417.403) (-416.232) [-416.281] -- 0:00:36
398500 -- (-416.616) (-417.211) (-419.438) [-416.892] * [-417.062] (-415.311) (-415.911) (-420.329) -- 0:00:36
399000 -- (-417.683) (-417.709) [-416.802] (-415.442) * (-423.747) [-418.043] (-415.931) (-414.595) -- 0:00:36
399500 -- (-415.550) (-421.807) [-417.481] (-417.576) * (-416.603) [-418.328] (-420.535) (-416.774) -- 0:00:36
400000 -- (-416.322) (-417.941) [-416.652] (-418.053) * (-418.572) (-417.732) [-418.299] (-415.118) -- 0:00:36
Average standard deviation of split frequencies: 0.011635
400500 -- [-416.458] (-416.480) (-417.410) (-418.022) * (-414.975) (-416.210) [-419.303] (-416.616) -- 0:00:35
401000 -- (-415.736) (-421.940) [-415.473] (-414.485) * [-415.591] (-418.429) (-419.071) (-417.805) -- 0:00:35
401500 -- (-415.801) [-415.974] (-417.012) (-414.937) * (-416.427) [-419.781] (-414.710) (-415.073) -- 0:00:35
402000 -- (-415.324) (-419.033) (-416.354) [-416.692] * [-415.978] (-415.915) (-417.262) (-418.771) -- 0:00:35
402500 -- (-418.130) (-415.749) [-417.213] (-417.953) * (-415.889) [-415.882] (-416.846) (-415.801) -- 0:00:35
403000 -- [-416.315] (-421.912) (-417.447) (-419.802) * (-414.839) (-416.743) [-418.632] (-417.867) -- 0:00:35
403500 -- [-416.258] (-416.907) (-416.638) (-419.933) * (-418.312) (-416.942) [-415.512] (-415.960) -- 0:00:35
404000 -- (-415.291) (-415.666) (-418.499) [-420.700] * (-415.624) [-417.402] (-417.053) (-415.567) -- 0:00:35
404500 -- [-416.116] (-419.066) (-418.053) (-418.128) * (-415.868) (-416.852) (-416.367) [-420.520] -- 0:00:35
405000 -- (-416.046) (-415.255) [-419.387] (-419.425) * (-416.584) (-417.402) (-415.359) [-416.705] -- 0:00:35
Average standard deviation of split frequencies: 0.011611
405500 -- (-416.090) (-415.510) (-417.445) [-416.266] * (-418.402) [-416.392] (-418.674) (-415.926) -- 0:00:35
406000 -- (-416.637) [-416.342] (-416.229) (-416.024) * [-416.120] (-418.201) (-417.385) (-415.960) -- 0:00:35
406500 -- (-418.110) [-417.373] (-417.873) (-417.046) * (-415.362) (-415.913) (-417.845) [-416.327] -- 0:00:35
407000 -- (-420.387) [-416.252] (-416.791) (-414.815) * (-416.490) (-415.637) (-416.489) [-415.771] -- 0:00:34
407500 -- [-414.976] (-415.976) (-418.497) (-417.193) * (-415.412) (-418.404) [-416.671] (-419.765) -- 0:00:34
408000 -- [-416.255] (-425.196) (-419.189) (-420.277) * (-416.877) (-416.340) [-416.051] (-422.886) -- 0:00:36
408500 -- [-419.458] (-417.251) (-418.001) (-419.609) * [-421.422] (-418.694) (-417.775) (-419.099) -- 0:00:36
409000 -- [-418.297] (-419.154) (-415.246) (-416.317) * (-422.648) [-417.276] (-420.858) (-420.947) -- 0:00:36
409500 -- [-415.209] (-423.015) (-415.133) (-418.684) * (-416.811) (-417.746) [-418.190] (-416.281) -- 0:00:36
410000 -- (-416.052) (-416.387) (-417.955) [-417.605] * (-417.922) (-417.329) [-417.706] (-417.734) -- 0:00:35
Average standard deviation of split frequencies: 0.010522
410500 -- (-417.824) (-417.673) [-416.645] (-417.625) * [-416.097] (-417.119) (-417.755) (-415.950) -- 0:00:35
411000 -- [-419.605] (-417.855) (-415.913) (-422.826) * (-420.177) [-416.185] (-414.996) (-416.525) -- 0:00:35
411500 -- [-417.325] (-416.469) (-415.901) (-416.617) * (-418.043) [-417.607] (-416.587) (-417.855) -- 0:00:35
412000 -- (-416.245) [-416.606] (-417.885) (-416.323) * [-417.318] (-417.924) (-414.800) (-416.591) -- 0:00:35
412500 -- (-415.945) (-415.568) (-416.039) [-416.749] * (-416.469) (-415.340) (-414.663) [-415.113] -- 0:00:35
413000 -- (-415.403) (-416.148) (-415.154) [-415.862] * (-417.457) (-416.913) [-414.614] (-416.312) -- 0:00:35
413500 -- (-416.092) [-417.330] (-416.546) (-415.290) * (-418.839) (-415.884) (-415.863) [-414.595] -- 0:00:35
414000 -- (-415.898) (-416.178) (-416.822) [-415.556] * (-416.518) [-419.106] (-415.465) (-417.002) -- 0:00:35
414500 -- [-416.782] (-417.143) (-418.720) (-416.098) * [-417.762] (-416.590) (-417.822) (-417.144) -- 0:00:35
415000 -- (-416.954) (-415.714) (-423.296) [-417.919] * (-417.322) (-417.202) (-418.387) [-418.030] -- 0:00:35
Average standard deviation of split frequencies: 0.010828
415500 -- [-417.533] (-415.720) (-419.798) (-417.974) * [-417.667] (-415.711) (-419.399) (-416.811) -- 0:00:35
416000 -- (-415.421) (-427.767) (-418.491) [-416.725] * [-415.618] (-416.954) (-419.300) (-416.985) -- 0:00:35
416500 -- [-417.154] (-418.585) (-414.704) (-418.988) * [-418.099] (-417.321) (-419.765) (-418.170) -- 0:00:35
417000 -- (-416.092) [-415.873] (-416.158) (-417.907) * (-414.629) (-417.818) (-420.229) [-417.388] -- 0:00:34
417500 -- (-415.344) (-418.335) (-421.244) [-415.867] * [-415.486] (-421.436) (-415.426) (-420.482) -- 0:00:34
418000 -- (-416.905) (-415.362) (-418.744) [-415.353] * (-415.289) (-417.368) [-416.354] (-415.508) -- 0:00:34
418500 -- (-416.198) (-416.266) (-415.836) [-415.026] * (-414.981) (-414.684) [-415.887] (-415.821) -- 0:00:34
419000 -- (-422.113) (-416.545) [-415.712] (-416.367) * (-417.233) (-414.769) [-415.763] (-416.265) -- 0:00:34
419500 -- (-415.568) (-416.098) [-416.511] (-416.030) * (-415.286) (-419.687) (-416.015) [-416.133] -- 0:00:34
420000 -- (-415.004) [-415.707] (-416.983) (-417.234) * [-416.370] (-417.366) (-416.848) (-416.466) -- 0:00:34
Average standard deviation of split frequencies: 0.010708
420500 -- (-417.272) (-418.821) (-415.150) [-416.098] * (-416.914) (-417.899) [-416.403] (-422.093) -- 0:00:34
421000 -- (-417.064) (-416.334) (-417.755) [-415.946] * (-422.683) [-420.606] (-416.380) (-420.401) -- 0:00:34
421500 -- (-416.933) (-418.268) (-417.126) [-416.591] * (-420.278) (-415.399) [-417.027] (-417.583) -- 0:00:34
422000 -- (-417.552) (-421.069) [-415.651] (-416.370) * (-416.970) (-418.088) [-415.086] (-418.633) -- 0:00:34
422500 -- (-416.344) (-415.205) (-415.556) [-416.996] * [-419.851] (-416.126) (-416.766) (-416.250) -- 0:00:34
423000 -- [-415.718] (-414.895) (-417.601) (-415.846) * (-417.544) (-417.390) [-415.229] (-415.026) -- 0:00:34
423500 -- (-415.768) (-417.839) [-418.017] (-416.195) * [-417.875] (-414.639) (-414.790) (-419.801) -- 0:00:35
424000 -- (-415.279) [-415.440] (-416.014) (-414.826) * (-416.381) (-415.414) (-416.414) [-415.690] -- 0:00:35
424500 -- [-418.197] (-416.986) (-415.539) (-416.937) * (-416.473) (-415.062) [-418.179] (-419.016) -- 0:00:35
425000 -- (-419.886) (-422.990) (-417.543) [-416.535] * [-415.887] (-418.150) (-417.366) (-422.075) -- 0:00:35
Average standard deviation of split frequencies: 0.011299
425500 -- (-423.138) [-418.312] (-417.596) (-417.741) * (-416.317) (-416.650) (-415.122) [-419.456] -- 0:00:35
426000 -- [-416.865] (-418.048) (-417.752) (-416.504) * (-418.007) [-415.176] (-414.849) (-415.807) -- 0:00:35
426500 -- [-417.981] (-418.886) (-418.976) (-414.589) * (-417.780) (-417.149) [-415.009] (-416.862) -- 0:00:34
427000 -- (-414.847) [-416.084] (-418.286) (-416.824) * (-416.890) (-416.561) [-415.784] (-417.520) -- 0:00:34
427500 -- (-416.305) (-417.699) [-415.611] (-415.592) * (-417.201) (-416.471) [-416.921] (-414.901) -- 0:00:34
428000 -- [-415.231] (-419.294) (-418.658) (-416.738) * (-416.828) (-420.863) (-416.187) [-416.761] -- 0:00:34
428500 -- (-417.587) [-417.683] (-414.572) (-416.960) * (-415.107) (-420.356) (-417.098) [-417.332] -- 0:00:34
429000 -- (-415.711) (-416.679) [-417.242] (-416.482) * (-416.967) (-420.094) (-415.814) [-418.110] -- 0:00:34
429500 -- [-415.878] (-418.797) (-419.015) (-417.375) * (-416.487) (-420.409) [-415.135] (-418.564) -- 0:00:34
430000 -- (-418.615) (-415.906) (-418.079) [-414.953] * (-416.835) (-418.579) (-417.216) [-418.314] -- 0:00:34
Average standard deviation of split frequencies: 0.011189
430500 -- [-414.891] (-416.379) (-415.079) (-417.764) * (-415.962) (-421.409) (-416.660) [-417.089] -- 0:00:34
431000 -- (-422.178) (-415.733) (-416.274) [-415.179] * (-419.501) (-420.196) (-416.279) [-415.839] -- 0:00:34
431500 -- [-417.163] (-416.173) (-415.046) (-415.344) * [-416.736] (-419.013) (-417.100) (-414.830) -- 0:00:34
432000 -- (-416.217) [-414.758] (-421.014) (-415.026) * (-416.789) [-421.241] (-416.704) (-418.446) -- 0:00:34
432500 -- (-419.258) (-414.396) [-417.375] (-414.750) * [-416.759] (-417.065) (-418.978) (-418.903) -- 0:00:34
433000 -- (-418.521) (-414.833) (-418.439) [-417.713] * (-415.338) [-421.306] (-417.533) (-416.143) -- 0:00:34
433500 -- (-416.291) [-414.887] (-415.590) (-414.786) * (-415.661) [-417.826] (-420.189) (-418.880) -- 0:00:33
434000 -- (-416.031) (-414.766) (-417.565) [-416.897] * (-414.864) [-416.956] (-417.941) (-414.986) -- 0:00:33
434500 -- (-416.441) (-419.384) (-419.496) [-417.193] * [-415.717] (-415.815) (-419.742) (-419.736) -- 0:00:33
435000 -- [-419.436] (-415.886) (-415.786) (-417.260) * (-415.000) (-415.627) (-416.048) [-417.319] -- 0:00:33
Average standard deviation of split frequencies: 0.010452
435500 -- (-417.512) (-416.002) (-415.041) [-415.221] * [-416.477] (-424.467) (-416.001) (-418.182) -- 0:00:33
436000 -- (-418.419) [-415.853] (-418.830) (-415.569) * (-416.126) (-415.853) (-419.085) [-416.932] -- 0:00:33
436500 -- [-415.840] (-416.069) (-418.539) (-415.088) * (-422.096) (-416.835) (-419.662) [-415.417] -- 0:00:33
437000 -- (-419.828) (-415.586) [-423.037] (-414.950) * [-424.454] (-417.712) (-420.812) (-417.959) -- 0:00:33
437500 -- (-415.876) [-418.958] (-415.229) (-416.598) * [-416.586] (-419.134) (-415.561) (-416.161) -- 0:00:33
438000 -- [-416.044] (-416.231) (-415.369) (-417.487) * (-416.125) (-415.394) (-417.164) [-416.050] -- 0:00:33
438500 -- (-414.925) [-415.743] (-415.736) (-418.303) * [-416.035] (-415.796) (-418.637) (-417.512) -- 0:00:34
439000 -- [-417.729] (-415.673) (-416.997) (-416.736) * (-419.642) [-418.735] (-415.669) (-418.017) -- 0:00:34
439500 -- (-417.407) [-416.573] (-416.602) (-418.567) * (-417.776) (-419.401) (-415.553) [-420.358] -- 0:00:34
440000 -- (-416.945) [-417.149] (-415.945) (-419.072) * (-421.453) (-416.370) [-415.287] (-416.759) -- 0:00:34
Average standard deviation of split frequencies: 0.011138
440500 -- (-416.280) (-414.802) (-418.138) [-416.194] * (-416.725) (-415.085) [-417.882] (-417.609) -- 0:00:34
441000 -- [-415.567] (-415.324) (-416.319) (-417.060) * (-416.002) (-415.566) [-417.536] (-417.585) -- 0:00:34
441500 -- (-414.626) [-415.070] (-418.676) (-415.864) * [-418.467] (-418.838) (-418.029) (-418.214) -- 0:00:34
442000 -- (-415.379) (-416.799) (-416.497) [-415.476] * [-416.008] (-419.926) (-416.649) (-416.117) -- 0:00:34
442500 -- (-420.912) (-416.031) (-415.977) [-417.486] * (-419.156) [-416.086] (-415.690) (-418.991) -- 0:00:34
443000 -- (-418.448) [-416.727] (-417.679) (-416.296) * [-417.137] (-415.540) (-415.189) (-415.792) -- 0:00:33
443500 -- (-415.639) (-417.355) [-420.020] (-415.471) * (-415.188) (-418.043) (-416.134) [-416.628] -- 0:00:33
444000 -- (-416.123) [-415.771] (-418.130) (-414.839) * [-414.514] (-419.530) (-415.602) (-416.097) -- 0:00:33
444500 -- (-417.762) (-416.089) (-416.831) [-416.124] * [-416.411] (-414.559) (-414.647) (-415.928) -- 0:00:33
445000 -- (-418.701) [-416.849] (-415.228) (-420.142) * (-418.839) (-416.694) (-414.420) [-418.697] -- 0:00:33
Average standard deviation of split frequencies: 0.010687
445500 -- (-417.430) [-415.816] (-417.559) (-416.622) * (-416.265) (-420.635) (-415.123) [-419.056] -- 0:00:33
446000 -- [-416.644] (-417.464) (-419.490) (-417.798) * [-414.895] (-417.970) (-416.017) (-418.544) -- 0:00:33
446500 -- (-416.531) (-417.205) [-418.857] (-416.036) * (-417.325) [-416.896] (-416.271) (-417.958) -- 0:00:33
447000 -- (-414.431) [-415.796] (-419.829) (-416.809) * (-415.997) (-417.415) [-415.595] (-419.598) -- 0:00:33
447500 -- (-421.385) (-417.011) [-416.663] (-416.556) * (-416.519) [-415.722] (-415.494) (-416.025) -- 0:00:33
448000 -- (-415.823) [-417.608] (-414.786) (-417.786) * (-418.953) [-415.483] (-418.978) (-416.813) -- 0:00:33
448500 -- (-416.318) (-416.639) (-414.754) [-415.247] * (-415.711) (-415.147) [-422.364] (-416.237) -- 0:00:33
449000 -- (-416.662) (-420.136) (-417.028) [-415.533] * [-415.128] (-417.421) (-417.236) (-417.071) -- 0:00:33
449500 -- [-416.750] (-417.338) (-418.012) (-418.977) * (-420.124) (-419.387) [-415.392] (-419.752) -- 0:00:33
450000 -- (-417.476) (-417.544) (-414.634) [-415.446] * [-417.571] (-419.841) (-416.648) (-420.114) -- 0:00:33
Average standard deviation of split frequencies: 0.010402
450500 -- (-414.487) (-416.356) (-419.286) [-415.291] * (-414.894) (-416.475) (-416.615) [-416.664] -- 0:00:32
451000 -- [-415.073] (-417.423) (-416.589) (-419.218) * (-417.155) (-418.411) [-416.865] (-418.933) -- 0:00:32
451500 -- [-416.253] (-416.428) (-419.895) (-418.029) * (-418.511) [-415.788] (-420.835) (-418.950) -- 0:00:32
452000 -- (-418.584) [-415.968] (-418.454) (-416.387) * (-418.419) (-415.470) (-418.809) [-419.435] -- 0:00:32
452500 -- (-415.026) (-420.363) [-416.565] (-416.520) * (-419.202) (-418.467) (-418.918) [-417.347] -- 0:00:32
453000 -- (-415.159) [-419.041] (-418.128) (-423.278) * [-415.078] (-420.420) (-420.564) (-416.370) -- 0:00:32
453500 -- (-417.783) (-417.886) [-416.673] (-416.138) * (-415.353) [-415.166] (-415.474) (-420.903) -- 0:00:33
454000 -- (-417.167) [-415.096] (-418.336) (-414.993) * (-419.438) (-422.708) [-417.802] (-415.686) -- 0:00:33
454500 -- [-418.872] (-414.883) (-415.638) (-414.525) * (-417.715) (-417.318) [-418.131] (-421.567) -- 0:00:33
455000 -- [-417.239] (-417.542) (-419.559) (-416.352) * (-417.050) [-416.506] (-417.399) (-425.485) -- 0:00:33
Average standard deviation of split frequencies: 0.010338
455500 -- (-417.244) [-417.016] (-417.970) (-415.842) * [-415.671] (-416.289) (-418.774) (-418.085) -- 0:00:33
456000 -- [-415.820] (-414.952) (-417.583) (-417.527) * [-415.510] (-416.222) (-421.583) (-416.159) -- 0:00:33
456500 -- (-418.716) (-415.684) [-415.871] (-415.718) * (-416.170) (-415.520) [-418.076] (-418.282) -- 0:00:33
457000 -- (-417.880) (-418.527) [-415.340] (-416.735) * (-417.171) (-422.109) (-414.625) [-419.385] -- 0:00:33
457500 -- (-416.363) (-415.587) [-416.982] (-417.080) * (-419.058) [-415.658] (-414.632) (-416.745) -- 0:00:33
458000 -- (-416.394) (-415.333) (-417.966) [-415.619] * (-419.102) (-418.609) [-420.808] (-422.184) -- 0:00:33
458500 -- (-414.750) [-416.803] (-419.556) (-416.062) * (-415.361) (-415.558) (-415.907) [-416.204] -- 0:00:33
459000 -- (-416.351) [-417.487] (-419.447) (-419.722) * (-417.071) (-417.903) [-418.339] (-415.526) -- 0:00:33
459500 -- (-423.583) (-418.025) (-416.090) [-420.953] * (-415.242) (-415.931) (-420.572) [-418.834] -- 0:00:32
460000 -- (-415.062) (-417.256) (-416.164) [-419.352] * (-415.588) [-415.718] (-415.968) (-415.421) -- 0:00:32
Average standard deviation of split frequencies: 0.010006
460500 -- [-416.361] (-416.157) (-416.897) (-418.312) * (-418.155) (-416.349) [-415.103] (-415.660) -- 0:00:32
461000 -- (-415.795) [-414.857] (-418.189) (-422.871) * (-415.620) [-415.025] (-415.360) (-417.318) -- 0:00:32
461500 -- (-418.715) (-414.578) (-418.122) [-417.620] * [-416.867] (-418.589) (-415.601) (-417.646) -- 0:00:32
462000 -- (-416.385) [-417.784] (-420.615) (-415.611) * [-416.284] (-416.465) (-415.647) (-424.357) -- 0:00:32
462500 -- (-415.553) (-414.761) [-417.407] (-417.589) * [-416.264] (-415.015) (-418.407) (-423.417) -- 0:00:32
463000 -- [-415.358] (-416.735) (-416.557) (-416.140) * [-416.542] (-417.348) (-415.875) (-418.269) -- 0:00:32
463500 -- (-417.810) (-415.131) [-416.897] (-415.852) * (-416.247) (-415.553) [-415.957] (-417.382) -- 0:00:32
464000 -- (-418.397) (-416.258) (-416.906) [-416.910] * [-416.476] (-419.200) (-419.037) (-415.566) -- 0:00:32
464500 -- (-417.531) (-419.091) (-417.459) [-418.810] * (-425.464) (-418.836) [-416.725] (-415.407) -- 0:00:32
465000 -- (-417.644) (-416.889) (-416.657) [-416.964] * (-415.020) (-418.683) (-418.355) [-414.633] -- 0:00:32
Average standard deviation of split frequencies: 0.009947
465500 -- (-416.416) [-418.409] (-418.153) (-419.494) * (-417.041) (-416.956) (-419.174) [-414.616] -- 0:00:32
466000 -- (-418.361) [-416.853] (-418.686) (-418.161) * [-418.007] (-418.004) (-416.592) (-418.710) -- 0:00:32
466500 -- [-416.502] (-415.415) (-414.932) (-417.289) * (-416.182) [-415.639] (-417.176) (-418.475) -- 0:00:32
467000 -- (-416.007) (-418.229) (-418.773) [-414.961] * (-415.773) (-418.768) (-418.060) [-416.173] -- 0:00:31
467500 -- (-417.539) (-419.186) (-419.646) [-416.869] * (-422.187) (-418.097) (-418.570) [-416.122] -- 0:00:31
468000 -- (-414.567) (-416.548) (-416.673) [-419.827] * (-418.999) (-416.981) [-418.622] (-418.617) -- 0:00:31
468500 -- [-415.668] (-421.805) (-416.144) (-419.921) * (-419.786) (-416.649) [-417.235] (-415.280) -- 0:00:31
469000 -- (-418.252) (-417.647) (-416.100) [-418.717] * (-422.620) (-416.511) [-414.838] (-417.654) -- 0:00:32
469500 -- (-419.934) [-418.423] (-416.370) (-415.365) * (-417.596) [-417.881] (-416.525) (-415.792) -- 0:00:32
470000 -- (-416.227) (-414.996) [-416.220] (-418.220) * (-418.898) (-417.135) (-416.543) [-417.613] -- 0:00:32
Average standard deviation of split frequencies: 0.008792
470500 -- (-420.858) (-419.925) (-419.658) [-416.804] * (-418.351) (-419.467) (-417.993) [-417.002] -- 0:00:32
471000 -- (-417.439) (-415.913) [-417.965] (-416.230) * (-416.759) (-419.570) (-418.985) [-414.918] -- 0:00:32
471500 -- (-417.605) (-415.235) (-418.540) [-415.787] * (-418.351) (-419.262) (-416.053) [-418.217] -- 0:00:32
472000 -- (-422.599) [-415.726] (-417.676) (-415.279) * (-416.545) (-418.064) (-419.172) [-416.545] -- 0:00:32
472500 -- (-415.918) (-417.389) (-416.999) [-415.564] * (-416.248) [-415.872] (-424.353) (-414.929) -- 0:00:32
473000 -- (-417.091) (-416.765) (-415.363) [-416.614] * (-421.374) (-416.302) (-420.857) [-416.036] -- 0:00:32
473500 -- (-414.571) (-416.636) (-417.722) [-418.201] * (-422.571) (-417.640) [-417.752] (-416.852) -- 0:00:32
474000 -- [-415.616] (-417.038) (-416.018) (-415.408) * (-416.071) (-415.938) (-417.267) [-415.528] -- 0:00:32
474500 -- (-415.732) [-416.388] (-416.036) (-417.113) * [-415.526] (-416.574) (-417.956) (-415.172) -- 0:00:32
475000 -- [-416.928] (-416.878) (-417.115) (-418.103) * (-417.295) (-417.840) (-422.399) [-415.350] -- 0:00:32
Average standard deviation of split frequencies: 0.008858
475500 -- (-415.582) (-418.269) [-414.818] (-416.291) * [-415.154] (-418.542) (-418.846) (-416.933) -- 0:00:31
476000 -- (-417.173) (-418.379) (-416.918) [-417.400] * [-418.881] (-415.806) (-422.030) (-415.889) -- 0:00:31
476500 -- [-418.073] (-416.411) (-416.776) (-422.914) * [-415.108] (-417.825) (-415.385) (-418.884) -- 0:00:31
477000 -- (-415.361) (-417.485) (-421.475) [-417.416] * (-416.626) (-416.330) (-420.963) [-416.070] -- 0:00:31
477500 -- (-417.292) [-415.490] (-417.782) (-418.019) * (-416.015) [-415.142] (-416.720) (-418.443) -- 0:00:31
478000 -- (-415.775) (-417.820) [-415.321] (-415.952) * (-418.897) (-417.166) (-415.178) [-415.482] -- 0:00:31
478500 -- (-417.528) [-415.698] (-415.073) (-418.220) * (-416.752) [-416.785] (-415.991) (-420.143) -- 0:00:31
479000 -- (-417.495) (-416.424) (-421.252) [-415.514] * (-417.081) [-417.410] (-416.685) (-422.184) -- 0:00:31
479500 -- [-416.879] (-415.170) (-416.280) (-420.036) * (-417.113) [-418.708] (-419.750) (-415.527) -- 0:00:31
480000 -- (-415.992) (-416.810) (-417.389) [-416.960] * (-416.054) [-417.291] (-416.167) (-414.839) -- 0:00:31
Average standard deviation of split frequencies: 0.008942
480500 -- (-416.702) (-415.792) [-416.019] (-417.016) * (-421.635) (-419.255) [-417.148] (-415.754) -- 0:00:31
481000 -- [-416.126] (-418.933) (-415.765) (-414.645) * (-418.628) [-415.385] (-416.063) (-418.489) -- 0:00:31
481500 -- (-417.283) (-419.550) [-418.628] (-416.220) * (-414.693) (-422.706) (-415.844) [-417.356] -- 0:00:31
482000 -- (-415.730) (-418.740) [-419.630] (-416.041) * [-415.910] (-416.847) (-415.781) (-417.180) -- 0:00:31
482500 -- [-414.646] (-416.980) (-415.406) (-421.473) * (-416.228) (-416.930) (-415.054) [-418.328] -- 0:00:31
483000 -- (-415.342) [-416.872] (-415.496) (-419.052) * (-416.820) (-416.550) (-417.001) [-417.959] -- 0:00:31
483500 -- (-415.938) [-416.229] (-417.168) (-416.463) * (-417.668) (-420.152) (-417.440) [-416.776] -- 0:00:30
484000 -- (-415.043) (-415.650) [-416.671] (-421.349) * (-416.434) (-417.536) (-419.062) [-415.273] -- 0:00:30
484500 -- (-417.323) [-417.832] (-416.499) (-417.250) * [-415.406] (-418.240) (-418.836) (-415.544) -- 0:00:30
485000 -- (-418.645) (-416.374) [-417.256] (-416.761) * [-418.812] (-418.518) (-414.910) (-417.953) -- 0:00:30
Average standard deviation of split frequencies: 0.008730
485500 -- (-415.758) (-418.539) (-416.154) [-415.442] * (-415.331) (-416.534) (-419.241) [-420.373] -- 0:00:30
486000 -- [-416.754] (-418.720) (-417.380) (-418.875) * [-414.750] (-417.218) (-415.471) (-415.028) -- 0:00:31
486500 -- [-418.027] (-419.069) (-416.754) (-416.735) * (-416.431) (-418.449) [-415.650] (-415.462) -- 0:00:31
487000 -- [-414.986] (-420.751) (-416.163) (-418.411) * (-417.641) (-416.531) (-416.968) [-417.273] -- 0:00:31
487500 -- (-415.847) (-420.652) [-416.856] (-417.797) * (-420.855) (-416.149) (-418.032) [-418.503] -- 0:00:31
488000 -- (-420.270) (-417.087) (-418.317) [-417.056] * (-419.133) (-415.778) [-418.221] (-420.065) -- 0:00:31
488500 -- (-416.728) [-415.696] (-420.775) (-420.991) * (-422.278) (-421.633) (-416.514) [-417.131] -- 0:00:31
489000 -- (-416.917) [-416.957] (-420.341) (-420.961) * [-416.883] (-416.977) (-418.236) (-415.112) -- 0:00:31
489500 -- (-416.984) (-415.435) [-416.402] (-415.182) * [-416.855] (-416.774) (-416.881) (-416.470) -- 0:00:31
490000 -- [-421.766] (-418.235) (-417.121) (-416.953) * [-415.293] (-414.574) (-415.643) (-418.578) -- 0:00:31
Average standard deviation of split frequencies: 0.008025
490500 -- (-415.822) [-418.058] (-417.606) (-416.889) * (-418.598) [-418.643] (-419.418) (-415.973) -- 0:00:31
491000 -- (-417.895) (-414.953) (-415.968) [-414.816] * (-415.564) (-420.080) [-419.213] (-415.806) -- 0:00:31
491500 -- (-423.107) (-417.540) (-414.644) [-416.177] * (-417.835) (-418.260) [-416.488] (-418.895) -- 0:00:31
492000 -- (-416.374) (-414.679) [-414.648] (-415.348) * (-416.553) (-416.348) [-415.390] (-417.245) -- 0:00:30
492500 -- (-417.713) [-414.527] (-416.068) (-417.410) * (-418.175) (-414.712) [-417.699] (-421.001) -- 0:00:30
493000 -- (-415.388) [-414.713] (-415.736) (-416.800) * [-416.624] (-416.974) (-420.853) (-416.714) -- 0:00:30
493500 -- (-415.740) (-416.141) [-416.117] (-418.959) * [-416.760] (-415.237) (-416.501) (-415.702) -- 0:00:30
494000 -- (-415.417) (-417.098) [-415.194] (-421.140) * (-416.007) [-416.724] (-416.417) (-417.352) -- 0:00:30
494500 -- (-416.033) (-422.656) (-415.548) [-417.133] * (-417.309) (-415.435) (-416.814) [-419.825] -- 0:00:30
495000 -- (-425.588) (-421.360) [-418.569] (-415.694) * (-415.950) [-415.076] (-415.421) (-420.065) -- 0:00:30
Average standard deviation of split frequencies: 0.008079
495500 -- (-415.445) (-415.729) [-415.922] (-416.628) * (-416.533) (-415.178) (-415.401) [-415.355] -- 0:00:30
496000 -- (-418.451) (-418.219) (-416.618) [-415.053] * [-416.609] (-418.189) (-415.851) (-415.696) -- 0:00:30
496500 -- (-417.985) [-418.217] (-417.675) (-415.236) * (-421.365) [-416.298] (-418.428) (-415.129) -- 0:00:30
497000 -- [-416.979] (-418.845) (-418.457) (-418.084) * (-420.802) (-417.221) (-419.777) [-420.519] -- 0:00:30
497500 -- (-415.296) [-417.962] (-419.512) (-419.281) * [-418.198] (-415.546) (-415.863) (-418.725) -- 0:00:30
498000 -- (-415.032) [-419.001] (-419.232) (-415.964) * (-417.675) [-418.081] (-420.607) (-415.789) -- 0:00:30
498500 -- [-415.435] (-416.049) (-416.262) (-414.713) * (-415.883) (-417.935) [-415.127] (-416.264) -- 0:00:30
499000 -- (-415.195) (-427.684) (-417.129) [-415.333] * [-416.282] (-414.763) (-415.007) (-418.935) -- 0:00:30
499500 -- (-415.492) [-419.455] (-417.330) (-418.993) * (-415.037) (-424.859) [-417.968] (-415.509) -- 0:00:30
500000 -- (-415.589) (-416.414) [-416.660] (-417.868) * [-414.696] (-415.490) (-416.162) (-415.934) -- 0:00:30
Average standard deviation of split frequencies: 0.007784
500500 -- [-414.928] (-415.608) (-417.692) (-418.546) * [-416.645] (-416.809) (-417.915) (-418.016) -- 0:00:29
501000 -- (-414.648) (-416.219) [-417.242] (-419.067) * [-415.701] (-417.298) (-420.966) (-417.417) -- 0:00:29
501500 -- (-416.857) [-419.060] (-417.778) (-418.412) * (-415.547) (-417.734) [-415.366] (-418.296) -- 0:00:29
502000 -- (-415.700) (-414.501) (-420.732) [-416.020] * (-416.410) [-419.368] (-419.586) (-415.406) -- 0:00:29
502500 -- [-419.493] (-418.517) (-418.010) (-416.216) * (-415.093) (-419.675) [-415.582] (-417.454) -- 0:00:29
503000 -- [-418.342] (-418.199) (-423.027) (-418.580) * (-414.588) (-417.774) (-416.839) [-417.341] -- 0:00:30
503500 -- (-415.801) [-415.472] (-414.704) (-417.234) * (-414.889) (-415.897) (-418.003) [-417.305] -- 0:00:30
504000 -- [-417.935] (-414.973) (-416.892) (-418.546) * (-416.155) (-418.219) (-415.797) [-417.265] -- 0:00:30
504500 -- [-417.037] (-418.252) (-418.398) (-416.394) * (-415.813) (-415.971) [-421.024] (-417.444) -- 0:00:30
505000 -- [-417.912] (-418.844) (-416.309) (-417.922) * [-415.873] (-415.805) (-418.250) (-415.974) -- 0:00:30
Average standard deviation of split frequencies: 0.007826
505500 -- (-415.735) (-414.979) (-417.841) [-421.074] * (-417.482) (-415.178) (-415.399) [-415.917] -- 0:00:30
506000 -- (-416.228) (-419.461) (-419.280) [-417.689] * (-418.975) (-417.000) [-417.655] (-416.838) -- 0:00:30
506500 -- [-415.140] (-415.573) (-418.852) (-416.476) * (-417.252) [-416.706] (-416.908) (-416.594) -- 0:00:30
507000 -- (-416.356) (-415.748) [-417.550] (-418.377) * (-419.415) (-417.724) [-416.109] (-418.301) -- 0:00:30
507500 -- (-414.702) (-415.770) [-415.566] (-417.418) * (-415.759) [-417.607] (-417.218) (-415.462) -- 0:00:30
508000 -- (-415.694) [-414.708] (-416.055) (-418.032) * (-415.399) (-416.976) [-416.280] (-416.629) -- 0:00:30
508500 -- (-419.676) (-414.793) [-417.390] (-419.843) * (-415.189) (-421.003) (-415.992) [-417.121] -- 0:00:29
509000 -- (-426.230) [-415.708] (-417.125) (-417.763) * [-414.962] (-415.822) (-419.318) (-417.957) -- 0:00:29
509500 -- (-421.072) (-416.210) (-417.260) [-419.071] * [-414.923] (-416.060) (-423.906) (-418.144) -- 0:00:29
510000 -- [-419.908] (-415.177) (-415.732) (-422.612) * (-417.365) (-415.636) (-415.204) [-416.711] -- 0:00:29
Average standard deviation of split frequencies: 0.006954
510500 -- (-416.690) (-417.075) [-415.805] (-417.857) * [-416.663] (-415.857) (-415.961) (-417.770) -- 0:00:29
511000 -- [-415.187] (-417.880) (-416.313) (-415.272) * (-415.893) [-416.498] (-417.174) (-416.593) -- 0:00:29
511500 -- [-419.450] (-416.484) (-416.169) (-415.964) * (-415.912) [-417.464] (-417.579) (-414.870) -- 0:00:29
512000 -- (-418.751) (-418.145) (-416.809) [-416.833] * [-416.226] (-418.312) (-417.117) (-415.905) -- 0:00:29
512500 -- (-417.193) (-416.284) (-418.499) [-416.006] * (-416.310) (-416.131) (-414.707) [-415.428] -- 0:00:29
513000 -- [-415.718] (-415.990) (-416.033) (-420.975) * (-419.762) [-417.542] (-417.745) (-419.473) -- 0:00:29
513500 -- (-418.259) (-418.624) [-415.322] (-416.125) * [-416.724] (-419.637) (-421.189) (-416.059) -- 0:00:29
514000 -- (-418.833) (-421.309) [-421.208] (-415.896) * (-416.910) (-420.209) (-422.470) [-418.031] -- 0:00:29
514500 -- (-417.593) (-420.075) (-418.329) [-414.877] * (-416.130) (-417.810) (-415.266) [-416.432] -- 0:00:29
515000 -- (-416.544) (-420.839) (-415.633) [-416.997] * (-416.242) (-418.429) (-415.684) [-415.841] -- 0:00:29
Average standard deviation of split frequencies: 0.006273
515500 -- (-415.432) [-418.369] (-416.337) (-417.158) * (-421.580) (-415.999) [-414.877] (-418.152) -- 0:00:29
516000 -- (-416.113) (-419.241) (-415.225) [-416.282] * (-415.098) (-416.325) [-415.974] (-417.465) -- 0:00:29
516500 -- (-414.962) [-418.727] (-419.835) (-415.966) * [-415.185] (-415.477) (-417.315) (-416.087) -- 0:00:29
517000 -- (-419.417) (-415.027) [-414.856] (-422.879) * (-415.780) (-419.669) [-418.022] (-424.613) -- 0:00:28
517500 -- [-415.923] (-415.281) (-420.690) (-417.767) * (-417.870) (-417.114) (-418.080) [-416.497] -- 0:00:28
518000 -- (-414.963) [-419.106] (-416.366) (-415.910) * (-416.097) (-416.877) (-417.166) [-419.780] -- 0:00:28
518500 -- (-421.152) [-416.259] (-415.896) (-419.912) * [-414.842] (-416.556) (-416.879) (-417.192) -- 0:00:28
519000 -- (-419.641) (-415.286) [-415.220] (-416.493) * (-416.440) (-422.143) (-418.057) [-417.783] -- 0:00:28
519500 -- (-419.399) [-415.986] (-415.875) (-417.590) * (-415.185) (-418.109) (-418.964) [-416.967] -- 0:00:29
520000 -- [-418.693] (-416.128) (-419.430) (-419.458) * (-415.801) (-416.302) (-417.645) [-420.642] -- 0:00:29
Average standard deviation of split frequencies: 0.005855
520500 -- [-419.560] (-416.293) (-416.990) (-414.781) * [-418.016] (-416.855) (-414.992) (-422.356) -- 0:00:29
521000 -- (-419.184) (-420.820) (-419.341) [-414.568] * (-419.470) [-416.423] (-415.439) (-417.720) -- 0:00:29
521500 -- [-417.501] (-419.073) (-416.998) (-417.387) * [-417.139] (-415.669) (-415.920) (-414.940) -- 0:00:29
522000 -- (-420.678) (-418.023) (-419.575) [-420.079] * (-415.648) (-415.847) (-416.822) [-415.156] -- 0:00:29
522500 -- (-416.914) [-418.795] (-414.764) (-424.027) * [-414.950] (-420.054) (-417.719) (-416.498) -- 0:00:29
523000 -- (-414.882) [-414.795] (-415.460) (-416.820) * (-417.152) (-417.921) [-417.474] (-416.578) -- 0:00:29
523500 -- [-415.376] (-415.003) (-415.295) (-417.662) * (-417.711) (-416.425) (-416.263) [-414.805] -- 0:00:29
524000 -- [-417.685] (-415.848) (-415.462) (-419.553) * (-415.164) (-415.886) [-415.385] (-416.266) -- 0:00:29
524500 -- (-416.783) (-417.595) (-416.586) [-414.796] * [-416.877] (-415.402) (-415.390) (-415.732) -- 0:00:29
525000 -- (-416.678) (-415.463) (-417.066) [-418.331] * (-416.395) [-417.269] (-414.975) (-419.095) -- 0:00:28
Average standard deviation of split frequencies: 0.006554
525500 -- (-419.064) [-418.556] (-421.233) (-416.823) * (-418.486) (-420.156) (-416.653) [-417.578] -- 0:00:28
526000 -- (-418.243) [-416.914] (-417.149) (-418.310) * [-415.316] (-422.701) (-415.545) (-415.975) -- 0:00:28
526500 -- [-415.736] (-420.422) (-415.492) (-417.768) * (-415.450) [-422.661] (-415.485) (-417.226) -- 0:00:28
527000 -- (-415.466) [-423.242] (-414.864) (-419.165) * [-416.640] (-415.613) (-416.631) (-418.527) -- 0:00:28
527500 -- (-416.752) [-417.171] (-414.995) (-417.250) * [-416.984] (-417.707) (-416.658) (-418.034) -- 0:00:28
528000 -- (-416.605) (-415.645) [-415.333] (-416.649) * (-418.946) (-418.743) [-416.025] (-417.035) -- 0:00:28
528500 -- [-416.234] (-416.147) (-415.338) (-414.892) * (-420.406) [-417.020] (-415.141) (-416.577) -- 0:00:28
529000 -- (-415.743) (-418.283) (-417.523) [-415.783] * (-417.611) (-415.080) [-417.994] (-416.088) -- 0:00:28
529500 -- [-418.294] (-419.171) (-415.061) (-415.722) * [-417.393] (-415.525) (-416.161) (-422.064) -- 0:00:28
530000 -- [-418.711] (-417.724) (-416.263) (-418.204) * [-416.518] (-418.043) (-415.456) (-415.254) -- 0:00:28
Average standard deviation of split frequencies: 0.005567
530500 -- (-419.702) (-418.153) [-417.336] (-420.202) * (-422.812) (-417.728) (-419.797) [-416.688] -- 0:00:28
531000 -- (-416.723) [-415.161] (-415.980) (-417.807) * (-416.795) (-418.586) (-417.141) [-417.991] -- 0:00:28
531500 -- [-417.460] (-415.137) (-416.292) (-416.527) * (-416.353) (-419.033) [-416.163] (-417.101) -- 0:00:28
532000 -- (-416.557) [-416.098] (-421.068) (-421.003) * [-418.582] (-417.765) (-417.013) (-416.704) -- 0:00:28
532500 -- (-417.275) (-419.076) [-415.801] (-420.437) * (-418.091) (-421.374) (-416.772) [-415.243] -- 0:00:28
533000 -- (-417.218) (-416.498) (-416.348) [-415.671] * (-421.118) (-415.712) (-417.940) [-416.022] -- 0:00:28
533500 -- (-416.692) (-418.108) (-420.206) [-417.094] * [-415.433] (-415.390) (-419.608) (-416.145) -- 0:00:27
534000 -- [-416.374] (-418.179) (-418.115) (-418.310) * (-415.538) (-417.105) [-420.633] (-415.948) -- 0:00:27
534500 -- [-416.169] (-418.008) (-418.756) (-417.087) * (-417.563) [-416.602] (-420.361) (-418.091) -- 0:00:27
535000 -- (-419.159) [-415.725] (-420.479) (-417.869) * (-416.078) [-415.634] (-416.475) (-419.248) -- 0:00:27
Average standard deviation of split frequencies: 0.005336
535500 -- [-416.390] (-419.071) (-415.451) (-416.526) * [-415.127] (-415.878) (-416.734) (-425.765) -- 0:00:27
536000 -- (-417.411) [-417.622] (-416.111) (-415.328) * (-415.265) (-416.759) [-419.054] (-421.747) -- 0:00:27
536500 -- (-414.569) (-420.290) (-415.350) [-416.290] * (-416.045) (-415.474) (-417.217) [-416.137] -- 0:00:28
537000 -- (-419.237) (-415.922) [-417.703] (-416.903) * [-417.036] (-416.558) (-416.139) (-417.991) -- 0:00:28
537500 -- (-416.222) [-414.838] (-415.029) (-417.187) * (-416.297) [-421.092] (-415.334) (-424.168) -- 0:00:28
538000 -- (-417.393) [-415.868] (-417.045) (-416.927) * [-419.954] (-418.393) (-415.320) (-415.781) -- 0:00:28
538500 -- [-417.389] (-415.772) (-415.854) (-417.142) * (-415.514) (-417.641) (-415.339) [-415.674] -- 0:00:28
539000 -- (-415.226) [-416.123] (-416.833) (-417.857) * (-416.298) (-415.157) (-422.007) [-416.906] -- 0:00:28
539500 -- (-415.512) [-418.615] (-415.261) (-415.999) * [-415.302] (-415.235) (-416.154) (-415.243) -- 0:00:28
540000 -- (-416.588) (-418.299) [-415.148] (-416.148) * (-415.103) [-416.864] (-417.784) (-417.043) -- 0:00:28
Average standard deviation of split frequencies: 0.004999
540500 -- [-419.353] (-417.620) (-416.955) (-415.793) * [-416.243] (-421.726) (-417.871) (-416.099) -- 0:00:28
541000 -- (-417.861) (-418.463) (-423.187) [-419.521] * (-415.425) (-417.398) (-415.821) [-417.015] -- 0:00:27
541500 -- (-416.006) (-418.629) (-417.323) [-417.969] * (-416.205) (-415.562) [-415.720] (-415.089) -- 0:00:27
542000 -- (-417.319) (-418.916) [-415.662] (-417.050) * (-414.560) [-418.395] (-419.893) (-421.218) -- 0:00:27
542500 -- (-415.558) (-420.953) [-415.969] (-417.067) * [-416.710] (-415.992) (-416.801) (-415.164) -- 0:00:27
543000 -- (-414.766) (-417.081) [-417.699] (-420.019) * [-415.069] (-418.558) (-415.666) (-416.538) -- 0:00:27
543500 -- (-423.654) (-419.853) [-416.431] (-415.930) * (-416.060) (-418.350) [-415.635] (-418.854) -- 0:00:27
544000 -- (-420.828) [-415.471] (-415.496) (-414.991) * (-415.651) [-417.709] (-415.686) (-417.794) -- 0:00:27
544500 -- (-415.746) (-417.222) [-417.010] (-417.496) * [-416.291] (-418.148) (-416.917) (-414.582) -- 0:00:27
545000 -- (-418.024) (-416.902) [-414.940] (-418.495) * (-415.732) (-415.882) (-416.824) [-415.242] -- 0:00:27
Average standard deviation of split frequencies: 0.005583
545500 -- (-415.419) (-418.596) [-417.905] (-415.652) * (-415.727) [-414.592] (-419.608) (-416.023) -- 0:00:27
546000 -- (-421.559) (-416.196) (-418.054) [-417.041] * [-415.123] (-420.843) (-417.100) (-416.972) -- 0:00:27
546500 -- (-417.069) [-416.502] (-415.883) (-418.397) * [-414.706] (-415.301) (-418.404) (-417.611) -- 0:00:27
547000 -- (-416.870) [-416.311] (-417.786) (-417.776) * (-421.851) (-416.857) (-417.126) [-422.091] -- 0:00:27
547500 -- (-415.215) (-414.818) [-417.369] (-415.632) * [-417.374] (-416.660) (-423.776) (-417.752) -- 0:00:27
548000 -- [-415.532] (-415.354) (-415.825) (-415.313) * (-415.962) [-419.065] (-417.235) (-415.358) -- 0:00:27
548500 -- [-419.627] (-415.588) (-416.432) (-415.376) * (-419.340) [-415.408] (-417.245) (-415.458) -- 0:00:27
549000 -- [-417.952] (-416.656) (-414.785) (-416.212) * (-418.799) (-415.173) [-415.343] (-417.095) -- 0:00:27
549500 -- (-416.926) (-416.463) (-418.396) [-418.353] * (-416.061) (-414.870) (-420.973) [-415.964] -- 0:00:27
550000 -- [-416.499] (-416.129) (-419.636) (-415.615) * (-417.634) (-415.576) (-416.907) [-414.675] -- 0:00:27
Average standard deviation of split frequencies: 0.005422
550500 -- (-416.841) [-415.152] (-418.333) (-415.671) * (-419.231) (-415.939) (-418.872) [-416.318] -- 0:00:26
551000 -- (-416.541) (-417.218) (-417.384) [-416.359] * (-415.820) (-418.855) [-418.330] (-419.102) -- 0:00:26
551500 -- (-417.763) [-420.136] (-417.926) (-416.517) * (-415.200) (-416.947) [-416.422] (-416.564) -- 0:00:26
552000 -- (-416.369) [-415.317] (-417.225) (-415.196) * (-414.973) (-415.861) (-417.318) [-418.097] -- 0:00:26
552500 -- [-416.068] (-416.982) (-419.836) (-417.549) * (-416.068) (-418.471) (-419.762) [-416.095] -- 0:00:26
553000 -- (-417.497) (-416.910) [-417.737] (-420.400) * (-416.448) (-414.986) (-416.107) [-416.132] -- 0:00:26
553500 -- (-417.439) [-416.498] (-417.962) (-418.052) * (-415.077) (-419.615) (-417.009) [-415.843] -- 0:00:27
554000 -- (-415.262) (-421.710) [-416.692] (-415.049) * (-416.402) (-417.488) [-416.760] (-420.135) -- 0:00:27
554500 -- (-415.917) [-415.389] (-420.605) (-415.361) * (-418.528) (-419.574) (-417.776) [-415.067] -- 0:00:27
555000 -- [-415.984] (-417.173) (-420.919) (-415.910) * (-415.880) (-417.877) (-415.654) [-418.744] -- 0:00:27
Average standard deviation of split frequencies: 0.005539
555500 -- (-427.707) (-416.884) (-417.935) [-416.852] * (-415.111) (-415.852) [-415.098] (-416.872) -- 0:00:27
556000 -- (-418.885) (-417.204) [-418.943] (-420.337) * (-419.500) [-416.139] (-416.837) (-418.356) -- 0:00:27
556500 -- [-415.279] (-415.453) (-415.814) (-418.162) * (-417.612) (-417.037) [-419.284] (-419.267) -- 0:00:27
557000 -- (-415.525) [-416.825] (-417.134) (-420.158) * (-418.654) [-416.202] (-415.289) (-415.044) -- 0:00:27
557500 -- (-422.443) (-416.251) [-415.805] (-417.285) * [-418.613] (-415.111) (-417.491) (-420.416) -- 0:00:26
558000 -- (-415.486) [-415.524] (-416.479) (-416.716) * [-416.883] (-423.737) (-419.454) (-418.975) -- 0:00:26
558500 -- (-416.282) (-415.793) [-416.485] (-417.760) * (-415.455) (-418.097) [-415.891] (-415.157) -- 0:00:26
559000 -- (-416.493) [-419.784] (-415.917) (-416.609) * (-416.431) [-416.211] (-417.341) (-419.220) -- 0:00:26
559500 -- (-418.150) [-417.675] (-423.269) (-420.851) * (-419.546) [-416.199] (-415.873) (-416.945) -- 0:00:26
560000 -- (-417.019) (-415.551) (-417.866) [-415.720] * (-417.532) [-416.637] (-415.469) (-415.286) -- 0:00:26
Average standard deviation of split frequencies: 0.004877
560500 -- (-418.801) (-419.413) (-415.639) [-415.853] * (-416.415) (-417.614) (-415.422) [-417.631] -- 0:00:26
561000 -- (-416.983) (-420.419) [-417.593] (-415.070) * [-417.749] (-418.105) (-417.054) (-420.006) -- 0:00:26
561500 -- (-414.913) (-418.217) (-416.273) [-417.863] * (-416.533) (-418.946) [-417.572] (-416.777) -- 0:00:26
562000 -- [-416.730] (-417.397) (-419.974) (-417.010) * (-417.925) (-418.345) (-417.100) [-417.405] -- 0:00:26
562500 -- (-417.199) [-415.299] (-418.644) (-416.676) * [-414.927] (-415.895) (-415.924) (-417.788) -- 0:00:26
563000 -- [-418.939] (-414.770) (-420.925) (-418.487) * [-415.740] (-415.173) (-417.025) (-420.830) -- 0:00:26
563500 -- [-415.814] (-417.151) (-416.415) (-417.280) * (-417.468) [-417.511] (-415.454) (-415.159) -- 0:00:26
564000 -- (-416.663) (-418.419) (-414.764) [-416.044] * (-416.507) [-416.001] (-415.359) (-415.942) -- 0:00:26
564500 -- [-419.273] (-417.739) (-416.768) (-414.929) * (-415.687) [-415.863] (-419.519) (-418.010) -- 0:00:26
565000 -- (-415.350) (-415.820) [-419.500] (-415.745) * [-415.648] (-418.682) (-417.642) (-421.413) -- 0:00:26
Average standard deviation of split frequencies: 0.005108
565500 -- [-416.035] (-414.902) (-422.576) (-418.394) * [-417.626] (-415.611) (-415.904) (-419.043) -- 0:00:26
566000 -- (-415.095) (-414.848) (-419.130) [-415.350] * [-417.958] (-416.016) (-423.131) (-419.583) -- 0:00:26
566500 -- (-417.112) (-415.035) [-414.748] (-415.596) * (-416.797) [-415.954] (-417.276) (-418.316) -- 0:00:26
567000 -- (-418.808) (-416.524) (-416.890) [-415.017] * [-416.300] (-418.004) (-417.305) (-417.141) -- 0:00:25
567500 -- [-420.590] (-416.655) (-420.393) (-418.115) * (-418.429) [-416.099] (-416.653) (-416.505) -- 0:00:25
568000 -- (-419.008) [-416.757] (-416.917) (-417.495) * (-416.102) [-417.164] (-416.280) (-415.312) -- 0:00:25
568500 -- (-418.397) [-419.197] (-417.039) (-419.207) * [-415.835] (-416.417) (-417.213) (-418.189) -- 0:00:25
569000 -- [-414.997] (-417.789) (-415.071) (-416.164) * [-415.234] (-417.644) (-416.988) (-415.595) -- 0:00:25
569500 -- (-415.321) [-418.036] (-415.851) (-417.228) * (-416.830) (-415.893) [-415.640] (-415.993) -- 0:00:25
570000 -- (-420.138) (-419.838) [-418.156] (-417.000) * (-415.024) (-416.717) (-415.368) [-416.462] -- 0:00:25
Average standard deviation of split frequencies: 0.005287
570500 -- (-416.379) (-416.569) [-415.437] (-418.205) * (-415.901) [-417.070] (-414.807) (-416.288) -- 0:00:26
571000 -- (-416.997) [-415.340] (-416.475) (-416.275) * (-416.984) (-414.627) (-416.691) [-415.584] -- 0:00:26
571500 -- (-414.751) (-417.657) (-418.404) [-414.815] * [-418.782] (-415.033) (-415.759) (-416.887) -- 0:00:26
572000 -- (-414.626) (-415.183) (-416.181) [-415.750] * (-417.069) [-415.955] (-419.016) (-415.451) -- 0:00:26
572500 -- [-416.454] (-416.083) (-418.908) (-417.803) * (-415.707) [-415.349] (-415.254) (-416.250) -- 0:00:26
573000 -- [-416.169] (-415.661) (-421.566) (-419.140) * [-417.026] (-415.244) (-416.316) (-415.513) -- 0:00:26
573500 -- (-414.947) (-416.507) [-415.294] (-418.321) * (-415.953) (-416.272) [-416.140] (-415.749) -- 0:00:26
574000 -- [-416.458] (-415.363) (-420.079) (-415.827) * [-417.126] (-417.184) (-417.551) (-414.424) -- 0:00:25
574500 -- (-416.063) (-416.538) [-418.684] (-416.984) * [-417.683] (-421.517) (-417.229) (-415.332) -- 0:00:25
575000 -- [-415.533] (-415.092) (-416.403) (-415.668) * (-415.300) (-418.200) [-415.914] (-415.426) -- 0:00:25
Average standard deviation of split frequencies: 0.004801
575500 -- [-416.420] (-418.076) (-420.890) (-418.555) * [-415.897] (-420.848) (-416.811) (-415.170) -- 0:00:25
576000 -- (-417.123) [-416.710] (-415.593) (-417.589) * (-418.219) (-414.459) (-416.754) [-419.275] -- 0:00:25
576500 -- (-417.016) (-419.086) [-414.857] (-418.156) * (-416.507) (-417.075) [-415.506] (-419.957) -- 0:00:25
577000 -- [-416.548] (-416.486) (-415.390) (-415.374) * [-414.694] (-416.259) (-416.681) (-416.142) -- 0:00:25
577500 -- (-418.447) (-416.192) (-417.211) [-418.325] * (-418.906) (-415.527) (-416.149) [-418.091] -- 0:00:25
578000 -- (-415.976) [-421.296] (-419.346) (-415.543) * (-415.120) (-416.158) [-419.752] (-418.705) -- 0:00:25
578500 -- (-417.231) [-418.830] (-415.709) (-414.935) * (-415.160) (-415.356) [-420.293] (-416.552) -- 0:00:25
579000 -- (-416.187) [-416.872] (-416.184) (-414.593) * (-416.042) (-415.681) [-417.429] (-415.774) -- 0:00:25
579500 -- (-418.414) [-415.423] (-417.577) (-415.662) * (-415.249) [-421.185] (-416.689) (-419.723) -- 0:00:25
580000 -- (-418.355) (-417.300) (-419.335) [-415.636] * (-417.310) (-415.710) [-415.535] (-415.755) -- 0:00:25
Average standard deviation of split frequencies: 0.004546
580500 -- [-415.938] (-417.971) (-420.007) (-415.238) * (-415.870) (-417.341) (-416.068) [-415.660] -- 0:00:25
581000 -- (-415.328) [-417.704] (-416.624) (-416.598) * (-415.559) [-416.530] (-419.767) (-418.429) -- 0:00:25
581500 -- (-416.818) (-418.733) (-415.462) [-417.627] * (-415.489) (-415.506) [-416.378] (-415.288) -- 0:00:25
582000 -- [-415.437] (-417.267) (-416.270) (-417.420) * (-419.562) (-416.846) [-417.951] (-416.778) -- 0:00:25
582500 -- (-416.071) (-417.824) (-417.748) [-415.233] * (-419.944) [-415.328] (-416.292) (-414.965) -- 0:00:25
583000 -- (-417.353) (-414.829) [-418.171] (-416.991) * (-415.476) [-414.872] (-419.154) (-420.297) -- 0:00:25
583500 -- (-419.604) (-414.848) (-417.893) [-418.382] * (-415.358) (-416.231) [-417.139] (-419.839) -- 0:00:24
584000 -- (-415.267) [-415.147] (-414.804) (-416.341) * (-416.929) (-416.281) [-415.917] (-423.614) -- 0:00:24
584500 -- (-418.276) (-417.392) (-415.920) [-415.114] * [-415.264] (-417.858) (-421.099) (-421.425) -- 0:00:24
585000 -- (-415.589) (-419.909) [-415.016] (-416.250) * [-419.636] (-415.657) (-415.240) (-417.639) -- 0:00:24
Average standard deviation of split frequencies: 0.004237
585500 -- (-417.246) (-420.195) (-420.638) [-417.163] * [-415.293] (-416.690) (-415.595) (-421.356) -- 0:00:24
586000 -- (-417.391) (-424.194) [-416.202] (-418.017) * (-415.617) [-414.468] (-417.084) (-418.668) -- 0:00:24
586500 -- (-416.907) [-415.995] (-415.937) (-415.207) * (-418.706) (-416.214) [-416.447] (-417.747) -- 0:00:24
587000 -- (-417.510) (-415.685) [-415.758] (-414.901) * [-416.665] (-416.141) (-419.358) (-422.201) -- 0:00:25
587500 -- (-415.530) [-415.065] (-414.815) (-416.050) * (-416.962) (-416.505) (-415.737) [-418.830] -- 0:00:25
588000 -- (-417.601) (-419.671) (-416.582) [-417.617] * (-416.908) (-415.310) [-415.182] (-418.327) -- 0:00:25
588500 -- (-415.157) (-416.113) (-416.319) [-417.244] * (-416.701) (-418.280) (-415.587) [-418.625] -- 0:00:25
589000 -- (-415.074) (-415.713) (-416.167) [-417.786] * (-419.189) (-415.824) (-415.784) [-418.405] -- 0:00:25
589500 -- (-416.368) [-415.467] (-424.575) (-420.849) * (-416.071) (-421.735) [-418.916] (-417.711) -- 0:00:25
590000 -- (-418.495) (-419.729) (-416.376) [-417.095] * (-416.183) (-418.997) [-415.031] (-419.249) -- 0:00:25
Average standard deviation of split frequencies: 0.004576
590500 -- (-419.881) (-415.527) [-417.105] (-415.736) * [-416.710] (-418.654) (-417.777) (-419.995) -- 0:00:24
591000 -- (-416.763) (-415.049) [-416.730] (-417.804) * (-416.517) (-417.533) (-415.654) [-414.916] -- 0:00:24
591500 -- (-415.195) (-417.501) (-417.762) [-421.539] * (-416.973) (-418.887) (-416.560) [-417.341] -- 0:00:24
592000 -- [-416.620] (-414.609) (-416.042) (-416.730) * (-419.614) [-415.028] (-414.902) (-421.450) -- 0:00:24
592500 -- (-415.431) (-415.559) (-417.528) [-415.728] * [-415.544] (-414.949) (-414.795) (-415.351) -- 0:00:24
593000 -- (-415.342) [-414.669] (-418.728) (-419.700) * (-416.084) (-415.430) [-417.248] (-416.272) -- 0:00:24
593500 -- (-416.686) (-417.188) (-416.840) [-416.180] * (-414.638) (-414.909) (-416.160) [-414.567] -- 0:00:24
594000 -- (-417.828) (-416.284) (-415.659) [-419.630] * (-418.721) (-420.313) (-415.365) [-415.670] -- 0:00:24
594500 -- (-416.901) (-414.978) (-417.444) [-418.662] * (-414.716) (-418.046) (-421.159) [-414.951] -- 0:00:24
595000 -- (-415.809) (-415.537) (-415.145) [-417.525] * [-415.376] (-416.045) (-417.435) (-415.228) -- 0:00:24
Average standard deviation of split frequencies: 0.004798
595500 -- [-414.795] (-415.747) (-414.951) (-416.743) * [-415.047] (-416.819) (-415.476) (-415.218) -- 0:00:24
596000 -- (-415.800) (-418.010) (-414.805) [-416.122] * (-415.569) (-417.294) (-415.818) [-414.954] -- 0:00:24
596500 -- [-418.252] (-416.939) (-415.221) (-419.967) * (-416.592) [-416.414] (-416.931) (-415.229) -- 0:00:24
597000 -- (-415.273) (-416.329) (-418.055) [-418.808] * (-416.833) [-418.217] (-420.066) (-415.713) -- 0:00:24
597500 -- (-415.299) (-417.940) [-417.617] (-417.255) * (-421.303) (-417.886) (-418.322) [-417.039] -- 0:00:24
598000 -- (-417.267) [-415.815] (-417.286) (-416.333) * (-417.703) (-416.790) [-416.471] (-416.045) -- 0:00:24
598500 -- [-416.219] (-414.599) (-415.920) (-416.453) * (-416.138) [-417.589] (-416.838) (-415.732) -- 0:00:24
599000 -- (-416.681) [-417.303] (-417.061) (-417.016) * [-415.647] (-417.354) (-419.813) (-417.563) -- 0:00:24
599500 -- (-418.898) (-415.172) (-416.997) [-414.592] * (-417.381) [-415.857] (-415.273) (-415.092) -- 0:00:24
600000 -- (-419.101) (-418.288) (-416.290) [-418.167] * (-416.434) (-416.488) [-416.731] (-418.262) -- 0:00:24
Average standard deviation of split frequencies: 0.005284
600500 -- [-416.968] (-418.791) (-416.260) (-414.797) * [-415.785] (-419.029) (-417.200) (-417.550) -- 0:00:23
601000 -- (-416.079) (-417.647) [-416.249] (-415.558) * (-416.086) [-416.996] (-420.221) (-416.171) -- 0:00:23
601500 -- (-415.876) (-417.726) (-415.813) [-416.293] * (-415.949) (-417.647) [-416.111] (-417.771) -- 0:00:23
602000 -- (-414.927) (-414.544) [-415.983] (-417.966) * [-415.887] (-418.595) (-418.309) (-418.194) -- 0:00:23
602500 -- (-415.568) (-415.192) (-416.322) [-416.010] * (-419.328) (-418.827) (-418.508) [-417.750] -- 0:00:23
603000 -- [-418.976] (-417.708) (-417.748) (-416.079) * (-419.913) (-417.085) (-415.502) [-422.596] -- 0:00:23
603500 -- (-416.957) (-418.907) (-419.644) [-416.750] * (-425.065) (-422.647) [-419.331] (-417.173) -- 0:00:23
604000 -- (-415.851) [-416.774] (-419.636) (-419.258) * (-422.541) (-418.548) [-418.928] (-417.901) -- 0:00:24
604500 -- (-416.424) [-415.183] (-417.521) (-416.871) * (-417.774) (-417.891) (-418.643) [-415.484] -- 0:00:24
605000 -- [-417.260] (-417.311) (-420.981) (-419.830) * (-416.425) (-417.818) [-417.284] (-418.281) -- 0:00:24
Average standard deviation of split frequencies: 0.005549
605500 -- (-417.320) (-415.637) (-416.126) [-414.826] * [-415.791] (-416.130) (-418.060) (-415.957) -- 0:00:24
606000 -- (-417.139) [-419.116] (-415.721) (-417.385) * (-415.168) [-416.326] (-418.831) (-417.703) -- 0:00:24
606500 -- (-416.210) [-419.595] (-415.668) (-416.712) * [-414.952] (-417.419) (-416.620) (-416.187) -- 0:00:24
607000 -- (-421.334) [-415.501] (-415.585) (-417.571) * (-415.377) (-416.785) [-416.299] (-414.988) -- 0:00:23
607500 -- (-417.975) (-415.226) (-416.958) [-418.638] * (-417.831) (-415.582) [-415.452] (-420.228) -- 0:00:23
608000 -- (-415.672) (-419.326) [-418.763] (-417.015) * (-418.920) (-418.762) [-416.420] (-416.321) -- 0:00:23
608500 -- (-415.812) [-419.041] (-417.867) (-419.191) * [-417.075] (-417.230) (-416.981) (-416.002) -- 0:00:23
609000 -- [-416.094] (-419.872) (-416.824) (-418.704) * (-416.135) (-416.101) [-416.977] (-416.680) -- 0:00:23
609500 -- (-418.771) [-415.211] (-416.521) (-420.031) * (-419.912) [-416.565] (-416.500) (-415.346) -- 0:00:23
610000 -- (-418.493) (-416.618) [-418.969] (-417.630) * (-417.195) (-419.211) (-420.379) [-415.469] -- 0:00:23
Average standard deviation of split frequencies: 0.005764
610500 -- (-419.241) [-415.886] (-418.474) (-416.845) * (-416.682) [-419.680] (-417.647) (-420.425) -- 0:00:23
611000 -- (-417.232) (-416.340) [-415.291] (-416.245) * [-415.951] (-417.236) (-416.277) (-416.796) -- 0:00:23
611500 -- (-422.014) [-415.587] (-417.046) (-416.258) * (-417.330) (-416.551) [-420.255] (-421.337) -- 0:00:23
612000 -- [-418.386] (-417.569) (-415.952) (-416.628) * (-416.208) (-416.557) [-417.477] (-418.064) -- 0:00:23
612500 -- [-415.107] (-417.005) (-417.558) (-417.317) * (-415.417) [-415.902] (-415.720) (-418.183) -- 0:00:23
613000 -- [-415.136] (-415.963) (-416.217) (-416.154) * [-415.658] (-415.465) (-416.457) (-415.220) -- 0:00:23
613500 -- (-415.829) [-415.183] (-416.249) (-419.061) * (-417.133) [-415.636] (-416.583) (-415.995) -- 0:00:23
614000 -- (-415.005) (-419.455) (-416.037) [-414.592] * [-416.580] (-417.292) (-418.255) (-416.377) -- 0:00:23
614500 -- (-418.046) [-419.424] (-419.576) (-420.460) * (-416.769) (-419.991) [-416.205] (-415.145) -- 0:00:23
615000 -- (-415.616) [-418.942] (-422.277) (-425.212) * (-416.533) (-418.757) [-416.707] (-414.699) -- 0:00:23
Average standard deviation of split frequencies: 0.005816
615500 -- (-415.513) (-418.993) [-416.286] (-417.255) * (-416.107) (-417.475) (-420.869) [-416.769] -- 0:00:23
616000 -- (-415.344) (-416.276) [-420.299] (-416.004) * (-415.659) [-419.906] (-416.870) (-415.410) -- 0:00:23
616500 -- (-415.517) [-415.825] (-421.175) (-415.054) * (-420.528) (-415.063) (-421.574) [-417.576] -- 0:00:23
617000 -- [-418.523] (-421.062) (-415.812) (-418.947) * (-418.525) (-415.439) [-416.053] (-418.652) -- 0:00:22
617500 -- [-419.443] (-419.714) (-420.694) (-415.147) * (-416.980) (-416.574) (-418.111) [-420.335] -- 0:00:22
618000 -- [-417.225] (-420.562) (-418.421) (-415.816) * [-415.973] (-419.500) (-416.160) (-415.844) -- 0:00:22
618500 -- (-416.868) [-417.746] (-418.035) (-415.564) * (-418.328) (-417.517) [-415.913] (-415.300) -- 0:00:22
619000 -- (-416.678) (-416.978) (-415.388) [-417.735] * (-416.958) (-416.981) [-415.382] (-416.089) -- 0:00:22
619500 -- (-416.401) (-417.858) [-415.202] (-418.033) * (-415.753) (-419.260) [-415.095] (-416.849) -- 0:00:22
620000 -- (-416.649) [-415.323] (-416.209) (-415.940) * (-417.642) (-421.296) [-416.306] (-416.923) -- 0:00:22
Average standard deviation of split frequencies: 0.006228
620500 -- (-421.095) (-415.825) [-415.458] (-416.622) * (-417.785) [-415.188] (-416.491) (-417.043) -- 0:00:23
621000 -- (-417.075) (-415.621) [-417.188] (-422.683) * [-414.978] (-417.086) (-415.963) (-415.748) -- 0:00:23
621500 -- [-416.131] (-419.621) (-416.718) (-416.722) * (-415.355) [-415.988] (-422.654) (-416.747) -- 0:00:23
622000 -- (-417.112) [-422.121] (-416.288) (-418.766) * [-417.306] (-418.330) (-416.244) (-417.408) -- 0:00:23
622500 -- (-416.764) [-416.992] (-416.074) (-416.575) * [-416.430] (-416.616) (-415.030) (-416.886) -- 0:00:23
623000 -- [-418.815] (-416.296) (-421.346) (-416.008) * (-418.160) (-416.545) (-415.791) [-417.380] -- 0:00:22
623500 -- (-417.981) (-415.439) [-415.422] (-415.000) * (-419.322) [-418.185] (-417.410) (-417.063) -- 0:00:22
624000 -- (-415.667) (-415.534) [-419.897] (-415.574) * (-416.256) [-416.839] (-419.234) (-417.495) -- 0:00:22
624500 -- (-415.317) (-415.720) (-419.463) [-416.179] * (-416.520) [-415.556] (-416.068) (-417.426) -- 0:00:22
625000 -- (-414.979) (-415.353) (-417.302) [-417.125] * [-419.492] (-416.393) (-416.602) (-417.366) -- 0:00:22
Average standard deviation of split frequencies: 0.006526
625500 -- (-417.127) (-416.836) [-415.245] (-417.498) * (-417.184) (-419.657) (-416.504) [-417.396] -- 0:00:22
626000 -- (-415.660) [-416.944] (-414.934) (-415.047) * (-419.720) (-417.145) (-418.979) [-415.717] -- 0:00:22
626500 -- [-415.850] (-417.025) (-417.340) (-418.469) * (-417.945) (-416.031) [-415.215] (-418.791) -- 0:00:22
627000 -- (-417.215) (-417.475) (-418.585) [-416.861] * [-416.837] (-417.303) (-415.529) (-417.653) -- 0:00:22
627500 -- [-423.663] (-415.277) (-417.903) (-417.347) * (-415.262) [-416.585] (-417.136) (-414.661) -- 0:00:22
628000 -- (-417.871) (-416.924) [-415.621] (-417.438) * (-415.578) (-418.133) [-416.175] (-415.007) -- 0:00:22
628500 -- [-418.479] (-418.204) (-419.707) (-415.253) * (-421.270) (-419.748) [-416.611] (-416.018) -- 0:00:22
629000 -- [-417.804] (-420.827) (-415.477) (-414.920) * (-417.936) [-417.809] (-418.471) (-417.891) -- 0:00:22
629500 -- (-415.383) (-416.763) (-417.190) [-415.668] * [-414.679] (-417.925) (-421.698) (-415.041) -- 0:00:22
630000 -- [-414.884] (-416.691) (-417.585) (-415.331) * (-416.968) (-418.519) [-416.569] (-416.935) -- 0:00:22
Average standard deviation of split frequencies: 0.006428
630500 -- (-415.455) (-415.981) (-415.904) [-420.052] * (-416.503) [-415.877] (-416.523) (-418.234) -- 0:00:22
631000 -- (-415.056) (-415.807) [-417.316] (-416.950) * [-417.655] (-417.799) (-417.130) (-419.015) -- 0:00:22
631500 -- (-419.670) (-419.306) [-418.941] (-416.374) * [-415.095] (-415.109) (-418.762) (-416.219) -- 0:00:22
632000 -- (-421.224) (-418.341) [-418.519] (-415.869) * (-417.108) [-415.711] (-416.210) (-416.193) -- 0:00:22
632500 -- (-416.084) (-418.947) (-423.473) [-416.343] * (-417.031) (-425.784) [-416.801] (-418.057) -- 0:00:22
633000 -- (-418.809) (-420.611) (-417.284) [-421.459] * (-416.465) [-414.994] (-416.772) (-415.393) -- 0:00:22
633500 -- (-420.801) [-417.080] (-416.838) (-416.291) * [-418.123] (-418.800) (-420.221) (-414.642) -- 0:00:21
634000 -- [-416.260] (-417.903) (-415.573) (-415.879) * (-416.886) (-416.808) (-417.398) [-414.973] -- 0:00:21
634500 -- (-414.935) (-417.766) (-415.857) [-414.679] * (-417.598) [-421.271] (-418.070) (-416.628) -- 0:00:21
635000 -- [-416.044] (-417.359) (-417.213) (-416.645) * [-416.390] (-415.664) (-416.020) (-416.674) -- 0:00:21
Average standard deviation of split frequencies: 0.006770
635500 -- (-417.013) [-414.747] (-421.776) (-420.363) * (-416.871) [-415.522] (-417.787) (-416.714) -- 0:00:21
636000 -- [-416.879] (-420.039) (-416.357) (-415.564) * (-416.277) [-415.967] (-416.149) (-417.719) -- 0:00:21
636500 -- (-419.539) (-418.217) [-418.208] (-416.146) * (-417.653) (-416.640) (-417.990) [-415.655] -- 0:00:21
637000 -- (-417.871) (-418.232) [-416.516] (-416.014) * (-416.467) [-416.414] (-418.140) (-415.802) -- 0:00:21
637500 -- [-417.262] (-416.369) (-416.076) (-416.379) * (-416.090) [-415.952] (-415.329) (-414.699) -- 0:00:22
638000 -- [-414.884] (-418.021) (-416.874) (-416.554) * (-415.959) (-417.238) (-414.597) [-414.577] -- 0:00:22
638500 -- (-415.564) (-417.453) [-415.189] (-414.776) * (-415.980) (-417.002) [-415.682] (-416.898) -- 0:00:22
639000 -- (-417.474) (-416.100) [-416.230] (-418.633) * [-415.231] (-418.604) (-414.473) (-416.793) -- 0:00:22
639500 -- (-414.524) (-415.765) (-415.256) [-415.907] * [-417.533] (-416.238) (-418.742) (-416.854) -- 0:00:21
640000 -- (-417.619) [-418.072] (-416.536) (-415.929) * (-416.192) (-418.479) [-416.677] (-415.603) -- 0:00:21
Average standard deviation of split frequencies: 0.006867
640500 -- (-419.789) [-416.416] (-417.664) (-418.610) * (-417.909) (-417.893) (-417.538) [-415.091] -- 0:00:21
641000 -- (-422.878) [-415.379] (-417.515) (-415.586) * (-416.749) [-417.192] (-420.411) (-415.764) -- 0:00:21
641500 -- (-419.843) (-417.958) (-419.324) [-414.869] * (-415.739) (-420.560) (-420.671) [-416.844] -- 0:00:21
642000 -- (-417.298) (-414.703) (-415.896) [-416.897] * (-417.942) [-414.949] (-416.644) (-416.997) -- 0:00:21
642500 -- [-418.017] (-418.781) (-419.213) (-417.696) * [-416.202] (-416.402) (-417.198) (-418.015) -- 0:00:21
643000 -- (-418.104) [-416.384] (-415.044) (-415.584) * [-414.965] (-418.219) (-420.383) (-417.582) -- 0:00:21
643500 -- (-422.967) [-415.170] (-414.948) (-416.641) * (-417.107) (-417.227) [-417.468] (-420.257) -- 0:00:21
644000 -- (-418.390) (-415.514) [-416.173] (-420.875) * (-423.881) [-421.375] (-416.409) (-417.790) -- 0:00:21
644500 -- (-417.356) [-415.091] (-415.240) (-415.106) * (-415.832) (-417.401) (-416.379) [-416.813] -- 0:00:21
645000 -- [-417.354] (-415.767) (-417.143) (-417.757) * [-420.042] (-416.786) (-415.140) (-416.894) -- 0:00:21
Average standard deviation of split frequencies: 0.007103
645500 -- [-415.202] (-415.935) (-416.320) (-416.057) * (-417.899) [-419.661] (-419.837) (-416.876) -- 0:00:21
646000 -- (-415.984) (-417.956) (-416.787) [-416.828] * (-416.256) (-416.308) [-415.359] (-416.929) -- 0:00:21
646500 -- (-417.058) [-415.541] (-417.021) (-416.325) * (-415.885) (-418.468) (-416.097) [-415.359] -- 0:00:21
647000 -- (-416.669) (-415.407) [-417.452] (-419.007) * [-417.804] (-415.281) (-420.891) (-417.656) -- 0:00:21
647500 -- (-416.282) (-421.264) [-417.198] (-420.871) * (-415.248) (-415.245) (-420.652) [-416.905] -- 0:00:21
648000 -- (-416.506) [-418.319] (-422.403) (-414.895) * (-418.163) (-417.147) (-417.471) [-420.145] -- 0:00:21
648500 -- (-414.858) [-416.388] (-415.270) (-416.023) * (-418.573) (-416.228) [-416.053] (-417.447) -- 0:00:21
649000 -- (-416.104) (-418.023) (-415.500) [-415.013] * [-415.800] (-415.861) (-416.756) (-419.252) -- 0:00:21
649500 -- (-415.041) (-417.603) (-416.030) [-417.741] * (-414.654) (-418.093) (-417.132) [-419.932] -- 0:00:21
650000 -- [-415.687] (-416.518) (-417.546) (-419.266) * [-415.587] (-423.198) (-418.701) (-417.504) -- 0:00:21
Average standard deviation of split frequencies: 0.006810
650500 -- (-416.485) [-418.781] (-417.122) (-417.125) * (-415.966) [-418.080] (-416.947) (-418.398) -- 0:00:20
651000 -- [-417.929] (-417.538) (-419.486) (-418.095) * (-416.378) [-417.911] (-416.750) (-416.286) -- 0:00:20
651500 -- (-417.126) [-416.864] (-417.241) (-415.304) * [-415.774] (-418.757) (-416.968) (-418.603) -- 0:00:20
652000 -- [-416.918] (-415.913) (-415.246) (-416.768) * (-416.077) [-419.017] (-421.793) (-415.185) -- 0:00:20
652500 -- (-426.036) (-416.767) (-415.077) [-417.914] * (-416.929) (-415.345) (-415.933) [-415.764] -- 0:00:20
653000 -- (-417.954) (-416.358) (-415.492) [-418.287] * [-419.394] (-416.021) (-417.994) (-416.310) -- 0:00:20
653500 -- (-415.593) (-416.114) [-416.115] (-417.020) * (-416.415) [-416.884] (-418.189) (-415.416) -- 0:00:20
654000 -- (-415.973) (-417.033) (-417.075) [-416.939] * [-416.355] (-417.225) (-418.134) (-415.037) -- 0:00:21
654500 -- (-414.906) (-417.567) [-417.323] (-418.452) * (-417.438) (-415.741) (-416.176) [-415.672] -- 0:00:21
655000 -- (-414.601) (-416.017) [-417.699] (-418.190) * (-419.452) (-415.762) (-415.111) [-417.570] -- 0:00:21
Average standard deviation of split frequencies: 0.006803
655500 -- (-414.591) (-418.106) (-415.244) [-416.719] * (-416.922) (-418.747) [-414.774] (-416.782) -- 0:00:21
656000 -- (-416.560) (-418.286) (-415.018) [-414.689] * (-417.069) (-418.609) (-418.806) [-417.640] -- 0:00:20
656500 -- (-418.306) (-420.106) (-416.335) [-416.909] * (-416.682) [-416.335] (-415.212) (-415.291) -- 0:00:20
657000 -- (-421.599) [-422.030] (-417.238) (-416.636) * [-418.337] (-418.465) (-417.735) (-418.859) -- 0:00:20
657500 -- (-417.117) (-419.316) [-415.199] (-416.514) * (-419.213) (-419.339) (-415.848) [-417.652] -- 0:00:20
658000 -- (-419.552) [-416.087] (-414.501) (-419.369) * [-416.031] (-421.413) (-415.487) (-417.267) -- 0:00:20
658500 -- (-417.376) [-418.561] (-417.734) (-419.988) * (-419.388) [-418.070] (-417.312) (-415.008) -- 0:00:20
659000 -- (-418.213) [-416.133] (-417.468) (-417.687) * (-416.756) (-418.600) [-415.308] (-414.862) -- 0:00:20
659500 -- (-420.877) [-416.508] (-418.019) (-418.915) * (-416.150) [-414.947] (-420.011) (-414.746) -- 0:00:20
660000 -- (-417.244) (-415.475) (-416.057) [-417.686] * [-415.788] (-415.058) (-418.965) (-416.061) -- 0:00:20
Average standard deviation of split frequencies: 0.006517
660500 -- (-416.362) [-415.530] (-417.116) (-419.014) * [-414.478] (-420.100) (-415.435) (-417.578) -- 0:00:20
661000 -- (-415.221) (-417.762) (-415.821) [-415.325] * (-419.186) (-414.919) (-416.906) [-420.416] -- 0:00:20
661500 -- (-414.656) [-417.299] (-421.998) (-421.820) * (-415.862) [-415.405] (-420.183) (-418.537) -- 0:00:20
662000 -- (-415.602) (-420.452) [-416.787] (-419.606) * (-416.045) (-418.549) [-415.888] (-423.353) -- 0:00:20
662500 -- (-415.026) (-416.636) [-414.491] (-418.346) * (-416.536) (-416.871) [-417.060] (-417.763) -- 0:00:20
663000 -- [-415.860] (-414.557) (-414.590) (-415.985) * [-415.848] (-415.911) (-421.598) (-416.341) -- 0:00:20
663500 -- (-416.833) (-415.960) (-415.829) [-415.433] * (-414.957) [-414.602] (-419.555) (-416.352) -- 0:00:20
664000 -- [-415.669] (-416.915) (-423.897) (-415.680) * (-417.871) (-417.581) (-419.059) [-415.666] -- 0:00:20
664500 -- (-416.074) (-419.946) (-424.514) [-417.627] * (-415.989) (-421.075) [-416.427] (-415.705) -- 0:00:20
665000 -- [-415.065] (-418.089) (-417.911) (-416.130) * (-420.471) (-421.583) [-415.317] (-417.115) -- 0:00:20
Average standard deviation of split frequencies: 0.006937
665500 -- [-415.097] (-420.005) (-420.208) (-420.621) * [-415.325] (-417.957) (-415.934) (-418.163) -- 0:00:20
666000 -- (-415.362) [-418.992] (-418.185) (-419.992) * [-415.017] (-415.859) (-417.245) (-417.014) -- 0:00:20
666500 -- (-415.285) [-417.719] (-417.158) (-418.177) * [-416.309] (-415.270) (-418.792) (-416.753) -- 0:00:20
667000 -- (-416.733) (-416.174) [-416.353] (-418.405) * [-416.462] (-415.395) (-414.821) (-417.032) -- 0:00:19
667500 -- (-417.387) (-417.652) (-415.150) [-414.864] * (-415.510) [-417.230] (-421.579) (-415.778) -- 0:00:19
668000 -- [-415.880] (-417.180) (-416.776) (-417.555) * (-414.674) (-418.013) (-415.861) [-415.061] -- 0:00:19
668500 -- [-418.143] (-416.984) (-416.542) (-419.357) * (-414.614) [-418.894] (-417.231) (-416.291) -- 0:00:19
669000 -- (-418.120) (-415.855) (-417.480) [-422.100] * (-417.527) (-417.948) [-419.764] (-417.367) -- 0:00:19
669500 -- [-417.074] (-417.605) (-416.732) (-422.466) * (-417.261) [-419.791] (-415.174) (-414.961) -- 0:00:20
670000 -- (-418.707) (-416.138) [-417.727] (-415.729) * (-417.020) [-419.293] (-416.044) (-420.677) -- 0:00:20
Average standard deviation of split frequencies: 0.006607
670500 -- (-418.895) [-417.940] (-421.445) (-416.987) * (-416.224) (-415.737) [-417.386] (-416.872) -- 0:00:20
671000 -- (-420.411) (-419.719) [-415.462] (-415.163) * (-420.501) (-416.732) (-415.878) [-417.545] -- 0:00:20
671500 -- (-415.051) (-416.374) (-420.267) [-415.815] * (-417.017) [-416.154] (-415.983) (-414.888) -- 0:00:20
672000 -- (-415.196) (-417.357) (-416.718) [-417.901] * [-418.907] (-415.614) (-417.400) (-418.579) -- 0:00:20
672500 -- (-417.258) (-415.860) (-420.149) [-418.338] * (-416.028) [-414.760] (-419.683) (-421.290) -- 0:00:19
673000 -- [-417.359] (-414.873) (-420.025) (-416.482) * (-418.691) [-415.481] (-417.696) (-417.143) -- 0:00:19
673500 -- [-416.372] (-415.600) (-418.097) (-415.483) * [-415.898] (-419.853) (-415.717) (-416.722) -- 0:00:19
674000 -- (-419.763) (-416.215) (-415.257) [-417.639] * (-415.549) [-422.185] (-416.705) (-422.828) -- 0:00:19
674500 -- [-415.550] (-416.099) (-416.887) (-415.483) * (-420.994) (-418.465) [-415.193] (-415.191) -- 0:00:19
675000 -- (-417.617) [-418.573] (-417.173) (-417.814) * (-415.969) [-416.156] (-419.729) (-421.847) -- 0:00:19
Average standard deviation of split frequencies: 0.006323
675500 -- [-415.867] (-419.578) (-415.680) (-417.209) * [-416.329] (-416.667) (-418.445) (-415.633) -- 0:00:19
676000 -- (-416.374) (-418.878) [-416.044] (-421.706) * (-422.885) (-422.853) [-416.927] (-414.944) -- 0:00:19
676500 -- (-418.275) (-417.241) [-418.184] (-424.181) * [-416.444] (-418.231) (-419.637) (-415.486) -- 0:00:19
677000 -- (-416.297) (-418.017) (-417.354) [-417.478] * (-417.824) (-417.733) [-416.515] (-415.471) -- 0:00:19
677500 -- (-418.326) [-419.096] (-416.469) (-417.645) * (-419.277) (-416.058) [-415.488] (-419.133) -- 0:00:19
678000 -- (-416.586) (-417.156) [-417.748] (-416.262) * [-415.821] (-414.857) (-415.383) (-421.212) -- 0:00:19
678500 -- [-416.669] (-416.954) (-417.458) (-416.382) * (-417.218) (-417.244) (-415.260) [-416.341] -- 0:00:19
679000 -- (-415.700) [-420.119] (-416.492) (-417.601) * [-417.971] (-416.226) (-415.627) (-417.021) -- 0:00:19
679500 -- (-418.181) (-419.382) [-416.923] (-420.931) * [-416.223] (-415.812) (-415.869) (-416.442) -- 0:00:19
680000 -- (-417.726) [-419.965] (-415.125) (-415.462) * (-418.643) (-417.199) (-415.287) [-415.790] -- 0:00:19
Average standard deviation of split frequencies: 0.006418
680500 -- (-417.508) (-417.019) [-417.178] (-415.139) * (-416.898) [-418.506] (-416.662) (-418.766) -- 0:00:19
681000 -- (-417.982) [-416.152] (-415.919) (-415.822) * (-419.148) (-420.733) [-416.700] (-415.291) -- 0:00:19
681500 -- (-416.749) (-416.141) [-417.332] (-416.507) * (-415.794) (-416.695) (-416.279) [-415.517] -- 0:00:19
682000 -- [-416.896] (-416.848) (-417.176) (-421.179) * [-416.126] (-416.971) (-419.902) (-417.623) -- 0:00:19
682500 -- (-416.793) [-418.098] (-418.622) (-415.495) * (-416.526) [-418.691] (-415.752) (-420.541) -- 0:00:19
683000 -- (-415.758) (-418.168) [-414.713] (-416.331) * (-420.347) (-418.976) (-415.873) [-415.937] -- 0:00:19
683500 -- (-416.542) [-414.842] (-414.947) (-416.399) * (-418.108) (-418.973) [-418.261] (-417.315) -- 0:00:18
684000 -- [-420.758] (-415.671) (-416.256) (-418.407) * [-416.681] (-418.170) (-418.158) (-418.541) -- 0:00:18
684500 -- (-417.341) (-416.145) (-414.759) [-416.003] * (-419.558) [-417.633] (-421.633) (-418.639) -- 0:00:19
685000 -- [-415.951] (-416.116) (-419.174) (-415.826) * (-414.764) (-416.233) [-417.429] (-415.772) -- 0:00:19
Average standard deviation of split frequencies: 0.006826
685500 -- (-418.949) (-416.187) (-422.300) [-417.861] * (-415.873) (-416.893) [-415.049] (-420.227) -- 0:00:19
686000 -- (-416.425) [-416.879] (-415.492) (-416.604) * (-416.642) (-415.362) (-414.796) [-416.630] -- 0:00:19
686500 -- [-417.181] (-415.851) (-415.833) (-417.085) * (-415.320) [-416.332] (-415.720) (-415.797) -- 0:00:19
687000 -- (-421.601) (-417.384) [-414.925] (-417.893) * (-414.928) [-416.195] (-415.945) (-415.729) -- 0:00:19
687500 -- (-415.015) (-420.536) [-415.429] (-417.506) * (-417.258) [-416.744] (-415.491) (-420.139) -- 0:00:19
688000 -- (-416.196) [-415.817] (-417.952) (-418.578) * (-415.961) (-420.884) (-417.646) [-423.026] -- 0:00:19
688500 -- (-416.817) (-414.847) (-419.472) [-414.966] * (-421.987) [-415.151] (-418.275) (-420.829) -- 0:00:19
689000 -- (-417.525) (-415.198) (-415.833) [-415.488] * [-418.047] (-414.826) (-417.255) (-420.894) -- 0:00:18
689500 -- (-417.152) (-418.622) [-417.325] (-416.038) * [-415.143] (-419.517) (-415.466) (-416.975) -- 0:00:18
690000 -- (-420.343) [-416.114] (-417.713) (-417.136) * (-415.019) [-417.924] (-415.328) (-416.236) -- 0:00:18
Average standard deviation of split frequencies: 0.007371
690500 -- (-415.953) (-415.466) (-418.519) [-416.968] * (-416.160) (-418.160) (-414.968) [-419.895] -- 0:00:18
691000 -- (-423.277) (-415.546) (-415.190) [-418.036] * [-418.090] (-415.623) (-416.534) (-415.134) -- 0:00:18
691500 -- (-424.458) (-425.908) [-416.160] (-415.393) * (-416.662) (-415.677) [-414.982] (-417.117) -- 0:00:18
692000 -- (-417.517) [-415.574] (-418.941) (-416.489) * (-415.057) (-416.313) (-416.517) [-416.237] -- 0:00:18
692500 -- (-417.696) [-416.229] (-420.491) (-416.819) * [-415.781] (-421.252) (-417.861) (-421.420) -- 0:00:18
693000 -- (-415.811) (-417.045) (-415.851) [-418.343] * (-415.329) (-418.603) (-417.487) [-419.873] -- 0:00:18
693500 -- [-415.194] (-416.319) (-416.681) (-419.031) * [-416.084] (-417.980) (-415.419) (-418.182) -- 0:00:18
694000 -- (-420.981) [-417.547] (-417.988) (-420.094) * (-422.780) [-416.763] (-416.678) (-415.503) -- 0:00:18
694500 -- (-418.829) (-419.262) (-416.170) [-414.930] * [-415.658] (-416.508) (-418.111) (-416.501) -- 0:00:18
695000 -- (-416.054) (-419.431) [-415.093] (-415.445) * (-415.276) (-422.183) [-415.443] (-417.472) -- 0:00:18
Average standard deviation of split frequencies: 0.007496
695500 -- (-424.640) [-418.256] (-416.418) (-417.966) * (-415.549) [-416.222] (-416.305) (-416.011) -- 0:00:18
696000 -- (-416.666) (-419.322) [-418.724] (-421.193) * (-416.299) (-416.356) (-416.332) [-418.024] -- 0:00:18
696500 -- (-416.410) (-419.323) (-415.430) [-414.699] * (-417.833) [-417.070] (-416.361) (-416.125) -- 0:00:18
697000 -- [-418.067] (-418.736) (-415.221) (-421.185) * [-415.981] (-418.036) (-420.790) (-415.678) -- 0:00:18
697500 -- (-415.823) [-417.763] (-414.566) (-417.307) * [-417.772] (-420.641) (-418.766) (-416.392) -- 0:00:18
698000 -- (-416.429) (-417.494) [-421.856] (-417.742) * (-415.029) (-418.261) [-416.448] (-419.966) -- 0:00:18
698500 -- (-416.662) (-416.327) [-416.210] (-416.263) * [-416.256] (-418.705) (-418.749) (-420.856) -- 0:00:18
699000 -- [-417.768] (-419.495) (-415.046) (-416.589) * (-415.312) [-415.534] (-419.948) (-419.309) -- 0:00:18
699500 -- (-420.535) [-415.383] (-414.897) (-418.541) * (-415.786) (-417.354) [-415.574] (-417.280) -- 0:00:18
700000 -- (-416.425) (-416.769) [-418.672] (-421.271) * (-416.032) (-417.531) [-416.443] (-415.694) -- 0:00:18
Average standard deviation of split frequencies: 0.008074
700500 -- [-416.521] (-414.764) (-420.670) (-418.281) * [-418.869] (-419.718) (-417.073) (-417.730) -- 0:00:18
701000 -- (-415.987) (-415.576) (-417.496) [-418.091] * (-418.978) (-422.021) (-420.798) [-417.036] -- 0:00:18
701500 -- (-414.569) (-415.451) [-416.843] (-417.434) * [-416.707] (-421.699) (-415.268) (-419.940) -- 0:00:18
702000 -- (-417.769) (-420.166) (-418.861) [-416.707] * [-417.964] (-416.518) (-417.417) (-415.850) -- 0:00:18
702500 -- (-417.923) [-417.262] (-415.064) (-415.568) * (-418.165) [-417.584] (-415.946) (-418.483) -- 0:00:18
703000 -- [-415.213] (-416.265) (-418.060) (-419.677) * (-414.914) (-418.708) [-416.628] (-417.422) -- 0:00:18
703500 -- [-417.674] (-416.485) (-415.398) (-417.368) * [-415.737] (-421.349) (-417.225) (-416.415) -- 0:00:18
704000 -- [-416.005] (-417.039) (-415.342) (-417.065) * (-415.520) (-417.790) [-417.901] (-419.359) -- 0:00:18
704500 -- (-417.573) (-415.695) (-416.400) [-419.676] * [-418.342] (-415.615) (-415.794) (-420.203) -- 0:00:18
705000 -- (-417.791) [-416.122] (-415.819) (-420.218) * [-418.306] (-418.170) (-416.593) (-417.073) -- 0:00:17
Average standard deviation of split frequencies: 0.008858
705500 -- [-415.228] (-418.236) (-416.448) (-416.840) * [-417.656] (-415.198) (-415.896) (-420.455) -- 0:00:17
706000 -- (-416.341) (-418.226) (-419.570) [-416.678] * (-417.010) (-417.397) [-418.865] (-419.379) -- 0:00:17
706500 -- [-418.220] (-419.355) (-415.209) (-416.320) * (-416.604) (-416.703) (-416.349) [-415.340] -- 0:00:17
707000 -- (-420.481) (-415.721) [-418.812] (-415.777) * (-418.161) (-414.583) (-417.475) [-414.699] -- 0:00:17
707500 -- [-421.186] (-415.057) (-415.827) (-416.896) * (-416.061) [-416.012] (-417.736) (-415.876) -- 0:00:17
708000 -- (-415.480) [-415.198] (-420.326) (-417.427) * [-418.203] (-418.744) (-417.370) (-420.939) -- 0:00:17
708500 -- (-415.583) (-415.550) [-415.050] (-420.085) * [-416.769] (-416.697) (-416.452) (-417.682) -- 0:00:17
709000 -- (-415.981) [-417.010] (-416.962) (-419.807) * (-416.913) (-419.148) (-417.250) [-415.208] -- 0:00:17
709500 -- (-416.572) (-418.941) (-416.042) [-418.748] * [-416.898] (-417.684) (-415.024) (-416.035) -- 0:00:17
710000 -- (-419.257) [-419.011] (-415.324) (-421.504) * (-417.308) [-415.555] (-417.333) (-416.268) -- 0:00:17
Average standard deviation of split frequencies: 0.008844
710500 -- (-418.070) (-422.434) [-415.845] (-415.727) * (-416.611) (-420.685) (-415.756) [-414.903] -- 0:00:17
711000 -- [-415.851] (-415.917) (-414.828) (-419.647) * [-418.343] (-418.511) (-416.466) (-416.833) -- 0:00:17
711500 -- (-416.802) (-415.514) (-415.054) [-417.496] * (-419.719) (-418.721) (-416.186) [-416.762] -- 0:00:17
712000 -- [-421.494] (-415.057) (-417.058) (-416.510) * [-416.233] (-416.766) (-419.500) (-417.783) -- 0:00:17
712500 -- (-417.151) (-416.390) (-416.215) [-416.986] * (-416.807) (-417.082) (-419.250) [-416.170] -- 0:00:17
713000 -- (-417.384) [-415.208] (-415.798) (-416.786) * (-417.332) (-417.107) [-416.029] (-416.813) -- 0:00:17
713500 -- (-419.144) (-415.828) (-415.395) [-418.913] * (-416.949) (-416.652) [-415.321] (-416.392) -- 0:00:17
714000 -- (-415.485) [-419.318] (-418.399) (-417.007) * (-416.212) [-417.258] (-418.124) (-417.764) -- 0:00:17
714500 -- [-416.392] (-416.985) (-417.747) (-415.622) * [-415.888] (-418.209) (-414.940) (-418.147) -- 0:00:17
715000 -- (-415.116) [-417.407] (-417.360) (-416.769) * [-415.309] (-415.701) (-415.790) (-416.717) -- 0:00:17
Average standard deviation of split frequencies: 0.009130
715500 -- (-420.514) (-417.594) (-418.628) [-415.832] * [-416.584] (-414.695) (-417.701) (-416.013) -- 0:00:17
716000 -- (-415.854) (-417.103) [-415.754] (-419.387) * (-419.353) (-421.561) (-417.963) [-420.572] -- 0:00:17
716500 -- (-416.062) (-418.280) (-415.098) [-417.572] * (-418.578) [-417.697] (-414.446) (-419.831) -- 0:00:17
717000 -- (-416.077) (-415.392) (-418.121) [-416.455] * (-417.740) (-417.036) [-415.776] (-415.152) -- 0:00:17
717500 -- [-416.311] (-416.021) (-417.485) (-415.491) * (-418.106) (-419.671) [-416.018] (-418.322) -- 0:00:17
718000 -- (-416.908) [-417.337] (-416.880) (-416.141) * (-417.939) (-418.406) [-416.960] (-422.745) -- 0:00:17
718500 -- (-417.039) [-417.512] (-417.620) (-415.749) * [-418.493] (-422.666) (-416.238) (-418.085) -- 0:00:17
719000 -- (-417.468) [-418.097] (-414.840) (-415.338) * (-416.424) (-415.724) [-418.550] (-417.341) -- 0:00:17
719500 -- (-417.235) [-422.334] (-415.988) (-417.128) * (-415.964) [-414.752] (-417.374) (-415.800) -- 0:00:17
720000 -- (-417.486) (-417.490) [-414.871] (-415.540) * [-418.508] (-415.918) (-416.258) (-417.259) -- 0:00:17
Average standard deviation of split frequencies: 0.008678
720500 -- [-417.141] (-418.245) (-415.023) (-415.463) * (-416.507) (-420.394) (-417.114) [-415.285] -- 0:00:17
721000 -- (-416.913) [-415.445] (-417.562) (-415.665) * (-416.586) (-420.633) (-418.081) [-414.795] -- 0:00:17
721500 -- (-418.507) [-415.084] (-416.522) (-418.696) * (-418.963) [-420.634] (-415.981) (-414.989) -- 0:00:16
722000 -- (-418.347) (-415.044) (-417.604) [-416.864] * [-426.430] (-419.827) (-420.851) (-418.120) -- 0:00:16
722500 -- [-416.859] (-416.657) (-416.356) (-420.418) * [-423.262] (-415.304) (-416.264) (-415.655) -- 0:00:16
723000 -- [-415.155] (-418.904) (-418.099) (-416.931) * (-419.805) [-415.262] (-420.719) (-418.072) -- 0:00:16
723500 -- (-418.116) [-415.274] (-418.840) (-416.989) * [-416.604] (-416.826) (-418.147) (-416.687) -- 0:00:16
724000 -- (-417.717) (-421.638) (-415.563) [-415.184] * (-418.363) (-416.142) (-416.508) [-414.663] -- 0:00:16
724500 -- (-420.193) (-423.307) [-415.604] (-414.786) * (-417.644) (-415.256) [-415.795] (-415.428) -- 0:00:16
725000 -- [-417.397] (-419.470) (-418.229) (-416.189) * (-416.616) [-415.841] (-418.747) (-417.910) -- 0:00:16
Average standard deviation of split frequencies: 0.008268
725500 -- (-419.010) (-419.272) [-418.822] (-415.298) * (-416.372) (-418.053) (-418.579) [-421.016] -- 0:00:16
726000 -- (-419.910) (-414.525) [-418.245] (-415.656) * [-415.312] (-417.112) (-415.956) (-421.557) -- 0:00:16
726500 -- (-417.419) [-416.679] (-415.032) (-418.660) * (-416.867) (-417.263) [-416.297] (-420.230) -- 0:00:16
727000 -- (-416.295) (-415.103) (-415.999) [-415.542] * (-417.076) (-419.021) [-415.985] (-419.544) -- 0:00:16
727500 -- [-416.904] (-415.795) (-420.520) (-414.823) * (-419.038) (-415.878) (-416.571) [-415.879] -- 0:00:16
728000 -- (-419.353) (-420.091) (-417.474) [-415.272] * (-416.201) [-415.052] (-418.020) (-416.279) -- 0:00:16
728500 -- (-418.224) (-420.217) [-418.046] (-418.094) * (-415.981) (-415.525) (-418.794) [-415.441] -- 0:00:16
729000 -- (-417.661) [-418.079] (-416.029) (-417.685) * (-419.723) [-416.492] (-415.371) (-415.972) -- 0:00:16
729500 -- (-418.642) (-415.616) [-416.685] (-419.872) * (-417.945) (-416.707) [-414.834] (-417.394) -- 0:00:16
730000 -- (-417.885) (-416.742) [-415.687] (-415.001) * (-418.453) [-417.886] (-415.002) (-416.507) -- 0:00:16
Average standard deviation of split frequencies: 0.008344
730500 -- (-417.406) (-415.998) (-416.008) [-415.113] * (-416.123) (-420.725) [-415.947] (-416.305) -- 0:00:16
731000 -- [-417.369] (-415.220) (-418.053) (-420.263) * [-417.834] (-417.298) (-422.803) (-417.084) -- 0:00:16
731500 -- (-418.996) (-418.147) [-416.704] (-416.790) * (-415.158) [-414.933] (-415.783) (-415.018) -- 0:00:16
732000 -- [-415.813] (-416.288) (-417.997) (-416.382) * (-415.285) [-416.426] (-414.964) (-417.432) -- 0:00:16
732500 -- (-420.496) (-416.006) (-418.666) [-417.583] * (-416.236) [-417.770] (-415.992) (-415.299) -- 0:00:16
733000 -- [-416.636] (-417.487) (-417.008) (-418.840) * (-414.787) [-417.632] (-416.524) (-416.253) -- 0:00:16
733500 -- (-417.738) (-421.376) [-416.722] (-417.210) * [-418.240] (-417.536) (-416.378) (-416.363) -- 0:00:16
734000 -- (-416.257) (-416.093) (-417.759) [-422.495] * [-415.098] (-421.484) (-416.542) (-416.860) -- 0:00:16
734500 -- (-417.488) [-416.063] (-417.764) (-417.101) * (-417.357) [-418.040] (-414.540) (-415.970) -- 0:00:16
735000 -- (-416.565) (-415.195) [-420.509] (-418.629) * (-415.323) (-418.700) [-415.039] (-415.383) -- 0:00:16
Average standard deviation of split frequencies: 0.008070
735500 -- (-414.804) (-419.048) [-416.182] (-416.275) * (-415.732) (-415.966) [-416.812] (-415.495) -- 0:00:16
736000 -- (-415.548) (-418.367) (-416.058) [-416.929] * (-417.041) [-415.428] (-419.938) (-418.140) -- 0:00:16
736500 -- [-416.624] (-417.811) (-416.960) (-418.885) * (-417.174) [-415.883] (-417.911) (-418.827) -- 0:00:16
737000 -- (-423.622) [-419.232] (-414.867) (-417.571) * (-417.277) (-415.601) [-417.396] (-415.617) -- 0:00:16
737500 -- (-420.118) (-417.213) (-414.827) [-415.883] * (-415.706) [-416.698] (-417.546) (-416.592) -- 0:00:16
738000 -- (-416.255) (-415.136) [-416.905] (-415.991) * [-416.746] (-417.771) (-416.419) (-415.218) -- 0:00:15
738500 -- (-421.147) (-415.625) [-417.884] (-420.098) * (-418.224) (-418.156) (-415.121) [-418.035] -- 0:00:15
739000 -- (-417.352) [-414.919] (-414.981) (-415.605) * [-417.341] (-418.320) (-416.821) (-422.206) -- 0:00:15
739500 -- [-416.516] (-416.057) (-420.245) (-416.562) * [-422.211] (-416.935) (-417.177) (-418.181) -- 0:00:15
740000 -- (-417.822) (-416.452) [-416.262] (-415.560) * [-416.025] (-416.278) (-417.167) (-416.417) -- 0:00:15
Average standard deviation of split frequencies: 0.008019
740500 -- (-415.013) (-417.581) [-418.292] (-419.921) * (-416.465) (-420.502) [-415.518] (-416.234) -- 0:00:15
741000 -- (-418.271) (-417.458) (-417.478) [-421.780] * (-415.342) (-421.073) [-415.920] (-417.867) -- 0:00:15
741500 -- (-419.231) (-419.138) (-416.479) [-417.831] * [-417.026] (-415.766) (-415.421) (-416.299) -- 0:00:15
742000 -- [-419.093] (-418.004) (-415.693) (-416.536) * [-415.123] (-414.943) (-415.176) (-415.437) -- 0:00:15
742500 -- (-417.351) [-418.330] (-420.579) (-418.428) * (-419.309) (-415.844) (-419.416) [-415.183] -- 0:00:15
743000 -- (-418.492) (-416.959) [-418.532] (-417.737) * (-418.550) (-416.540) [-417.555] (-419.267) -- 0:00:15
743500 -- [-416.849] (-417.347) (-416.661) (-423.287) * (-420.531) [-415.438] (-416.129) (-418.963) -- 0:00:15
744000 -- (-417.223) [-414.997] (-418.805) (-416.747) * (-419.594) [-416.983] (-415.337) (-416.280) -- 0:00:15
744500 -- (-417.834) (-415.555) [-420.228] (-419.435) * (-416.260) (-416.229) (-415.950) [-416.735] -- 0:00:15
745000 -- (-416.825) (-415.139) (-417.863) [-416.438] * (-415.495) (-416.209) [-417.788] (-414.963) -- 0:00:15
Average standard deviation of split frequencies: 0.007667
745500 -- (-416.451) (-415.380) (-422.135) [-416.784] * [-416.753] (-416.452) (-416.710) (-420.049) -- 0:00:15
746000 -- (-418.125) [-420.119] (-418.692) (-419.876) * [-419.049] (-419.497) (-416.496) (-419.453) -- 0:00:15
746500 -- (-416.954) (-417.216) [-417.923] (-419.990) * (-416.614) (-420.676) [-424.548] (-419.816) -- 0:00:15
747000 -- (-418.910) [-417.344] (-417.122) (-423.223) * [-417.709] (-416.143) (-417.346) (-417.968) -- 0:00:15
747500 -- [-418.123] (-419.029) (-416.601) (-417.483) * (-415.117) (-416.231) [-414.680] (-415.738) -- 0:00:15
748000 -- (-417.879) (-415.636) (-419.426) [-414.788] * [-415.770] (-414.910) (-416.640) (-419.776) -- 0:00:15
748500 -- (-415.395) [-417.132] (-417.871) (-416.628) * (-415.618) [-418.879] (-416.586) (-419.475) -- 0:00:15
749000 -- (-418.842) [-417.420] (-416.000) (-414.596) * (-416.829) (-417.194) [-415.164] (-415.048) -- 0:00:15
749500 -- (-416.907) (-417.007) (-417.826) [-415.348] * (-416.137) (-416.970) [-416.979] (-416.104) -- 0:00:15
750000 -- [-416.573] (-420.365) (-417.000) (-415.271) * (-420.686) (-420.683) [-416.890] (-417.126) -- 0:00:15
Average standard deviation of split frequencies: 0.007913
750500 -- (-416.781) [-415.374] (-415.833) (-416.227) * [-416.695] (-417.502) (-418.302) (-417.338) -- 0:00:15
751000 -- (-416.206) (-415.094) [-415.403] (-414.916) * (-416.633) (-416.537) (-422.003) [-416.166] -- 0:00:15
751500 -- (-417.198) [-416.834] (-416.074) (-415.734) * (-414.918) [-415.960] (-416.350) (-417.497) -- 0:00:15
752000 -- (-417.702) (-417.795) [-415.695] (-416.266) * (-416.373) (-418.311) [-414.716] (-421.178) -- 0:00:15
752500 -- (-417.562) (-415.666) [-414.850] (-417.339) * [-416.667] (-417.356) (-421.779) (-419.650) -- 0:00:15
753000 -- [-416.333] (-415.070) (-417.922) (-416.778) * (-415.728) [-419.025] (-415.377) (-416.402) -- 0:00:15
753500 -- (-415.705) (-416.036) (-420.713) [-417.668] * [-416.494] (-417.612) (-417.799) (-414.826) -- 0:00:15
754000 -- [-417.083] (-419.447) (-417.021) (-416.922) * [-416.776] (-415.860) (-417.095) (-415.211) -- 0:00:15
754500 -- [-417.139] (-418.343) (-416.838) (-420.258) * (-416.421) [-415.580] (-420.382) (-415.342) -- 0:00:14
755000 -- (-420.168) (-418.664) (-420.256) [-415.724] * [-419.562] (-422.091) (-417.950) (-417.757) -- 0:00:14
Average standard deviation of split frequencies: 0.007649
755500 -- [-421.842] (-419.790) (-415.352) (-415.190) * (-421.003) [-420.288] (-415.145) (-415.907) -- 0:00:14
756000 -- (-418.055) (-419.719) (-417.086) [-417.844] * (-420.040) (-414.704) [-416.826] (-416.587) -- 0:00:14
756500 -- (-417.988) (-417.638) [-415.714] (-415.935) * [-415.955] (-417.641) (-416.678) (-418.084) -- 0:00:14
757000 -- (-419.300) [-417.632] (-416.423) (-418.397) * (-417.466) (-416.744) (-416.355) [-415.544] -- 0:00:14
757500 -- (-417.087) (-416.294) [-417.507] (-419.003) * (-415.732) (-419.849) (-415.674) [-416.511] -- 0:00:14
758000 -- [-416.364] (-418.855) (-417.933) (-417.936) * (-417.143) (-418.113) (-416.621) [-415.942] -- 0:00:14
758500 -- (-416.709) (-420.149) (-417.379) [-416.653] * (-418.290) [-416.362] (-416.818) (-415.379) -- 0:00:14
759000 -- (-416.882) [-414.731] (-417.718) (-416.705) * (-415.983) [-418.377] (-417.391) (-419.579) -- 0:00:14
759500 -- [-415.769] (-417.224) (-416.237) (-420.029) * (-418.073) (-417.033) [-415.474] (-414.449) -- 0:00:14
760000 -- (-416.964) (-414.672) (-421.019) [-416.394] * (-417.509) (-416.362) (-416.958) [-415.790] -- 0:00:14
Average standard deviation of split frequencies: 0.007850
760500 -- (-416.083) [-415.833] (-419.106) (-420.159) * (-416.288) (-417.136) (-419.009) [-416.970] -- 0:00:14
761000 -- [-417.402] (-415.315) (-415.490) (-416.028) * (-420.646) [-416.816] (-415.485) (-418.220) -- 0:00:14
761500 -- (-418.077) (-416.772) [-417.178] (-423.095) * (-419.674) [-415.169] (-418.744) (-420.505) -- 0:00:14
762000 -- (-418.473) (-417.041) [-416.569] (-416.509) * (-415.717) [-414.779] (-419.945) (-418.144) -- 0:00:14
762500 -- (-419.547) (-420.304) [-415.676] (-417.459) * (-414.908) (-415.377) [-417.201] (-417.138) -- 0:00:14
763000 -- (-415.505) (-420.755) [-417.950] (-414.476) * (-419.127) [-415.137] (-416.203) (-416.728) -- 0:00:14
763500 -- [-420.412] (-420.880) (-415.510) (-419.547) * (-416.820) [-415.565] (-416.053) (-414.855) -- 0:00:14
764000 -- (-416.939) (-417.199) (-418.432) [-417.686] * [-415.209] (-415.483) (-415.488) (-414.825) -- 0:00:14
764500 -- (-415.589) (-419.965) (-416.563) [-416.016] * (-417.061) (-419.917) (-417.843) [-415.661] -- 0:00:14
765000 -- [-416.362] (-415.264) (-415.812) (-417.738) * (-416.655) (-416.520) (-416.679) [-417.729] -- 0:00:14
Average standard deviation of split frequencies: 0.008116
765500 -- [-415.693] (-415.383) (-417.113) (-416.612) * (-416.415) (-416.214) (-416.192) [-418.157] -- 0:00:14
766000 -- (-415.770) (-417.399) [-415.987] (-418.074) * (-416.851) [-419.906] (-417.046) (-420.648) -- 0:00:14
766500 -- (-419.426) (-415.924) [-415.685] (-418.060) * (-416.738) (-418.060) (-424.303) [-417.711] -- 0:00:14
767000 -- [-419.603] (-415.738) (-416.799) (-415.754) * (-414.590) (-415.248) [-416.059] (-416.048) -- 0:00:14
767500 -- (-418.627) (-418.093) (-421.931) [-415.260] * (-415.203) (-416.062) [-414.888] (-419.131) -- 0:00:14
768000 -- (-418.321) (-418.045) (-420.344) [-417.234] * [-414.994] (-416.347) (-415.089) (-418.354) -- 0:00:14
768500 -- (-415.788) (-419.013) (-421.156) [-415.576] * (-416.604) [-416.449] (-415.324) (-418.796) -- 0:00:14
769000 -- (-415.361) (-421.567) (-426.568) [-417.786] * (-417.969) [-419.676] (-416.518) (-419.646) -- 0:00:14
769500 -- (-418.723) (-418.643) (-416.765) [-415.022] * [-419.041] (-415.527) (-419.812) (-416.428) -- 0:00:14
770000 -- (-417.023) (-416.998) (-418.260) [-416.009] * [-414.813] (-420.557) (-415.100) (-419.609) -- 0:00:14
Average standard deviation of split frequencies: 0.007952
770500 -- (-417.330) (-415.506) (-416.380) [-415.429] * [-414.620] (-416.305) (-419.216) (-418.383) -- 0:00:13
771000 -- (-415.944) [-417.030] (-420.109) (-417.027) * (-416.053) [-416.797] (-414.996) (-417.436) -- 0:00:13
771500 -- [-416.864] (-416.777) (-416.848) (-419.430) * [-417.096] (-416.868) (-416.048) (-415.592) -- 0:00:13
772000 -- (-416.272) [-416.502] (-417.140) (-417.946) * (-416.514) (-418.783) [-417.167] (-417.750) -- 0:00:13
772500 -- [-416.905] (-419.602) (-416.689) (-428.280) * (-416.168) [-417.652] (-415.899) (-417.972) -- 0:00:13
773000 -- (-415.715) (-416.941) [-418.051] (-417.813) * (-418.891) (-417.418) (-418.098) [-417.311] -- 0:00:13
773500 -- (-416.332) (-418.710) (-417.228) [-416.976] * [-417.247] (-417.461) (-420.220) (-419.629) -- 0:00:13
774000 -- (-416.298) (-419.698) [-418.526] (-419.102) * (-421.407) (-415.038) [-417.978] (-416.416) -- 0:00:13
774500 -- (-417.204) [-418.083] (-415.209) (-418.423) * (-423.497) [-419.423] (-418.710) (-417.772) -- 0:00:13
775000 -- (-417.631) (-418.771) [-415.156] (-415.980) * [-420.201] (-415.924) (-415.828) (-417.283) -- 0:00:13
Average standard deviation of split frequencies: 0.008059
775500 -- (-417.632) (-418.804) (-417.185) [-414.932] * [-421.319] (-415.597) (-417.903) (-421.268) -- 0:00:13
776000 -- [-417.344] (-419.836) (-416.509) (-418.129) * (-417.519) (-416.404) (-417.953) [-416.847] -- 0:00:13
776500 -- (-417.274) (-416.915) (-416.293) [-420.518] * (-415.116) [-416.577] (-416.075) (-418.018) -- 0:00:13
777000 -- [-420.468] (-416.317) (-420.503) (-417.330) * (-416.534) [-421.592] (-416.667) (-415.471) -- 0:00:13
777500 -- (-417.394) (-417.450) [-420.627] (-416.628) * (-416.903) (-418.598) [-418.884] (-416.133) -- 0:00:13
778000 -- (-417.445) (-414.921) (-417.000) [-416.589] * (-415.531) [-418.583] (-416.513) (-418.867) -- 0:00:13
778500 -- (-416.795) (-415.918) [-414.797] (-416.283) * [-416.921] (-419.919) (-415.207) (-415.953) -- 0:00:13
779000 -- (-417.373) (-418.695) (-417.073) [-419.718] * (-419.187) (-424.681) (-418.582) [-416.836] -- 0:00:13
779500 -- (-416.519) (-416.356) [-418.291] (-416.259) * (-420.484) [-416.275] (-416.096) (-416.851) -- 0:00:13
780000 -- [-417.886] (-418.031) (-417.676) (-417.054) * (-417.482) [-415.173] (-416.032) (-417.666) -- 0:00:13
Average standard deviation of split frequencies: 0.008341
780500 -- (-418.314) (-414.689) (-416.138) [-415.556] * (-418.745) (-415.178) [-415.754] (-420.308) -- 0:00:13
781000 -- (-417.669) (-414.628) (-421.217) [-417.687] * (-415.941) (-415.140) [-417.183] (-414.811) -- 0:00:13
781500 -- (-417.075) [-415.360] (-416.013) (-418.258) * [-415.354] (-417.851) (-417.784) (-417.041) -- 0:00:13
782000 -- [-416.865] (-417.460) (-416.391) (-417.226) * [-414.787] (-420.358) (-420.060) (-417.898) -- 0:00:13
782500 -- (-417.390) [-416.206] (-415.570) (-417.377) * [-416.036] (-420.951) (-421.389) (-417.682) -- 0:00:13
783000 -- [-416.875] (-415.681) (-415.596) (-419.199) * (-414.639) [-419.841] (-415.753) (-419.497) -- 0:00:13
783500 -- [-415.906] (-415.118) (-415.996) (-417.300) * (-416.648) (-417.682) (-415.448) [-415.044] -- 0:00:13
784000 -- (-415.620) (-416.602) (-414.825) [-416.346] * (-416.744) (-415.616) (-415.475) [-418.169] -- 0:00:13
784500 -- (-417.778) (-415.201) (-417.069) [-418.394] * [-417.298] (-420.677) (-417.114) (-416.105) -- 0:00:13
785000 -- (-415.120) [-415.499] (-416.907) (-422.313) * (-422.379) (-417.650) (-417.347) [-418.525] -- 0:00:13
Average standard deviation of split frequencies: 0.008172
785500 -- [-416.747] (-415.984) (-415.797) (-420.400) * (-415.772) [-415.587] (-414.846) (-418.292) -- 0:00:13
786000 -- [-415.122] (-420.227) (-418.385) (-416.778) * [-415.784] (-417.461) (-415.974) (-419.293) -- 0:00:13
786500 -- (-415.409) (-417.976) [-416.910] (-414.925) * (-417.033) (-415.912) [-426.560] (-417.027) -- 0:00:13
787000 -- (-420.664) (-419.081) [-415.160] (-417.046) * [-418.067] (-416.623) (-419.268) (-416.387) -- 0:00:12
787500 -- (-419.335) [-416.859] (-419.282) (-420.572) * (-416.971) (-415.359) [-416.281] (-415.229) -- 0:00:12
788000 -- [-417.213] (-415.073) (-421.051) (-420.082) * (-415.982) (-417.207) (-422.867) [-414.761] -- 0:00:12
788500 -- (-417.760) (-421.528) [-415.073] (-418.741) * (-417.839) [-416.426] (-416.009) (-415.609) -- 0:00:12
789000 -- (-417.874) (-424.785) [-414.943] (-417.392) * (-414.781) [-414.840] (-416.440) (-415.581) -- 0:00:12
789500 -- (-418.514) (-416.410) [-416.805] (-415.618) * [-415.220] (-416.638) (-419.862) (-421.584) -- 0:00:12
790000 -- (-417.595) (-418.566) [-414.985] (-415.483) * (-418.215) [-415.490] (-417.154) (-416.790) -- 0:00:12
Average standard deviation of split frequencies: 0.008161
790500 -- (-417.565) [-415.758] (-416.534) (-417.347) * (-417.055) [-416.585] (-416.355) (-415.970) -- 0:00:12
791000 -- (-417.201) [-416.648] (-419.070) (-418.067) * (-415.645) (-415.970) [-416.907] (-416.322) -- 0:00:12
791500 -- (-416.554) (-419.106) [-417.694] (-414.979) * (-419.052) (-417.709) (-416.558) [-419.173] -- 0:00:12
792000 -- (-415.062) (-417.378) (-416.883) [-415.061] * (-416.473) (-416.349) [-415.775] (-418.228) -- 0:00:12
792500 -- (-416.084) [-415.963] (-417.057) (-416.920) * (-417.229) [-416.566] (-416.403) (-416.758) -- 0:00:12
793000 -- (-416.755) (-417.268) (-416.139) [-419.679] * (-418.282) (-415.746) [-415.792] (-417.925) -- 0:00:12
793500 -- (-420.190) [-415.513] (-417.579) (-419.245) * [-417.998] (-416.291) (-415.956) (-417.265) -- 0:00:12
794000 -- [-420.505] (-416.266) (-415.329) (-415.198) * [-419.804] (-416.989) (-415.441) (-418.729) -- 0:00:12
794500 -- (-417.792) (-418.638) (-415.638) [-414.941] * (-419.404) (-417.239) [-414.869] (-417.629) -- 0:00:12
795000 -- [-415.340] (-418.899) (-416.214) (-415.876) * (-415.999) (-421.830) (-418.852) [-415.980] -- 0:00:12
Average standard deviation of split frequencies: 0.008180
795500 -- (-415.559) (-418.884) (-415.528) [-415.608] * (-416.747) (-419.128) [-416.864] (-415.259) -- 0:00:12
796000 -- (-416.528) (-417.410) (-419.058) [-414.572] * (-417.316) (-417.277) [-418.970] (-415.530) -- 0:00:12
796500 -- (-417.670) (-417.416) (-415.222) [-418.826] * (-416.228) (-414.997) [-421.407] (-418.766) -- 0:00:12
797000 -- (-416.168) (-415.455) [-417.162] (-415.269) * [-420.910] (-419.446) (-422.037) (-416.466) -- 0:00:12
797500 -- (-416.922) (-420.379) [-418.318] (-415.314) * (-422.553) (-417.255) (-420.238) [-419.266] -- 0:00:12
798000 -- (-417.450) (-420.901) [-415.711] (-417.398) * (-419.849) [-414.854] (-415.370) (-425.173) -- 0:00:12
798500 -- (-414.877) (-416.028) [-414.965] (-417.509) * (-417.781) [-414.646] (-420.127) (-421.968) -- 0:00:12
799000 -- (-417.623) [-415.729] (-417.073) (-419.422) * (-419.442) (-415.377) (-417.590) [-416.657] -- 0:00:12
799500 -- (-416.935) (-415.888) (-419.528) [-415.644] * (-417.035) (-419.554) (-416.567) [-414.816] -- 0:00:12
800000 -- (-416.290) [-417.451] (-418.626) (-420.752) * (-419.652) [-417.574] (-415.381) (-416.075) -- 0:00:12
Average standard deviation of split frequencies: 0.008316
800500 -- [-418.773] (-419.384) (-419.215) (-419.227) * (-418.421) (-415.338) (-416.924) [-419.572] -- 0:00:12
801000 -- (-419.409) (-419.473) [-417.793] (-417.047) * (-416.487) (-418.774) (-416.340) [-419.887] -- 0:00:12
801500 -- (-419.496) [-415.389] (-418.897) (-419.545) * (-415.426) [-419.641] (-416.188) (-417.803) -- 0:00:12
802000 -- (-421.404) (-415.175) (-419.325) [-418.725] * (-415.645) (-415.380) [-415.597] (-416.722) -- 0:00:12
802500 -- (-415.997) (-416.991) (-420.124) [-415.871] * (-417.819) (-415.789) (-417.148) [-416.804] -- 0:00:12
803000 -- (-416.419) (-415.921) [-416.709] (-415.727) * (-417.772) (-415.166) [-417.622] (-426.547) -- 0:00:12
803500 -- (-418.855) (-414.681) (-417.535) [-419.470] * (-416.807) (-417.551) [-419.078] (-417.388) -- 0:00:11
804000 -- (-419.894) (-415.895) (-415.179) [-415.415] * (-415.281) (-416.691) (-418.204) [-418.962] -- 0:00:11
804500 -- [-420.407] (-417.936) (-421.826) (-416.352) * (-415.076) (-420.707) (-417.062) [-416.835] -- 0:00:11
805000 -- (-423.198) [-415.424] (-415.382) (-416.272) * (-417.404) (-417.392) (-420.131) [-415.942] -- 0:00:11
Average standard deviation of split frequencies: 0.008700
805500 -- (-418.546) [-415.187] (-414.919) (-421.856) * (-415.114) (-417.474) [-419.139] (-416.130) -- 0:00:11
806000 -- [-416.550] (-419.607) (-420.006) (-415.882) * (-415.970) (-415.157) [-417.882] (-416.095) -- 0:00:11
806500 -- (-419.019) (-418.905) [-415.366] (-418.089) * (-414.411) [-416.364] (-416.125) (-418.033) -- 0:00:11
807000 -- (-417.070) (-417.466) [-417.001] (-420.134) * (-416.351) [-420.314] (-414.986) (-416.768) -- 0:00:11
807500 -- (-414.948) (-425.171) [-416.189] (-416.268) * (-417.822) (-414.965) (-415.389) [-415.391] -- 0:00:11
808000 -- (-415.458) (-420.278) (-416.439) [-416.140] * (-416.294) (-415.085) [-416.515] (-416.178) -- 0:00:11
808500 -- (-416.493) [-415.540] (-414.990) (-419.971) * [-416.024] (-415.045) (-417.782) (-417.246) -- 0:00:11
809000 -- (-417.683) (-421.931) (-416.711) [-416.248] * (-415.945) [-416.660] (-422.307) (-415.751) -- 0:00:11
809500 -- [-416.852] (-416.384) (-415.398) (-417.197) * (-416.254) (-416.880) [-418.334] (-415.972) -- 0:00:11
810000 -- (-415.980) [-415.328] (-419.264) (-416.960) * (-416.516) [-416.238] (-416.521) (-416.855) -- 0:00:11
Average standard deviation of split frequencies: 0.009195
810500 -- (-418.589) (-418.484) [-420.605] (-417.364) * (-418.664) (-417.855) [-415.188] (-417.979) -- 0:00:11
811000 -- (-420.450) (-419.339) (-415.799) [-415.352] * (-419.256) (-417.536) [-415.678] (-415.057) -- 0:00:11
811500 -- (-416.147) (-420.612) [-414.726] (-415.132) * [-418.831] (-419.374) (-415.756) (-417.388) -- 0:00:11
812000 -- (-416.678) [-417.655] (-416.512) (-419.112) * (-416.438) [-416.067] (-417.245) (-415.763) -- 0:00:11
812500 -- (-420.126) [-420.058] (-417.102) (-417.688) * (-416.627) (-417.892) [-418.031] (-414.926) -- 0:00:11
813000 -- [-414.707] (-417.345) (-415.442) (-419.221) * (-418.624) [-417.829] (-415.240) (-415.059) -- 0:00:11
813500 -- (-416.020) (-418.074) [-414.863] (-418.773) * (-416.423) (-418.984) [-415.388] (-416.421) -- 0:00:11
814000 -- (-416.914) (-416.443) (-415.044) [-418.725] * [-415.828] (-416.063) (-415.613) (-418.814) -- 0:00:11
814500 -- (-417.323) [-418.673] (-422.152) (-417.500) * (-415.554) [-415.939] (-415.726) (-418.463) -- 0:00:11
815000 -- (-415.918) [-415.549] (-415.303) (-417.759) * (-418.113) (-416.122) (-415.426) [-416.504] -- 0:00:11
Average standard deviation of split frequencies: 0.009243
815500 -- (-415.132) (-417.179) (-417.219) [-416.984] * (-417.944) [-417.425] (-419.532) (-415.505) -- 0:00:11
816000 -- [-416.753] (-416.596) (-417.011) (-418.374) * (-416.639) (-417.500) [-419.106] (-415.596) -- 0:00:11
816500 -- (-418.533) (-416.352) [-415.825] (-417.762) * (-422.639) (-418.077) [-417.453] (-418.818) -- 0:00:11
817000 -- (-414.462) (-416.122) (-418.693) [-416.565] * (-421.304) [-417.866] (-423.393) (-417.241) -- 0:00:11
817500 -- [-415.823] (-415.097) (-418.014) (-415.018) * (-425.418) (-420.409) (-419.519) [-419.946] -- 0:00:11
818000 -- (-416.682) (-415.911) (-416.881) [-415.779] * (-415.646) (-425.782) (-418.814) [-416.739] -- 0:00:11
818500 -- (-419.432) [-418.105] (-419.411) (-416.280) * (-418.272) (-415.174) [-414.630] (-415.764) -- 0:00:11
819000 -- (-422.552) (-419.621) [-416.960] (-418.244) * (-420.380) (-415.228) (-420.437) [-416.235] -- 0:00:11
819500 -- [-416.868] (-417.817) (-417.022) (-417.967) * (-418.833) (-415.423) (-415.827) [-415.809] -- 0:00:11
820000 -- (-417.312) (-420.501) (-419.634) [-416.925] * (-421.368) (-417.883) (-420.283) [-414.802] -- 0:00:10
Average standard deviation of split frequencies: 0.009693
820500 -- [-416.034] (-419.288) (-419.234) (-416.999) * (-420.204) (-418.941) [-415.264] (-414.524) -- 0:00:10
821000 -- (-418.410) (-417.224) [-416.692] (-418.037) * [-415.343] (-420.029) (-416.418) (-416.188) -- 0:00:10
821500 -- (-418.287) (-416.803) [-416.491] (-418.681) * (-415.404) (-416.062) [-416.167] (-415.051) -- 0:00:10
822000 -- [-415.153] (-417.592) (-416.433) (-419.203) * (-416.431) (-416.405) [-415.012] (-419.945) -- 0:00:10
822500 -- (-417.046) (-420.169) (-421.264) [-415.899] * (-416.059) [-415.654] (-415.813) (-415.579) -- 0:00:10
823000 -- [-415.754] (-417.727) (-415.363) (-417.741) * (-416.608) (-419.304) [-416.711] (-418.924) -- 0:00:10
823500 -- [-419.628] (-417.646) (-415.603) (-418.541) * (-416.157) (-419.485) (-416.123) [-418.682] -- 0:00:10
824000 -- (-416.870) (-415.454) [-420.389] (-416.150) * (-418.579) [-416.840] (-415.910) (-424.124) -- 0:00:10
824500 -- (-416.221) [-414.827] (-418.320) (-415.510) * (-418.273) (-417.636) [-414.967] (-420.985) -- 0:00:10
825000 -- (-418.348) [-417.067] (-415.005) (-415.110) * (-417.757) [-417.796] (-418.667) (-419.508) -- 0:00:10
Average standard deviation of split frequencies: 0.009488
825500 -- [-417.276] (-415.936) (-418.301) (-419.566) * (-416.655) (-416.531) [-417.442] (-420.241) -- 0:00:10
826000 -- (-416.134) (-415.802) [-417.701] (-422.166) * (-416.863) (-418.292) (-416.878) [-416.895] -- 0:00:10
826500 -- (-419.361) (-422.661) [-419.500] (-422.498) * (-417.400) [-418.559] (-417.504) (-419.875) -- 0:00:10
827000 -- (-417.945) (-417.793) (-416.190) [-416.242] * (-418.735) (-417.462) [-417.326] (-417.990) -- 0:00:10
827500 -- [-419.202] (-420.750) (-415.271) (-415.537) * (-418.225) [-416.079] (-415.499) (-416.897) -- 0:00:10
828000 -- (-417.254) (-414.546) (-417.844) [-418.826] * (-416.626) [-415.305] (-418.821) (-422.474) -- 0:00:10
828500 -- (-416.186) [-416.276] (-419.778) (-418.427) * [-415.817] (-415.981) (-416.583) (-417.650) -- 0:00:10
829000 -- [-421.778] (-415.553) (-415.552) (-419.085) * (-415.786) [-415.377] (-416.794) (-416.422) -- 0:00:10
829500 -- [-416.404] (-418.176) (-416.915) (-421.368) * [-417.288] (-414.687) (-416.372) (-415.108) -- 0:00:10
830000 -- (-416.372) (-414.770) [-418.058] (-420.750) * [-416.765] (-414.896) (-416.720) (-416.553) -- 0:00:10
Average standard deviation of split frequencies: 0.009364
830500 -- (-423.466) (-416.074) [-415.467] (-416.320) * (-416.821) (-418.134) [-416.985] (-416.351) -- 0:00:10
831000 -- (-417.461) [-416.077] (-416.049) (-415.705) * (-416.821) [-415.275] (-415.012) (-417.655) -- 0:00:10
831500 -- [-415.830] (-416.548) (-420.302) (-415.439) * (-416.801) (-415.797) [-417.857] (-415.770) -- 0:00:10
832000 -- [-417.145] (-416.220) (-417.027) (-416.834) * (-416.708) [-415.365] (-417.329) (-417.337) -- 0:00:10
832500 -- (-417.335) (-419.861) (-415.814) [-415.842] * (-418.206) [-417.216] (-421.822) (-415.960) -- 0:00:10
833000 -- (-418.013) (-419.320) [-417.199] (-414.886) * [-418.190] (-415.991) (-416.850) (-414.751) -- 0:00:10
833500 -- (-418.488) [-418.259] (-419.878) (-417.645) * [-416.987] (-416.108) (-415.491) (-419.370) -- 0:00:10
834000 -- [-418.689] (-419.160) (-416.318) (-416.079) * (-416.940) (-417.515) [-418.299] (-415.265) -- 0:00:10
834500 -- [-415.193] (-419.069) (-415.817) (-415.307) * (-415.323) (-417.436) [-419.225] (-417.418) -- 0:00:10
835000 -- (-415.383) (-422.460) (-416.203) [-416.122] * (-414.895) [-417.699] (-415.705) (-419.999) -- 0:00:10
Average standard deviation of split frequencies: 0.009285
835500 -- [-418.041] (-421.265) (-416.674) (-416.793) * (-418.334) (-417.037) [-417.259] (-415.675) -- 0:00:10
836000 -- (-416.265) (-416.750) (-416.052) [-419.715] * (-417.515) (-415.934) [-415.956] (-415.765) -- 0:00:10
836500 -- (-416.395) (-422.302) (-417.140) [-416.482] * (-415.552) (-415.340) [-415.158] (-416.330) -- 0:00:09
837000 -- (-419.077) [-417.378] (-416.171) (-416.447) * (-418.042) (-415.948) (-416.789) [-417.618] -- 0:00:09
837500 -- (-418.593) (-415.691) (-421.179) [-415.698] * (-417.442) (-417.190) (-418.136) [-416.403] -- 0:00:09
838000 -- [-416.188] (-417.911) (-420.990) (-416.597) * (-416.221) (-416.372) [-416.755] (-415.414) -- 0:00:09
838500 -- (-415.654) (-416.010) (-415.520) [-416.696] * (-417.344) (-416.028) (-418.300) [-414.709] -- 0:00:09
839000 -- [-418.346] (-416.881) (-417.148) (-418.628) * (-415.829) (-414.868) [-416.089] (-415.521) -- 0:00:09
839500 -- [-416.873] (-418.641) (-419.896) (-418.320) * [-419.760] (-414.940) (-415.737) (-418.073) -- 0:00:09
840000 -- (-416.709) [-417.845] (-418.975) (-421.780) * (-418.115) (-417.321) [-415.951] (-419.202) -- 0:00:09
Average standard deviation of split frequencies: 0.009673
840500 -- (-415.101) [-416.271] (-417.681) (-418.331) * [-416.617] (-415.937) (-415.600) (-419.529) -- 0:00:09
841000 -- (-415.903) (-417.724) (-418.590) [-415.633] * [-414.996] (-414.439) (-417.966) (-415.980) -- 0:00:09
841500 -- (-419.480) (-423.536) [-416.078] (-416.188) * (-417.590) (-418.303) [-417.562] (-417.708) -- 0:00:09
842000 -- [-418.367] (-416.491) (-416.753) (-415.914) * [-418.176] (-416.512) (-417.821) (-421.633) -- 0:00:09
842500 -- [-415.241] (-416.046) (-420.428) (-418.031) * [-415.552] (-422.115) (-420.528) (-418.298) -- 0:00:09
843000 -- (-415.604) [-415.518] (-422.297) (-417.561) * (-416.224) (-416.330) (-421.868) [-415.443] -- 0:00:09
843500 -- [-415.508] (-417.938) (-418.337) (-416.122) * (-417.613) [-417.574] (-418.477) (-416.548) -- 0:00:09
844000 -- (-416.347) (-417.525) (-421.291) [-418.239] * (-419.038) (-419.635) (-421.288) [-421.047] -- 0:00:09
844500 -- (-414.820) (-416.515) (-416.053) [-417.542] * (-417.529) (-419.256) [-419.139] (-417.683) -- 0:00:09
845000 -- (-415.588) (-418.804) [-417.191] (-419.368) * (-416.758) (-416.184) [-420.075] (-420.969) -- 0:00:09
Average standard deviation of split frequencies: 0.009264
845500 -- (-417.693) [-420.411] (-415.646) (-414.903) * (-418.787) (-415.981) (-418.022) [-416.760] -- 0:00:09
846000 -- [-417.730] (-418.992) (-419.629) (-415.077) * [-419.189] (-418.462) (-416.470) (-416.841) -- 0:00:09
846500 -- (-416.660) (-420.677) [-418.739] (-414.683) * (-419.430) (-416.134) [-418.205] (-418.733) -- 0:00:09
847000 -- (-417.598) (-422.111) (-418.582) [-416.486] * [-415.614] (-420.583) (-415.753) (-418.410) -- 0:00:09
847500 -- [-418.646] (-417.506) (-419.817) (-414.641) * [-415.434] (-416.227) (-416.359) (-421.930) -- 0:00:09
848000 -- [-415.815] (-415.450) (-416.575) (-414.699) * [-416.607] (-416.316) (-419.012) (-420.316) -- 0:00:09
848500 -- [-416.347] (-417.669) (-420.046) (-418.055) * [-414.857] (-418.466) (-417.801) (-417.934) -- 0:00:09
849000 -- [-415.800] (-416.948) (-418.065) (-415.723) * (-417.718) (-418.046) [-417.587] (-419.513) -- 0:00:09
849500 -- (-415.073) [-416.556] (-415.765) (-416.656) * (-415.426) [-417.394] (-415.136) (-420.568) -- 0:00:09
850000 -- (-415.804) [-421.601] (-415.024) (-416.853) * (-418.064) (-415.648) (-416.091) [-414.834] -- 0:00:09
Average standard deviation of split frequencies: 0.009074
850500 -- (-416.392) (-417.635) [-420.366] (-417.530) * (-417.464) (-417.832) (-418.732) [-416.575] -- 0:00:09
851000 -- (-415.755) (-419.629) [-420.581] (-420.216) * (-417.036) (-417.291) (-416.554) [-416.315] -- 0:00:09
851500 -- [-416.596] (-423.698) (-418.742) (-417.745) * [-418.650] (-417.368) (-415.464) (-420.456) -- 0:00:09
852000 -- [-417.015] (-415.516) (-415.790) (-414.807) * (-415.445) (-416.068) (-416.184) [-416.705] -- 0:00:09
852500 -- (-416.869) [-417.600] (-415.800) (-415.610) * (-416.015) (-419.215) (-415.803) [-415.757] -- 0:00:08
853000 -- (-415.943) (-419.058) [-416.746] (-415.109) * (-418.619) (-416.386) (-417.115) [-415.994] -- 0:00:08
853500 -- [-415.796] (-415.137) (-419.165) (-416.825) * (-421.259) (-421.661) (-417.451) [-416.199] -- 0:00:08
854000 -- [-416.572] (-419.687) (-416.620) (-418.866) * (-417.342) [-417.132] (-415.372) (-417.867) -- 0:00:08
854500 -- (-419.006) (-424.113) (-419.288) [-415.085] * (-415.347) (-415.981) [-414.868] (-417.537) -- 0:00:08
855000 -- (-421.008) [-414.581] (-417.396) (-415.993) * (-419.332) [-415.117] (-415.946) (-415.815) -- 0:00:08
Average standard deviation of split frequencies: 0.009018
855500 -- [-420.673] (-418.006) (-416.372) (-418.506) * (-420.622) (-415.115) [-417.815] (-415.569) -- 0:00:08
856000 -- (-416.171) (-417.737) [-416.245] (-416.540) * (-419.035) (-417.050) (-416.385) [-414.859] -- 0:00:08
856500 -- [-416.079] (-417.868) (-417.834) (-417.050) * (-415.533) (-415.742) (-419.547) [-416.695] -- 0:00:08
857000 -- (-417.206) [-416.005] (-414.947) (-416.925) * [-417.801] (-417.187) (-415.658) (-416.755) -- 0:00:08
857500 -- (-416.398) (-416.369) (-416.035) [-420.871] * (-416.450) (-415.520) (-416.410) [-418.591] -- 0:00:08
858000 -- [-416.362] (-415.611) (-421.890) (-417.432) * [-417.138] (-416.997) (-415.313) (-416.137) -- 0:00:08
858500 -- (-415.371) [-415.416] (-418.183) (-415.919) * (-414.763) (-420.175) (-417.370) [-416.963] -- 0:00:08
859000 -- (-419.968) (-416.435) [-418.131] (-418.668) * (-416.487) (-416.081) [-415.708] (-415.502) -- 0:00:08
859500 -- (-417.330) [-417.346] (-416.083) (-415.780) * (-417.297) (-417.500) (-416.693) [-414.968] -- 0:00:08
860000 -- (-418.354) [-415.320] (-419.980) (-416.544) * (-417.158) (-416.391) [-416.833] (-415.329) -- 0:00:08
Average standard deviation of split frequencies: 0.009243
860500 -- [-417.607] (-418.959) (-416.375) (-418.816) * (-421.648) (-418.710) (-419.550) [-416.329] -- 0:00:08
861000 -- (-417.411) (-415.917) [-415.965] (-417.520) * (-416.902) (-417.153) [-418.046] (-416.103) -- 0:00:08
861500 -- (-417.116) (-415.451) [-416.204] (-418.842) * (-417.460) (-417.336) (-419.165) [-416.137] -- 0:00:08
862000 -- (-415.732) (-416.465) [-416.644] (-414.660) * [-419.791] (-416.385) (-421.737) (-415.472) -- 0:00:08
862500 -- (-421.883) (-415.286) (-423.440) [-414.499] * (-416.898) (-416.400) [-416.549] (-420.504) -- 0:00:08
863000 -- [-415.261] (-418.176) (-422.907) (-415.570) * [-417.258] (-418.159) (-416.876) (-418.349) -- 0:00:08
863500 -- (-415.226) (-418.649) [-415.900] (-415.189) * (-416.168) [-417.202] (-415.885) (-414.634) -- 0:00:08
864000 -- [-415.726] (-420.040) (-420.209) (-415.186) * (-415.692) [-416.231] (-416.972) (-417.086) -- 0:00:08
864500 -- (-417.353) (-420.255) [-419.210] (-421.254) * [-415.619] (-420.800) (-416.221) (-416.641) -- 0:00:08
865000 -- (-415.910) [-416.721] (-419.510) (-419.375) * (-416.500) (-417.949) (-416.418) [-418.098] -- 0:00:08
Average standard deviation of split frequencies: 0.009084
865500 -- (-416.211) [-420.562] (-415.997) (-419.486) * (-415.187) [-417.855] (-416.663) (-417.450) -- 0:00:08
866000 -- (-416.356) (-418.326) (-418.208) [-420.815] * (-415.098) [-418.380] (-416.771) (-417.451) -- 0:00:08
866500 -- (-418.847) (-417.920) [-417.583] (-415.906) * (-416.383) (-416.831) (-417.609) [-415.851] -- 0:00:08
867000 -- [-416.114] (-420.681) (-416.405) (-416.694) * (-416.738) [-416.515] (-415.367) (-419.118) -- 0:00:08
867500 -- (-415.908) (-418.119) (-414.583) [-415.567] * (-416.299) [-418.031] (-416.109) (-415.208) -- 0:00:08
868000 -- (-415.671) (-420.302) (-417.380) [-417.086] * (-417.281) [-415.862] (-415.280) (-418.908) -- 0:00:08
868500 -- (-414.694) (-415.730) (-416.441) [-415.949] * (-420.451) [-415.754] (-417.576) (-417.938) -- 0:00:08
869000 -- (-415.046) [-416.646] (-423.045) (-417.743) * (-420.531) [-418.993] (-417.410) (-423.539) -- 0:00:07
869500 -- (-416.123) (-416.390) (-418.284) [-415.257] * (-415.592) (-416.462) [-417.466] (-418.849) -- 0:00:07
870000 -- (-415.312) (-419.516) [-419.873] (-415.223) * (-415.251) (-418.933) (-416.748) [-416.514] -- 0:00:07
Average standard deviation of split frequencies: 0.009001
870500 -- [-415.257] (-416.148) (-420.302) (-415.743) * (-415.463) (-416.993) (-416.682) [-415.973] -- 0:00:07
871000 -- (-415.723) [-414.743] (-419.079) (-418.415) * [-416.742] (-417.034) (-418.073) (-418.265) -- 0:00:07
871500 -- (-416.800) (-419.936) [-417.111] (-420.855) * (-424.741) [-416.028] (-417.703) (-418.121) -- 0:00:07
872000 -- [-417.174] (-417.841) (-419.910) (-419.640) * (-418.234) (-421.478) [-416.344] (-416.079) -- 0:00:07
872500 -- (-418.453) (-419.204) (-415.409) [-415.119] * (-415.772) (-418.081) [-416.191] (-416.557) -- 0:00:07
873000 -- (-415.055) [-416.656] (-423.211) (-417.534) * [-415.343] (-419.142) (-416.566) (-417.977) -- 0:00:07
873500 -- (-415.979) (-416.102) (-426.377) [-417.226] * [-415.141] (-416.299) (-417.994) (-422.228) -- 0:00:07
874000 -- (-416.483) (-416.503) [-416.769] (-416.332) * (-416.903) [-416.854] (-417.771) (-417.230) -- 0:00:07
874500 -- (-418.687) [-417.932] (-417.001) (-418.526) * (-416.513) (-415.899) (-415.490) [-417.592] -- 0:00:07
875000 -- (-418.022) (-417.359) (-419.601) [-414.859] * [-415.795] (-421.419) (-416.918) (-415.979) -- 0:00:07
Average standard deviation of split frequencies: 0.008476
875500 -- (-420.113) [-417.836] (-418.613) (-415.723) * (-416.015) (-416.451) [-416.732] (-415.517) -- 0:00:07
876000 -- (-421.771) (-417.630) [-418.774] (-415.882) * (-414.689) (-418.278) (-416.542) [-415.918] -- 0:00:07
876500 -- (-421.347) (-417.574) (-416.322) [-415.756] * (-417.285) (-419.454) [-415.323] (-416.596) -- 0:00:07
877000 -- (-421.121) (-418.654) (-415.635) [-416.966] * [-417.062] (-416.479) (-421.348) (-417.278) -- 0:00:07
877500 -- (-417.180) (-416.159) (-415.405) [-417.822] * [-416.314] (-415.573) (-416.995) (-416.158) -- 0:00:07
878000 -- (-415.786) [-416.179] (-415.013) (-418.678) * [-415.301] (-419.251) (-418.816) (-417.131) -- 0:00:07
878500 -- (-416.923) (-416.487) (-416.569) [-415.984] * (-417.661) [-416.281] (-417.442) (-416.978) -- 0:00:07
879000 -- [-415.016] (-417.888) (-416.587) (-416.720) * [-419.037] (-415.324) (-418.564) (-419.591) -- 0:00:07
879500 -- (-414.951) [-416.338] (-421.135) (-417.190) * (-417.770) [-414.849] (-418.405) (-417.203) -- 0:00:07
880000 -- (-416.543) [-419.374] (-419.262) (-417.612) * (-417.686) [-416.209] (-422.137) (-419.966) -- 0:00:07
Average standard deviation of split frequencies: 0.008966
880500 -- (-415.420) (-414.488) (-416.609) [-415.929] * (-417.683) (-418.307) (-415.542) [-420.403] -- 0:00:07
881000 -- (-416.311) [-416.020] (-416.906) (-417.388) * [-417.214] (-416.932) (-416.545) (-416.034) -- 0:00:07
881500 -- (-414.461) [-417.146] (-416.378) (-415.337) * (-415.176) (-417.965) [-415.414] (-415.164) -- 0:00:07
882000 -- [-415.175] (-415.891) (-415.875) (-417.553) * [-421.268] (-417.589) (-415.195) (-417.604) -- 0:00:07
882500 -- (-415.828) [-415.890] (-419.486) (-420.729) * (-415.944) (-422.655) (-415.949) [-415.403] -- 0:00:07
883000 -- [-415.981] (-415.863) (-418.202) (-416.337) * (-418.766) (-421.577) (-417.222) [-417.281] -- 0:00:07
883500 -- [-417.834] (-415.064) (-416.124) (-414.636) * (-415.158) (-415.938) [-415.904] (-418.663) -- 0:00:07
884000 -- (-417.524) (-414.899) (-416.654) [-416.097] * [-414.968] (-415.256) (-415.709) (-415.452) -- 0:00:07
884500 -- [-416.664] (-420.848) (-417.616) (-418.335) * (-417.081) [-415.062] (-417.590) (-416.374) -- 0:00:07
885000 -- (-416.026) (-415.947) (-416.884) [-415.950] * (-416.496) [-415.432] (-417.327) (-416.188) -- 0:00:07
Average standard deviation of split frequencies: 0.008779
885500 -- (-416.857) (-415.120) (-416.537) [-416.377] * (-416.255) (-415.876) [-416.268] (-417.844) -- 0:00:06
886000 -- [-418.243] (-419.106) (-416.905) (-415.124) * (-417.642) (-414.928) [-419.251] (-415.075) -- 0:00:06
886500 -- [-418.552] (-415.463) (-417.662) (-415.268) * (-417.901) (-416.490) (-417.999) [-414.952] -- 0:00:06
887000 -- (-416.878) (-415.854) (-418.185) [-415.737] * (-415.962) (-415.375) [-419.416] (-420.085) -- 0:00:06
887500 -- (-416.306) (-417.138) [-417.786] (-419.530) * (-414.722) (-420.210) (-421.507) [-417.658] -- 0:00:06
888000 -- (-416.278) (-415.171) (-420.680) [-419.010] * (-414.818) [-418.229] (-415.837) (-417.696) -- 0:00:06
888500 -- (-417.856) (-416.361) [-417.710] (-419.860) * (-414.879) (-415.345) [-415.396] (-417.563) -- 0:00:06
889000 -- (-421.563) (-416.571) [-416.578] (-422.599) * (-417.994) (-416.457) (-417.890) [-418.177] -- 0:00:06
889500 -- [-419.243] (-421.936) (-417.456) (-418.650) * (-415.501) [-415.494] (-415.857) (-417.989) -- 0:00:06
890000 -- (-419.416) (-416.055) (-415.872) [-418.255] * (-418.784) (-415.526) [-417.764] (-420.208) -- 0:00:06
Average standard deviation of split frequencies: 0.008237
890500 -- (-418.679) (-415.609) [-419.202] (-417.318) * (-423.340) (-418.958) (-417.496) [-419.617] -- 0:00:06
891000 -- (-416.924) (-417.664) (-418.211) [-416.441] * (-419.850) [-421.001] (-419.381) (-415.703) -- 0:00:06
891500 -- (-416.763) (-419.289) (-419.992) [-415.649] * (-417.303) (-419.320) (-417.006) [-417.902] -- 0:00:06
892000 -- (-418.919) (-416.352) (-415.546) [-416.640] * (-418.806) [-416.843] (-418.078) (-416.450) -- 0:00:06
892500 -- (-418.727) (-416.833) (-415.825) [-417.749] * (-416.763) (-417.393) (-417.489) [-417.749] -- 0:00:06
893000 -- (-417.497) [-418.399] (-415.994) (-415.225) * (-417.727) (-415.911) [-418.666] (-417.875) -- 0:00:06
893500 -- (-418.013) [-418.650] (-415.399) (-415.987) * (-417.709) (-415.489) (-418.685) [-417.406] -- 0:00:06
894000 -- (-415.451) (-415.569) [-415.171] (-417.724) * (-421.339) [-415.900] (-417.705) (-416.935) -- 0:00:06
894500 -- (-414.590) (-421.309) (-416.166) [-416.915] * (-422.105) [-415.931] (-419.644) (-419.425) -- 0:00:06
895000 -- (-417.044) (-416.464) [-415.700] (-419.062) * (-417.949) [-417.241] (-415.021) (-416.329) -- 0:00:06
Average standard deviation of split frequencies: 0.008418
895500 -- (-416.134) (-416.712) [-415.611] (-414.606) * (-421.703) (-417.207) [-416.296] (-415.819) -- 0:00:06
896000 -- [-414.927] (-415.797) (-416.805) (-419.145) * (-422.470) [-415.803] (-414.905) (-416.756) -- 0:00:06
896500 -- (-416.156) [-416.321] (-417.108) (-415.186) * (-423.732) [-414.742] (-415.390) (-417.611) -- 0:00:06
897000 -- (-416.334) (-415.462) (-420.778) [-415.936] * (-415.955) (-416.314) [-416.135] (-419.023) -- 0:00:06
897500 -- (-415.983) (-417.683) [-417.408] (-418.079) * (-415.405) [-417.979] (-416.676) (-421.579) -- 0:00:06
898000 -- [-415.431] (-415.072) (-418.437) (-417.959) * [-415.144] (-416.172) (-418.568) (-418.532) -- 0:00:06
898500 -- (-416.371) [-415.313] (-417.740) (-420.626) * (-416.672) (-417.592) (-415.543) [-417.105] -- 0:00:06
899000 -- [-415.729] (-414.838) (-418.573) (-416.699) * [-416.422] (-416.427) (-418.875) (-415.238) -- 0:00:06
899500 -- (-416.177) [-418.096] (-416.179) (-416.448) * (-416.824) [-417.243] (-415.987) (-416.719) -- 0:00:06
900000 -- [-416.221] (-415.676) (-416.757) (-418.397) * (-417.031) (-417.339) [-417.073] (-424.383) -- 0:00:06
Average standard deviation of split frequencies: 0.008165
900500 -- (-421.061) [-415.505] (-415.802) (-415.178) * (-420.409) [-417.953] (-416.526) (-414.693) -- 0:00:06
901000 -- (-422.392) (-419.328) (-418.630) [-416.866] * (-416.777) [-415.600] (-416.127) (-414.678) -- 0:00:06
901500 -- (-422.407) (-415.196) (-417.286) [-417.845] * (-418.086) (-417.026) (-419.366) [-416.549] -- 0:00:06
902000 -- (-422.501) [-418.108] (-417.905) (-415.892) * [-415.986] (-415.938) (-416.356) (-415.955) -- 0:00:05
902500 -- [-417.186] (-418.182) (-416.595) (-415.371) * (-416.386) (-418.605) (-418.793) [-416.715] -- 0:00:05
903000 -- (-416.199) (-417.453) [-416.895] (-415.125) * [-414.808] (-418.040) (-417.100) (-415.791) -- 0:00:05
903500 -- (-418.217) (-421.419) (-416.999) [-415.508] * (-414.680) (-417.007) (-419.665) [-420.897] -- 0:00:05
904000 -- (-417.317) (-419.501) [-419.920] (-416.110) * (-416.704) [-416.328] (-417.235) (-415.755) -- 0:00:05
904500 -- (-414.608) (-417.785) (-419.996) [-417.127] * (-415.724) (-416.149) [-416.471] (-418.275) -- 0:00:05
905000 -- (-415.922) (-418.947) [-416.307] (-417.015) * [-415.068] (-417.060) (-418.473) (-420.125) -- 0:00:05
Average standard deviation of split frequencies: 0.008455
905500 -- [-416.139] (-422.274) (-415.006) (-415.785) * (-415.252) (-416.523) [-416.824] (-416.328) -- 0:00:05
906000 -- (-419.500) (-416.220) (-418.242) [-416.634] * (-416.890) (-416.968) (-416.185) [-416.091] -- 0:00:05
906500 -- [-418.540] (-415.305) (-417.900) (-421.461) * (-416.073) [-415.394] (-415.971) (-423.630) -- 0:00:05
907000 -- [-417.652] (-416.374) (-423.253) (-417.151) * [-418.396] (-415.411) (-416.152) (-417.665) -- 0:00:05
907500 -- (-416.682) (-416.206) (-420.068) [-415.303] * (-415.670) [-416.322] (-418.425) (-415.722) -- 0:00:05
908000 -- (-415.786) (-418.670) (-416.800) [-416.626] * (-414.840) (-416.741) [-416.859] (-416.854) -- 0:00:05
908500 -- [-417.709] (-415.826) (-419.928) (-417.288) * (-418.596) (-419.147) (-417.719) [-416.127] -- 0:00:05
909000 -- (-420.413) (-417.724) (-415.900) [-415.419] * (-414.894) (-421.083) [-416.146] (-417.301) -- 0:00:05
909500 -- (-415.410) [-416.263] (-416.689) (-415.387) * (-416.473) (-415.827) (-417.783) [-418.668] -- 0:00:05
910000 -- [-417.247] (-415.229) (-424.415) (-415.794) * (-416.365) (-416.640) [-416.083] (-416.361) -- 0:00:05
Average standard deviation of split frequencies: 0.008671
910500 -- [-418.347] (-418.231) (-415.098) (-415.308) * [-416.421] (-416.691) (-415.540) (-419.866) -- 0:00:05
911000 -- (-416.368) (-417.589) (-414.771) [-414.883] * [-417.576] (-418.447) (-417.815) (-416.316) -- 0:00:05
911500 -- (-418.427) (-417.122) (-416.158) [-416.810] * [-415.588] (-421.020) (-420.922) (-416.333) -- 0:00:05
912000 -- (-420.768) (-415.614) (-417.037) [-417.944] * (-417.155) (-418.576) (-417.821) [-418.889] -- 0:00:05
912500 -- [-418.137] (-415.529) (-416.675) (-418.149) * (-418.509) [-418.318] (-417.280) (-421.138) -- 0:00:05
913000 -- (-421.901) (-420.481) (-416.123) [-415.344] * (-414.756) (-415.198) [-414.741] (-419.757) -- 0:00:05
913500 -- (-419.946) (-418.641) [-418.504] (-415.365) * (-419.132) (-416.763) [-415.504] (-416.817) -- 0:00:05
914000 -- (-419.700) (-417.797) [-417.889] (-419.066) * (-417.863) (-417.641) (-415.448) [-415.213] -- 0:00:05
914500 -- (-420.325) (-417.598) [-417.470] (-416.534) * (-415.641) (-415.370) (-416.983) [-417.788] -- 0:00:05
915000 -- [-417.605] (-418.902) (-415.591) (-416.601) * [-418.753] (-419.323) (-417.008) (-417.798) -- 0:00:05
Average standard deviation of split frequencies: 0.008298
915500 -- (-418.096) [-418.350] (-417.146) (-416.789) * (-420.794) (-421.564) (-415.121) [-417.359] -- 0:00:05
916000 -- (-417.907) (-417.939) (-415.799) [-415.504] * (-417.381) (-417.032) (-417.132) [-420.707] -- 0:00:05
916500 -- (-417.163) (-419.399) [-418.358] (-416.504) * [-418.030] (-418.979) (-417.500) (-420.806) -- 0:00:05
917000 -- (-417.765) [-417.888] (-416.137) (-416.405) * (-416.787) (-415.052) (-417.044) [-416.299] -- 0:00:05
917500 -- (-415.505) (-419.233) (-418.413) [-416.973] * (-422.139) [-415.907] (-421.523) (-419.444) -- 0:00:05
918000 -- (-417.812) (-416.326) [-419.187] (-415.284) * (-417.597) (-416.086) [-417.188] (-420.484) -- 0:00:05
918500 -- [-415.893] (-417.595) (-415.211) (-417.214) * [-417.895] (-418.171) (-417.888) (-419.210) -- 0:00:04
919000 -- (-418.442) (-417.481) (-416.709) [-414.791] * [-417.123] (-416.334) (-418.220) (-418.101) -- 0:00:04
919500 -- (-418.808) (-418.082) [-416.460] (-414.543) * (-418.010) [-415.770] (-417.419) (-418.261) -- 0:00:04
920000 -- [-415.254] (-419.206) (-415.608) (-415.081) * (-419.396) (-415.057) (-415.112) [-416.018] -- 0:00:04
Average standard deviation of split frequencies: 0.008448
920500 -- [-417.483] (-418.734) (-419.627) (-416.578) * (-416.590) (-416.029) (-416.083) [-414.902] -- 0:00:04
921000 -- [-417.331] (-416.695) (-416.730) (-416.589) * (-415.991) (-414.715) (-415.210) [-418.045] -- 0:00:04
921500 -- (-417.266) (-418.284) [-416.130] (-415.928) * (-418.687) (-416.732) (-419.019) [-415.515] -- 0:00:04
922000 -- (-415.935) (-415.590) [-415.985] (-417.068) * [-417.950] (-417.812) (-418.500) (-415.261) -- 0:00:04
922500 -- (-416.023) [-416.461] (-417.509) (-414.954) * (-418.054) (-415.574) [-416.953] (-422.624) -- 0:00:04
923000 -- (-415.127) [-416.704] (-417.514) (-415.491) * (-415.469) (-416.409) [-416.621] (-416.424) -- 0:00:04
923500 -- (-414.976) (-416.061) [-416.554] (-419.074) * (-418.827) (-418.238) (-416.881) [-417.031] -- 0:00:04
924000 -- (-414.757) (-415.247) [-414.796] (-417.272) * (-415.989) [-417.067] (-417.059) (-416.365) -- 0:00:04
924500 -- (-417.554) (-415.703) (-418.351) [-418.842] * (-416.005) (-416.687) [-417.237] (-419.767) -- 0:00:04
925000 -- (-415.383) [-416.013] (-415.604) (-417.243) * [-416.597] (-419.374) (-420.731) (-416.825) -- 0:00:04
Average standard deviation of split frequencies: 0.008495
925500 -- [-416.653] (-415.571) (-415.062) (-416.592) * (-415.388) (-415.700) (-419.359) [-417.949] -- 0:00:04
926000 -- (-417.678) (-417.676) (-415.336) [-415.706] * (-416.816) (-418.453) [-415.965] (-419.017) -- 0:00:04
926500 -- (-415.452) [-418.378] (-415.851) (-416.276) * (-419.756) (-416.667) (-419.822) [-418.289] -- 0:00:04
927000 -- [-415.107] (-419.243) (-414.965) (-414.992) * [-418.160] (-418.602) (-418.869) (-415.380) -- 0:00:04
927500 -- (-416.623) (-416.959) [-417.019] (-415.789) * (-416.319) (-417.773) [-416.687] (-415.432) -- 0:00:04
928000 -- (-416.730) (-415.799) (-415.932) [-415.214] * (-417.640) (-415.654) [-416.664] (-419.565) -- 0:00:04
928500 -- (-418.103) [-417.063] (-415.332) (-416.658) * (-419.651) (-415.515) [-416.595] (-416.481) -- 0:00:04
929000 -- (-420.015) (-418.904) (-414.885) [-416.188] * (-421.515) (-415.950) (-418.220) [-415.521] -- 0:00:04
929500 -- (-414.671) [-416.836] (-418.043) (-415.584) * [-417.424] (-415.383) (-417.710) (-415.750) -- 0:00:04
930000 -- (-414.915) (-417.186) (-416.032) [-418.919] * (-419.207) [-414.965] (-419.665) (-416.539) -- 0:00:04
Average standard deviation of split frequencies: 0.008927
930500 -- (-417.822) (-417.254) (-415.759) [-417.872] * (-416.392) (-416.571) (-423.236) [-415.561] -- 0:00:04
931000 -- (-415.454) [-417.436] (-418.329) (-418.440) * (-416.430) (-420.160) [-416.216] (-417.041) -- 0:00:04
931500 -- [-415.738] (-416.355) (-417.096) (-415.690) * [-415.456] (-417.755) (-416.057) (-416.088) -- 0:00:04
932000 -- [-416.480] (-422.100) (-415.264) (-416.335) * (-420.758) (-417.772) [-415.503] (-415.967) -- 0:00:04
932500 -- [-417.161] (-417.545) (-419.813) (-416.023) * (-415.703) (-416.485) [-414.723] (-415.810) -- 0:00:04
933000 -- (-416.984) (-418.156) [-416.266] (-416.794) * (-417.498) (-418.407) (-417.450) [-415.168] -- 0:00:04
933500 -- (-415.460) (-417.242) (-416.738) [-415.728] * [-416.963] (-418.611) (-421.890) (-415.568) -- 0:00:04
934000 -- [-415.502] (-417.096) (-416.482) (-416.247) * (-419.163) [-418.513] (-415.911) (-416.635) -- 0:00:04
934500 -- (-414.677) [-416.343] (-417.254) (-416.134) * (-415.706) [-417.966] (-416.185) (-420.134) -- 0:00:03
935000 -- (-417.367) (-415.698) [-416.172] (-416.051) * (-416.286) [-420.380] (-416.981) (-415.533) -- 0:00:03
Average standard deviation of split frequencies: 0.009286
935500 -- (-416.098) [-415.996] (-418.726) (-415.797) * (-417.500) (-418.500) (-416.313) [-414.710] -- 0:00:03
936000 -- (-419.214) [-417.577] (-417.039) (-415.159) * [-415.385] (-415.549) (-417.460) (-418.733) -- 0:00:03
936500 -- [-415.759] (-415.617) (-416.001) (-417.106) * [-416.542] (-416.172) (-417.230) (-415.808) -- 0:00:03
937000 -- (-418.526) (-418.200) (-415.000) [-419.444] * (-417.043) (-416.681) (-415.534) [-418.821] -- 0:00:03
937500 -- (-419.845) [-418.888] (-417.137) (-419.761) * (-417.140) (-415.346) [-416.266] (-417.016) -- 0:00:03
938000 -- (-419.235) (-417.712) [-415.543] (-416.570) * [-416.524] (-415.244) (-417.713) (-415.747) -- 0:00:03
938500 -- (-415.021) (-416.390) (-416.488) [-416.655] * [-418.165] (-416.943) (-417.928) (-418.778) -- 0:00:03
939000 -- (-416.145) (-416.412) (-415.282) [-416.455] * (-416.347) [-416.565] (-419.541) (-424.269) -- 0:00:03
939500 -- (-416.498) (-418.183) (-416.127) [-414.672] * (-416.899) (-418.728) [-418.425] (-416.361) -- 0:00:03
940000 -- (-416.772) (-418.022) [-415.984] (-416.866) * (-416.371) [-422.605] (-418.347) (-414.617) -- 0:00:03
Average standard deviation of split frequencies: 0.009177
940500 -- (-417.101) (-415.959) [-416.325] (-416.460) * (-416.194) (-417.740) [-415.210] (-414.960) -- 0:00:03
941000 -- [-419.341] (-415.887) (-417.014) (-417.171) * [-417.965] (-417.500) (-418.296) (-414.884) -- 0:00:03
941500 -- (-422.876) (-416.962) (-415.117) [-417.022] * [-416.670] (-415.211) (-424.031) (-418.546) -- 0:00:03
942000 -- [-415.908] (-417.207) (-417.680) (-417.765) * (-418.287) (-417.073) (-415.806) [-418.876] -- 0:00:03
942500 -- [-415.616] (-420.858) (-416.876) (-420.230) * [-418.838] (-416.837) (-415.086) (-415.531) -- 0:00:03
943000 -- (-415.030) [-417.577] (-423.915) (-422.861) * [-416.272] (-416.351) (-415.046) (-417.397) -- 0:00:03
943500 -- (-416.247) (-415.219) [-418.645] (-416.878) * (-416.831) [-416.004] (-415.046) (-419.102) -- 0:00:03
944000 -- [-415.070] (-418.364) (-416.903) (-415.344) * [-418.304] (-418.787) (-416.314) (-416.336) -- 0:00:03
944500 -- (-415.262) (-415.636) (-421.304) [-415.365] * (-414.987) (-415.540) (-416.928) [-416.198] -- 0:00:03
945000 -- (-415.288) (-414.718) (-417.907) [-415.313] * (-416.329) (-415.794) [-414.811] (-415.323) -- 0:00:03
Average standard deviation of split frequencies: 0.009032
945500 -- (-417.330) (-417.316) (-417.315) [-415.598] * (-416.300) (-417.357) (-420.780) [-414.985] -- 0:00:03
946000 -- (-415.849) [-417.076] (-418.874) (-415.668) * (-419.902) [-416.902] (-416.180) (-415.619) -- 0:00:03
946500 -- (-416.848) [-415.183] (-417.060) (-418.131) * (-416.158) [-415.255] (-419.515) (-417.404) -- 0:00:03
947000 -- (-417.327) (-415.461) (-416.856) [-416.331] * (-418.648) [-415.104] (-416.986) (-418.110) -- 0:00:03
947500 -- (-417.774) (-419.362) (-418.646) [-415.863] * (-417.451) [-416.718] (-419.987) (-418.227) -- 0:00:03
948000 -- [-417.204] (-416.635) (-417.819) (-420.873) * (-417.702) [-418.554] (-421.307) (-415.451) -- 0:00:03
948500 -- [-416.403] (-415.975) (-419.153) (-421.214) * (-418.540) (-417.057) (-421.969) [-415.257] -- 0:00:03
949000 -- (-415.501) (-418.130) [-418.558] (-417.742) * (-416.639) [-416.529] (-424.372) (-415.726) -- 0:00:03
949500 -- (-423.883) [-415.299] (-417.302) (-415.533) * (-415.803) (-415.674) [-418.632] (-416.193) -- 0:00:03
950000 -- [-424.804] (-414.952) (-416.402) (-418.547) * (-418.893) [-415.346] (-417.500) (-417.761) -- 0:00:03
Average standard deviation of split frequencies: 0.009019
950500 -- (-416.816) (-415.713) [-415.016] (-422.278) * (-417.066) (-415.685) [-415.114] (-420.479) -- 0:00:03
951000 -- (-415.893) (-418.417) (-414.690) [-418.795] * (-415.227) (-415.266) (-416.031) [-420.783] -- 0:00:02
951500 -- (-418.582) (-417.825) [-417.646] (-419.262) * [-417.228] (-422.349) (-417.060) (-415.081) -- 0:00:02
952000 -- (-415.772) (-417.437) (-424.152) [-418.992] * (-418.124) (-417.512) [-416.966] (-415.955) -- 0:00:02
952500 -- (-418.666) [-415.244] (-419.301) (-417.530) * (-419.277) (-415.539) [-415.835] (-415.155) -- 0:00:02
953000 -- (-415.720) (-415.941) (-416.148) [-416.026] * (-416.364) (-416.135) [-415.516] (-416.955) -- 0:00:02
953500 -- (-416.291) (-416.456) [-416.420] (-416.884) * (-415.869) (-417.244) [-417.270] (-419.046) -- 0:00:02
954000 -- (-417.427) (-418.338) (-416.834) [-415.695] * (-415.968) [-416.113] (-419.014) (-422.435) -- 0:00:02
954500 -- (-417.617) (-416.814) (-417.232) [-417.110] * (-417.166) (-418.275) [-415.471] (-418.220) -- 0:00:02
955000 -- [-415.300] (-417.834) (-417.342) (-415.746) * (-417.254) (-416.641) (-415.822) [-414.923] -- 0:00:02
Average standard deviation of split frequencies: 0.010036
955500 -- (-418.697) (-417.253) (-416.607) [-415.632] * [-415.743] (-418.986) (-417.222) (-421.536) -- 0:00:02
956000 -- (-422.869) [-415.785] (-417.680) (-416.832) * (-417.586) (-418.553) [-415.774] (-415.751) -- 0:00:02
956500 -- (-415.169) (-416.934) [-421.342] (-416.872) * (-415.873) (-417.916) [-417.546] (-419.253) -- 0:00:02
957000 -- (-420.009) [-415.860] (-417.037) (-418.927) * (-417.170) [-415.247] (-417.611) (-415.997) -- 0:00:02
957500 -- (-420.117) (-420.031) (-418.922) [-415.905] * (-415.603) (-415.514) [-416.119] (-416.331) -- 0:00:02
958000 -- (-415.585) (-421.341) (-418.546) [-415.172] * (-416.313) (-415.911) [-416.590] (-414.950) -- 0:00:02
958500 -- [-416.680] (-419.021) (-417.770) (-415.852) * [-420.010] (-422.400) (-416.585) (-415.651) -- 0:00:02
959000 -- (-417.517) [-418.072] (-415.647) (-417.216) * (-419.537) [-415.920] (-416.579) (-416.217) -- 0:00:02
959500 -- (-417.023) (-417.625) (-415.805) [-416.853] * (-414.585) [-419.138] (-414.992) (-417.404) -- 0:00:02
960000 -- [-417.230] (-417.979) (-415.762) (-416.184) * (-414.784) (-418.815) [-417.089] (-417.467) -- 0:00:02
Average standard deviation of split frequencies: 0.009583
960500 -- (-415.109) [-415.198] (-415.218) (-416.770) * [-418.787] (-418.980) (-417.466) (-417.571) -- 0:00:02
961000 -- (-418.397) [-419.371] (-417.772) (-417.881) * (-418.254) [-415.685] (-416.115) (-417.864) -- 0:00:02
961500 -- (-416.057) (-418.079) (-416.703) [-418.989] * (-417.841) (-415.854) [-416.474] (-416.305) -- 0:00:02
962000 -- (-415.999) (-415.287) (-416.127) [-417.314] * [-415.941] (-421.078) (-417.241) (-416.010) -- 0:00:02
962500 -- (-416.909) [-415.305] (-418.032) (-418.603) * (-416.592) [-417.743] (-417.589) (-421.730) -- 0:00:02
963000 -- (-416.409) [-417.113] (-421.315) (-421.431) * (-415.783) (-418.777) [-417.652] (-424.200) -- 0:00:02
963500 -- (-416.268) [-415.774] (-417.924) (-416.729) * (-417.086) [-415.824] (-415.873) (-424.024) -- 0:00:02
964000 -- [-416.749] (-416.224) (-416.417) (-417.216) * (-415.526) [-417.849] (-418.146) (-418.010) -- 0:00:02
964500 -- [-415.171] (-416.954) (-417.122) (-415.096) * [-415.842] (-418.760) (-415.743) (-416.553) -- 0:00:02
965000 -- [-414.527] (-417.610) (-418.066) (-418.951) * (-419.043) (-414.843) (-416.056) [-415.229] -- 0:00:02
Average standard deviation of split frequencies: 0.009530
965500 -- (-419.876) [-419.508] (-416.989) (-415.599) * (-419.497) (-419.065) [-416.418] (-414.660) -- 0:00:02
966000 -- (-415.440) [-418.105] (-422.024) (-417.079) * (-415.447) (-418.852) (-419.523) [-414.684] -- 0:00:02
966500 -- (-414.637) (-419.054) (-418.726) [-417.907] * (-414.945) [-416.124] (-417.768) (-417.538) -- 0:00:02
967000 -- (-416.291) (-415.398) [-416.212] (-415.487) * [-416.594] (-417.851) (-417.500) (-415.021) -- 0:00:02
967500 -- [-419.366] (-416.237) (-417.267) (-415.952) * (-417.673) (-417.386) [-415.353] (-421.023) -- 0:00:01
968000 -- [-418.613] (-419.597) (-418.675) (-415.589) * (-415.524) (-417.020) (-414.783) [-418.138] -- 0:00:01
968500 -- (-418.197) (-418.789) [-418.241] (-419.766) * (-417.158) (-415.746) (-415.889) [-420.371] -- 0:00:01
969000 -- [-418.162] (-419.199) (-419.266) (-421.779) * (-417.234) (-419.922) (-415.378) [-415.175] -- 0:00:01
969500 -- (-416.120) (-416.514) [-415.394] (-426.370) * (-415.825) [-417.523] (-414.854) (-415.647) -- 0:00:01
970000 -- (-417.696) [-416.265] (-416.485) (-425.295) * (-414.772) [-418.174] (-417.583) (-415.561) -- 0:00:01
Average standard deviation of split frequencies: 0.009570
970500 -- (-416.585) [-417.155] (-416.252) (-416.739) * (-414.752) (-418.694) (-418.460) [-416.509] -- 0:00:01
971000 -- [-415.228] (-417.141) (-416.188) (-415.817) * [-415.988] (-421.120) (-418.461) (-419.521) -- 0:00:01
971500 -- (-415.801) (-416.886) (-416.964) [-415.400] * [-415.487] (-417.138) (-416.814) (-418.370) -- 0:00:01
972000 -- (-415.920) [-417.729] (-419.191) (-418.016) * (-416.641) (-415.636) (-416.312) [-415.276] -- 0:00:01
972500 -- [-416.433] (-416.292) (-418.736) (-417.401) * [-418.734] (-417.477) (-419.655) (-416.899) -- 0:00:01
973000 -- (-415.508) (-417.388) [-415.875] (-416.553) * (-419.688) (-415.152) [-419.229] (-415.454) -- 0:00:01
973500 -- [-417.388] (-417.051) (-418.062) (-416.562) * (-416.712) (-416.952) [-417.229] (-416.376) -- 0:00:01
974000 -- (-414.860) (-420.467) (-418.319) [-416.084] * (-417.953) (-419.012) [-421.516] (-416.457) -- 0:00:01
974500 -- (-420.013) (-414.821) [-419.042] (-416.169) * (-421.695) (-418.028) (-419.718) [-415.678] -- 0:00:01
975000 -- (-415.245) [-419.246] (-417.508) (-415.560) * [-417.717] (-419.634) (-417.851) (-416.630) -- 0:00:01
Average standard deviation of split frequencies: 0.008875
975500 -- (-415.260) (-415.847) (-417.164) [-417.268] * (-421.535) (-418.714) [-416.704] (-419.899) -- 0:00:01
976000 -- [-417.070] (-423.145) (-419.114) (-416.308) * (-415.852) (-420.083) [-415.417] (-418.797) -- 0:00:01
976500 -- (-416.341) (-415.320) [-416.053] (-419.215) * (-416.381) [-418.217] (-416.894) (-419.552) -- 0:00:01
977000 -- (-415.573) [-415.524] (-420.869) (-416.764) * (-422.383) (-415.146) [-418.408] (-417.920) -- 0:00:01
977500 -- [-416.598] (-418.086) (-418.273) (-418.280) * [-416.511] (-416.454) (-420.522) (-415.658) -- 0:00:01
978000 -- (-418.275) (-419.708) [-419.140] (-419.411) * (-417.876) (-419.112) [-416.413] (-416.094) -- 0:00:01
978500 -- (-415.700) (-415.234) (-417.360) [-416.556] * [-416.877] (-417.690) (-417.096) (-419.922) -- 0:00:01
979000 -- (-419.747) (-417.577) [-414.868] (-415.828) * [-417.916] (-417.819) (-417.581) (-418.993) -- 0:00:01
979500 -- (-418.144) (-414.808) [-415.801] (-415.455) * (-419.225) (-419.007) [-416.930] (-419.261) -- 0:00:01
980000 -- [-415.291] (-414.706) (-416.157) (-416.097) * (-424.871) [-416.828] (-419.341) (-418.076) -- 0:00:01
Average standard deviation of split frequencies: 0.008803
980500 -- (-416.023) (-417.718) (-416.467) [-416.292] * (-423.306) (-415.985) [-415.030] (-417.062) -- 0:00:01
981000 -- [-417.068] (-416.495) (-414.699) (-417.224) * (-417.584) [-416.359] (-415.172) (-415.197) -- 0:00:01
981500 -- (-415.748) (-416.714) [-419.375] (-415.418) * (-416.854) [-415.675] (-415.622) (-418.510) -- 0:00:01
982000 -- (-416.043) (-418.428) [-417.147] (-415.734) * (-416.066) (-414.637) (-415.459) [-419.105] -- 0:00:01
982500 -- (-416.390) (-418.425) (-418.005) [-415.301] * (-417.393) [-417.530] (-417.861) (-419.387) -- 0:00:01
983000 -- (-415.845) (-416.657) (-418.542) [-417.073] * (-415.729) (-417.642) [-417.580] (-415.062) -- 0:00:01
983500 -- (-415.586) (-416.899) (-416.149) [-418.843] * (-416.609) [-419.171] (-417.713) (-415.137) -- 0:00:01
984000 -- (-418.068) (-418.153) [-414.776] (-416.562) * (-416.025) (-416.097) (-416.043) [-415.856] -- 0:00:00
984500 -- (-417.754) [-417.175] (-416.069) (-417.875) * (-415.322) (-421.020) [-416.799] (-415.458) -- 0:00:00
985000 -- (-415.387) (-416.782) (-419.353) [-418.770] * (-415.507) (-416.582) [-416.682] (-416.351) -- 0:00:00
Average standard deviation of split frequencies: 0.008576
985500 -- (-416.591) [-416.545] (-419.335) (-415.205) * [-417.234] (-417.459) (-417.926) (-417.030) -- 0:00:00
986000 -- (-416.177) [-414.660] (-416.421) (-414.905) * (-416.254) (-416.328) (-417.533) [-416.546] -- 0:00:00
986500 -- (-415.261) (-415.314) [-414.878] (-415.378) * [-414.730] (-417.046) (-415.553) (-418.688) -- 0:00:00
987000 -- (-418.145) (-415.224) (-416.540) [-416.493] * [-415.263] (-416.532) (-421.080) (-416.336) -- 0:00:00
987500 -- (-419.055) [-414.883] (-416.794) (-415.954) * (-416.114) [-415.975] (-415.142) (-416.322) -- 0:00:00
988000 -- (-420.081) (-415.744) [-418.108] (-419.680) * (-422.768) (-417.257) [-415.499] (-417.243) -- 0:00:00
988500 -- (-419.725) (-416.904) (-416.416) [-417.184] * (-415.075) (-416.313) (-417.373) [-417.752] -- 0:00:00
989000 -- (-417.987) (-416.786) [-416.424] (-416.916) * [-416.015] (-415.527) (-415.634) (-416.598) -- 0:00:00
989500 -- (-419.039) [-417.420] (-418.604) (-418.007) * (-422.860) (-415.350) (-416.764) [-417.162] -- 0:00:00
990000 -- [-417.549] (-415.861) (-420.091) (-416.183) * (-422.563) (-415.213) (-418.724) [-420.952] -- 0:00:00
Average standard deviation of split frequencies: 0.008535
990500 -- [-418.414] (-415.523) (-418.353) (-416.489) * (-425.605) [-415.915] (-417.729) (-415.527) -- 0:00:00
991000 -- (-414.810) (-417.530) (-420.301) [-415.725] * (-420.139) (-415.218) (-421.009) [-415.209] -- 0:00:00
991500 -- (-422.155) (-417.886) [-416.703] (-415.114) * (-420.556) (-415.086) [-415.920] (-415.544) -- 0:00:00
992000 -- [-419.560] (-415.899) (-415.183) (-415.773) * [-418.048] (-416.263) (-416.496) (-418.434) -- 0:00:00
992500 -- (-420.383) (-416.178) [-414.971] (-419.678) * (-416.229) (-416.513) [-415.653] (-422.050) -- 0:00:00
993000 -- [-417.313] (-414.955) (-417.491) (-418.771) * [-418.992] (-417.094) (-416.874) (-416.772) -- 0:00:00
993500 -- (-419.940) (-416.004) (-418.065) [-416.149] * (-420.061) (-416.786) [-415.796] (-416.507) -- 0:00:00
994000 -- (-416.964) (-419.754) [-418.980] (-418.021) * [-415.867] (-415.673) (-415.611) (-416.665) -- 0:00:00
994500 -- (-417.380) (-418.238) (-421.677) [-415.990] * (-415.258) (-417.573) (-419.435) [-416.654] -- 0:00:00
995000 -- [-417.819] (-416.935) (-415.890) (-418.699) * (-416.690) (-417.102) [-417.793] (-420.144) -- 0:00:00
Average standard deviation of split frequencies: 0.008579
995500 -- [-417.416] (-416.184) (-418.778) (-416.348) * (-416.831) (-417.589) (-415.309) [-418.307] -- 0:00:00
996000 -- [-417.143] (-416.118) (-417.448) (-414.844) * (-422.483) (-416.154) [-417.064] (-417.340) -- 0:00:00
996500 -- (-419.255) (-417.779) (-416.301) [-415.193] * [-417.484] (-419.119) (-422.770) (-418.850) -- 0:00:00
997000 -- (-420.097) (-415.615) (-419.125) [-418.126] * [-416.117] (-415.173) (-420.775) (-418.163) -- 0:00:00
997500 -- [-419.975] (-416.056) (-419.287) (-415.706) * (-416.948) (-417.839) [-418.193] (-418.565) -- 0:00:00
998000 -- (-414.919) (-417.095) [-417.757] (-416.102) * (-421.739) (-416.187) (-420.663) [-420.264] -- 0:00:00
998500 -- (-416.810) [-420.371] (-416.915) (-416.102) * (-419.963) (-416.366) (-418.340) [-419.889] -- 0:00:00
999000 -- (-417.619) (-418.060) [-415.888] (-417.808) * [-418.530] (-415.475) (-418.885) (-416.953) -- 0:00:00
999500 -- (-417.458) (-417.814) (-418.672) [-416.669] * (-416.152) (-417.476) (-415.938) [-417.611] -- 0:00:00
1000000 -- (-417.417) (-423.728) (-419.215) [-416.580] * (-415.912) (-419.976) [-416.116] (-416.468) -- 0:00:00
Average standard deviation of split frequencies: 0.008568
Analysis completed in 1 mins 1 seconds
Analysis used 60.11 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -414.40
Likelihood of best state for "cold" chain of run 2 was -414.40
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 56 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
38.3 % ( 19 %) Dirichlet(Pi{all})
38.4 % ( 27 %) Slider(Pi{all})
78.9 % ( 58 %) Multiplier(Alpha{1,2})
77.5 % ( 52 %) Multiplier(Alpha{3})
25.9 % ( 27 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 93 %) ParsSPR(Tau{all},V{all})
28.3 % ( 29 %) Multiplier(V{all})
97.5 % ( 95 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 74 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
39.3 % ( 32 %) Dirichlet(Pi{all})
38.5 % ( 26 %) Slider(Pi{all})
79.1 % ( 58 %) Multiplier(Alpha{1,2})
77.8 % ( 46 %) Multiplier(Alpha{3})
26.1 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.5 % ( 94 %) Nodeslider(V{all})
30.3 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166850 0.82 0.67
3 | 166283 166650 0.84
4 | 167075 166902 166240
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166902 0.82 0.67
3 | 166357 166682 0.84
4 | 166304 166414 167341
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -416.36
| 1 2 2 2 1 1 |
| 1 2 2 2 1 |
| 1 1 2 2 1 1 2 2 * 2 2 |
| 2 2 11 2122 1 1 2* * 2 1 |
| 2 1 2* 21 1 211 1 2 |
|2 1 2 2 1 2 2 2 1 1 12 |
| 2 2 1 1 21 11 11 2 2 21 21 1 * 2 2 |
| 2 2 2 2 2 1 2 2 |
|1 1 2 1 2 |
| 2 1 1 1 21 1 1 *|
| 1 2 1 |
| 1 2 1 |
| 1 |
| 1 1 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -417.79
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -416.14 -419.11
2 -416.08 -420.23
--------------------------------------
TOTAL -416.11 -419.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899483 0.089597 0.364583 1.501585 0.864806 1501.00 1501.00 1.000
r(A<->C){all} 0.163818 0.020017 0.000172 0.440772 0.122239 218.48 221.38 1.006
r(A<->G){all} 0.163237 0.019115 0.000077 0.442410 0.123656 108.44 175.65 1.000
r(A<->T){all} 0.175722 0.021346 0.000035 0.475843 0.136832 171.93 201.57 1.010
r(C<->G){all} 0.162769 0.020213 0.000006 0.463323 0.123449 252.18 262.44 1.002
r(C<->T){all} 0.172378 0.019800 0.000041 0.457056 0.137462 196.40 240.03 1.001
r(G<->T){all} 0.162076 0.018668 0.000142 0.435464 0.126256 92.93 222.73 1.011
pi(A){all} 0.240414 0.000602 0.195314 0.288970 0.239829 1205.56 1225.08 1.001
pi(C){all} 0.306584 0.000701 0.255065 0.356917 0.306737 1013.19 1199.08 1.001
pi(G){all} 0.273632 0.000670 0.227735 0.327752 0.272472 1183.58 1281.60 1.000
pi(T){all} 0.179369 0.000475 0.136185 0.220712 0.178551 1304.44 1336.90 1.000
alpha{1,2} 0.404199 0.215124 0.000154 1.305997 0.237891 950.10 1098.63 1.000
alpha{3} 0.457623 0.247215 0.000318 1.456938 0.290708 1151.13 1169.91 1.000
pinvar{all} 0.994638 0.000042 0.982411 0.999994 0.996721 1128.02 1171.28 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .*...*
9 -- .***.*
10 -- ..*.*.
11 -- .**.**
12 -- .*.*..
13 -- ...**.
14 -- ....**
15 -- ..****
16 -- .****.
17 -- .**...
18 -- .*..*.
19 -- ..**..
20 -- ...*.*
21 -- .*.***
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 469 0.156229 0.000471 0.155896 0.156562 2
8 461 0.153564 0.003298 0.151233 0.155896 2
9 460 0.153231 0.002827 0.151233 0.155230 2
10 446 0.148568 0.010364 0.141239 0.155896 2
11 437 0.145570 0.008009 0.139907 0.151233 2
12 433 0.144237 0.003298 0.141905 0.146569 2
13 425 0.141572 0.005182 0.137908 0.145237 2
14 423 0.140906 0.003298 0.138574 0.143238 2
15 420 0.139907 0.004711 0.136576 0.143238 2
16 418 0.139241 0.017901 0.126582 0.151899 2
17 418 0.139241 0.021670 0.123917 0.154564 2
18 412 0.137242 0.017901 0.124584 0.149900 2
19 411 0.136909 0.008951 0.130580 0.143238 2
20 404 0.134577 0.006595 0.129913 0.139241 2
21 403 0.134244 0.006124 0.129913 0.138574 2
22 277 0.092272 0.016488 0.080613 0.103931 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099371 0.010011 0.000020 0.301515 0.068390 1.000 2
length{all}[2] 0.098046 0.009238 0.000001 0.289799 0.068034 1.000 2
length{all}[3] 0.105448 0.011313 0.000021 0.309723 0.071318 1.000 2
length{all}[4] 0.101493 0.010281 0.000031 0.307907 0.068077 1.000 2
length{all}[5] 0.097471 0.009243 0.000002 0.290063 0.068112 1.000 2
length{all}[6] 0.101690 0.010091 0.000113 0.296070 0.071213 1.000 2
length{all}[7] 0.102043 0.011480 0.000656 0.309110 0.064699 0.999 2
length{all}[8] 0.100091 0.009413 0.000120 0.306051 0.071353 1.004 2
length{all}[9] 0.092546 0.008862 0.000167 0.272909 0.062200 0.999 2
length{all}[10] 0.097728 0.008509 0.000002 0.276734 0.070511 0.998 2
length{all}[11] 0.096670 0.009086 0.000390 0.289503 0.064486 0.998 2
length{all}[12] 0.095039 0.010040 0.000431 0.310179 0.061959 0.998 2
length{all}[13] 0.095370 0.007367 0.000289 0.270374 0.070224 1.001 2
length{all}[14] 0.097533 0.008932 0.000374 0.287445 0.070424 1.003 2
length{all}[15] 0.096336 0.010156 0.000317 0.298254 0.065127 0.998 2
length{all}[16] 0.108851 0.012442 0.000540 0.319376 0.076659 0.998 2
length{all}[17] 0.102699 0.009934 0.000052 0.294899 0.072021 0.998 2
length{all}[18] 0.097172 0.009784 0.000291 0.300282 0.065019 0.998 2
length{all}[19] 0.103556 0.009399 0.000094 0.292130 0.077643 1.004 2
length{all}[20] 0.111969 0.012729 0.000464 0.358380 0.074318 0.998 2
length{all}[21] 0.093782 0.008491 0.000015 0.271456 0.063540 1.002 2
length{all}[22] 0.095287 0.008515 0.000064 0.278566 0.069948 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008568
Maximum standard deviation of split frequencies = 0.021670
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 303
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 43 patterns at 101 / 101 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 43 patterns at 101 / 101 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
41968 bytes for conP
3784 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.035282 0.104080 0.018997 0.103628 0.071882 0.042702 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -427.335948
Iterating by ming2
Initial: fx= 427.335948
x= 0.03528 0.10408 0.01900 0.10363 0.07188 0.04270 0.30000 1.30000
1 h-m-p 0.0000 0.0002 241.2173 +++ 416.187493 m 0.0002 14 | 1/8
2 h-m-p 0.0010 0.0070 43.4579 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 220.6272 +++ 408.167734 m 0.0002 46 | 2/8
4 h-m-p 0.0009 0.0089 34.1933 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 197.6049 ++ 405.234938 m 0.0001 77 | 3/8
6 h-m-p 0.0005 0.0114 26.9815 -----------.. | 3/8
7 h-m-p 0.0000 0.0003 170.9559 +++ 396.535005 m 0.0003 109 | 4/8
8 h-m-p 0.0021 0.0158 19.6416 ------------.. | 4/8
9 h-m-p 0.0000 0.0003 140.0811 +++ 390.139181 m 0.0003 142 | 5/8
10 h-m-p 0.0028 0.0283 11.3977 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 99.6561 ++ 390.093183 m 0.0000 174 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 Y 390.093183 0 0.0160 185 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 ++ 390.093183 m 8.0000 198
Out..
lnL = -390.093183
199 lfun, 199 eigenQcodon, 1194 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072220 0.106807 0.103950 0.017874 0.044039 0.016522 0.299772 0.697596 0.265198
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.186133
np = 9
lnL0 = -424.228936
Iterating by ming2
Initial: fx= 424.228936
x= 0.07222 0.10681 0.10395 0.01787 0.04404 0.01652 0.29977 0.69760 0.26520
1 h-m-p 0.0000 0.0002 220.7801 +++ 415.269415 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0000 165.9014 ++ 414.615884 m 0.0000 27 | 2/9
3 h-m-p 0.0001 0.0005 103.9014 ++ 406.021357 m 0.0005 39 | 3/9
4 h-m-p 0.0002 0.0008 139.6586 ++ 397.806656 m 0.0008 51 | 4/9
5 h-m-p 0.0000 0.0000 9046.3798 ++ 390.480101 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0001 327.2579 ++ 390.093190 m 0.0001 75 | 6/9
7 h-m-p 1.0701 8.0000 0.0252 ++ 390.093186 m 8.0000 87 | 6/9
8 h-m-p 1.6000 8.0000 0.0951 ++ 390.093183 m 8.0000 102 | 6/9
9 h-m-p 0.5761 2.8804 0.0882 ++ 390.093183 m 2.8804 117 | 7/9
10 h-m-p 0.4358 2.1792 0.0649 ++ 390.093183 m 2.1792 132 | 7/9
11 h-m-p 0.0012 0.0088 113.7358 -----------.. | 7/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 390.093183 m 8.0000 170 | 7/9
13 h-m-p 0.0754 8.0000 0.0022 ++++ 390.093183 m 8.0000 186 | 7/9
14 h-m-p 0.0030 0.0148 1.2158 --------C 390.093183 0 0.0000 208 | 7/9
15 h-m-p 0.0908 8.0000 0.0000 --------------.. | 7/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 390.093183 m 8.0000 249 | 7/9
17 h-m-p 0.0160 8.0000 0.2903 -------------.. | 7/9
18 h-m-p 0.0160 8.0000 0.0000 +++++ 390.093183 m 8.0000 291 | 7/9
19 h-m-p 0.0003 0.1557 1.7181 +++++ 390.093177 m 0.1557 308 | 8/9
20 h-m-p 0.0160 8.0000 0.0000 N 390.093177 0 0.0160 320 | 8/9
21 h-m-p 0.0160 8.0000 0.0000 N 390.093177 0 0.0160 333
Out..
lnL = -390.093177
334 lfun, 1002 eigenQcodon, 4008 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.026899 0.031649 0.013771 0.072398 0.078648 0.074598 0.000100 1.144028 0.444624 0.346278 1.419105
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.584785
np = 11
lnL0 = -418.390037
Iterating by ming2
Initial: fx= 418.390037
x= 0.02690 0.03165 0.01377 0.07240 0.07865 0.07460 0.00011 1.14403 0.44462 0.34628 1.41911
1 h-m-p 0.0000 0.0000 223.1706 ++ 418.048765 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0009 100.0648 +++ 410.222221 m 0.0009 31 | 2/11
3 h-m-p 0.0001 0.0004 72.5183 ++ 404.946012 m 0.0004 45 | 3/11
4 h-m-p 0.0003 0.0014 30.9750 ++ 403.004631 m 0.0014 59 | 4/11
5 h-m-p 0.0001 0.0007 181.8923 ++ 391.087818 m 0.0007 73 | 5/11
6 h-m-p 0.0001 0.0007 52.2866 ++ 390.564452 m 0.0007 87 | 6/11
7 h-m-p 0.0001 0.0004 203.3719 ++ 390.454877 m 0.0004 101 | 7/11
8 h-m-p 0.0034 1.6778 78.4544 ------------.. | 7/11
9 h-m-p 0.0000 0.0000 99.0707 ++ 390.093180 m 0.0000 139 | 8/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 390.093180 m 8.0000 156 | 8/11
11 h-m-p 0.0160 8.0000 0.0021 +++++ 390.093180 m 8.0000 176 | 8/11
12 h-m-p 0.0160 8.0000 1.3292 ++++Y 390.093176 0 4.0960 197 | 8/11
13 h-m-p 1.6000 8.0000 0.0255 ++ 390.093176 m 8.0000 211 | 8/11
14 h-m-p 0.6338 8.0000 0.3214 --------Y 390.093176 0 0.0000 236 | 8/11
15 h-m-p 0.0160 8.0000 0.0001 Y 390.093176 0 0.0160 253 | 8/11
16 h-m-p 0.0160 8.0000 0.0001 -Y 390.093176 0 0.0010 271 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 -N 390.093176 0 0.0010 289
Out..
lnL = -390.093176
290 lfun, 1160 eigenQcodon, 5220 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -390.095972 S = -390.091265 -0.001798
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 43 patterns 0:03
did 20 / 43 patterns 0:03
did 30 / 43 patterns 0:03
did 40 / 43 patterns 0:03
did 43 / 43 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.094263 0.089328 0.087815 0.022486 0.087646 0.024372 0.000100 1.009070 1.676701
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.889463
np = 9
lnL0 = -428.303778
Iterating by ming2
Initial: fx= 428.303778
x= 0.09426 0.08933 0.08782 0.02249 0.08765 0.02437 0.00011 1.00907 1.67670
1 h-m-p 0.0000 0.0000 218.9622 ++ 428.121636 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0386 26.0781 +++++ 416.762819 m 0.0386 29 | 2/9
3 h-m-p 0.0003 0.0016 89.2924 ++ 407.411581 m 0.0016 41 | 3/9
4 h-m-p 0.0001 0.0006 23.6721 ++ 404.537962 m 0.0006 53 | 4/9
5 h-m-p 0.0001 0.0005 6.7984 ----------.. | 4/9
6 h-m-p 0.0000 0.0000 191.6885 ++ 403.986641 m 0.0000 85 | 5/9
7 h-m-p 0.0010 0.2917 2.5470 -----------.. | 5/9
8 h-m-p 0.0000 0.0000 163.7544 ++ 403.900593 m 0.0000 118 | 6/9
9 h-m-p 0.0160 8.0000 1.0866 -------------.. | 6/9
10 h-m-p 0.0000 0.0008 129.5129 ++++ 390.337122 m 0.0008 155 | 7/9
11 h-m-p 0.0857 8.0000 0.8247 --------------.. | 7/9
12 h-m-p 0.0000 0.0000 100.0140 ++ 390.093198 m 0.0000 193 | 8/9
13 h-m-p 1.1401 8.0000 0.0000 Y 390.093198 0 1.1401 205 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 +++++ 390.093198 m 8.0000 221 | 7/9
15 h-m-p 0.0070 0.0349 0.0010 ----Y 390.093198 0 0.0000 239
Out..
lnL = -390.093198
240 lfun, 2640 eigenQcodon, 14400 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.014903 0.068017 0.078002 0.030295 0.078414 0.063792 0.000133 0.900000 1.026044 1.024592 1.300022
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.402834
np = 11
lnL0 = -421.638257
Iterating by ming2
Initial: fx= 421.638257
x= 0.01490 0.06802 0.07800 0.03030 0.07841 0.06379 0.00013 0.90000 1.02604 1.02459 1.30002
1 h-m-p 0.0000 0.0000 221.0781 ++ 419.788947 m 0.0000 16 | 1/11
2 h-m-p 0.0002 0.0036 50.8850 +++ 412.051271 m 0.0036 31 | 2/11
3 h-m-p 0.0001 0.0006 98.8806 ++ 404.856413 m 0.0006 45 | 3/11
4 h-m-p 0.0008 0.0075 72.3462 ++ 392.427345 m 0.0075 59 | 4/11
5 h-m-p 0.0000 0.0000 3377.8848 ++ 391.479144 m 0.0000 73 | 5/11
6 h-m-p 0.0002 0.0024 303.0732 ++ 390.139320 m 0.0024 87 | 6/11
7 h-m-p 0.0051 0.0255 57.4685 ------------.. | 6/11
8 h-m-p 0.0000 0.0000 140.5501 ++ 390.110724 m 0.0000 125 | 7/11
9 h-m-p 0.0065 3.2508 0.3487 ------------.. | 7/11
10 h-m-p 0.0000 0.0000 99.4308 ++ 390.093178 m 0.0000 167 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 C 390.093178 0 0.0160 181 | 8/11
12 h-m-p 0.2872 8.0000 0.0000 Y 390.093178 0 0.0718 198
Out..
lnL = -390.093178
199 lfun, 2388 eigenQcodon, 13134 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -390.099882 S = -390.091443 -0.003701
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 43 patterns 0:10
did 20 / 43 patterns 0:10
did 30 / 43 patterns 0:11
did 40 / 43 patterns 0:11
did 43 / 43 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=101
NC_011896_1_WP_010908587_1_1991_MLBR_RS09450 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
NC_002677_1_NP_302266_1_1138_rpsJ VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
**************************************************
NC_011896_1_WP_010908587_1_1991_MLBR_RS09450 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
NC_002677_1_NP_302266_1_1138_rpsJ VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520 VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
**************************************************
NC_011896_1_WP_010908587_1_1991_MLBR_RS09450 Q
NC_002677_1_NP_302266_1_1138_rpsJ Q
NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565 Q
NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185 Q
NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250 Q
NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520 Q
*
>NC_011896_1_WP_010908587_1_1991_MLBR_RS09450 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC CAG >NC_002677_1_NP_302266_1_1138_rpsJ GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC CAG >NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC CAG >NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC CAG >NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC CAG >NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520 GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC CAG
>NC_011896_1_WP_010908587_1_1991_MLBR_RS09450 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI Q >NC_002677_1_NP_302266_1_1138_rpsJ VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI Q >NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI Q >NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI Q >NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI Q >NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520 VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI Q
#NEXUS
[ID: 0214631674]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908587_1_1991_MLBR_RS09450
NC_002677_1_NP_302266_1_1138_rpsJ
NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565
NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185
NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250
NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908587_1_1991_MLBR_RS09450,
2 NC_002677_1_NP_302266_1_1138_rpsJ,
3 NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565,
4 NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185,
5 NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250,
6 NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06839037,2:0.06803364,3:0.07131789,4:0.06807676,5:0.06811239,6:0.07121324);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06839037,2:0.06803364,3:0.07131789,4:0.06807676,5:0.06811239,6:0.07121324);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -416.14 -419.11
2 -416.08 -420.23
--------------------------------------
TOTAL -416.11 -419.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899483 0.089597 0.364583 1.501585 0.864806 1501.00 1501.00 1.000
r(A<->C){all} 0.163818 0.020017 0.000172 0.440772 0.122239 218.48 221.38 1.006
r(A<->G){all} 0.163237 0.019115 0.000077 0.442410 0.123656 108.44 175.65 1.000
r(A<->T){all} 0.175722 0.021346 0.000035 0.475843 0.136832 171.93 201.57 1.010
r(C<->G){all} 0.162769 0.020213 0.000006 0.463323 0.123449 252.18 262.44 1.002
r(C<->T){all} 0.172378 0.019800 0.000041 0.457056 0.137462 196.40 240.03 1.001
r(G<->T){all} 0.162076 0.018668 0.000142 0.435464 0.126256 92.93 222.73 1.011
pi(A){all} 0.240414 0.000602 0.195314 0.288970 0.239829 1205.56 1225.08 1.001
pi(C){all} 0.306584 0.000701 0.255065 0.356917 0.306737 1013.19 1199.08 1.001
pi(G){all} 0.273632 0.000670 0.227735 0.327752 0.272472 1183.58 1281.60 1.000
pi(T){all} 0.179369 0.000475 0.136185 0.220712 0.178551 1304.44 1336.90 1.000
alpha{1,2} 0.404199 0.215124 0.000154 1.305997 0.237891 950.10 1098.63 1.000
alpha{3} 0.457623 0.247215 0.000318 1.456938 0.290708 1151.13 1169.91 1.000
pinvar{all} 0.994638 0.000042 0.982411 0.999994 0.996721 1128.02 1171.28 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpsJ/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 101
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 3 3 3 3 3 3 | CGC 5 5 5 5 5 5
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 2 2 2 2 2 2 | CCG 5 5 5 5 5 5 | CAG 2 2 2 2 2 2 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 7 7 7 7 7 7 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 7 7 7 7 7 7 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 4 4 4 4 4 4 | Gly GGT 2 2 2 2 2 2
GTC 6 6 6 6 6 6 | GCC 5 5 5 5 5 5 | GAC 4 4 4 4 4 4 | GGC 0 0 0 0 0 0
GTA 2 2 2 2 2 2 | GCA 0 0 0 0 0 0 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 3 3 3 3 3 3 | GCG 2 2 2 2 2 2 | GAG 4 4 4 4 4 4 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908587_1_1991_MLBR_RS09450
position 1: T:0.07921 C:0.26733 A:0.29703 G:0.35644
position 2: T:0.29703 C:0.23762 A:0.32673 G:0.13861
position 3: T:0.15842 C:0.41584 A:0.09901 G:0.32673
Average T:0.17822 C:0.30693 A:0.24092 G:0.27393
#2: NC_002677_1_NP_302266_1_1138_rpsJ
position 1: T:0.07921 C:0.26733 A:0.29703 G:0.35644
position 2: T:0.29703 C:0.23762 A:0.32673 G:0.13861
position 3: T:0.15842 C:0.41584 A:0.09901 G:0.32673
Average T:0.17822 C:0.30693 A:0.24092 G:0.27393
#3: NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565
position 1: T:0.07921 C:0.26733 A:0.29703 G:0.35644
position 2: T:0.29703 C:0.23762 A:0.32673 G:0.13861
position 3: T:0.15842 C:0.41584 A:0.09901 G:0.32673
Average T:0.17822 C:0.30693 A:0.24092 G:0.27393
#4: NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185
position 1: T:0.07921 C:0.26733 A:0.29703 G:0.35644
position 2: T:0.29703 C:0.23762 A:0.32673 G:0.13861
position 3: T:0.15842 C:0.41584 A:0.09901 G:0.32673
Average T:0.17822 C:0.30693 A:0.24092 G:0.27393
#5: NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250
position 1: T:0.07921 C:0.26733 A:0.29703 G:0.35644
position 2: T:0.29703 C:0.23762 A:0.32673 G:0.13861
position 3: T:0.15842 C:0.41584 A:0.09901 G:0.32673
Average T:0.17822 C:0.30693 A:0.24092 G:0.27393
#6: NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520
position 1: T:0.07921 C:0.26733 A:0.29703 G:0.35644
position 2: T:0.29703 C:0.23762 A:0.32673 G:0.13861
position 3: T:0.15842 C:0.41584 A:0.09901 G:0.32673
Average T:0.17822 C:0.30693 A:0.24092 G:0.27393
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 6 | TCC 0 | TAC 18 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 18 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 6
CTC 12 | CCC 0 | CAC 18 | CGC 30
CTA 0 | CCA 12 | Gln Q CAA 0 | CGA 6
CTG 12 | CCG 30 | CAG 12 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 6
ATC 42 | ACC 18 | AAC 12 | AGC 0
ATA 6 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 12 | ACG 6 | AAG 42 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 24 | Gly G GGT 12
GTC 36 | GCC 30 | GAC 24 | GGC 0
GTA 12 | GCA 0 | Glu E GAA 6 | GGA 6
GTG 18 | GCG 12 | GAG 24 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.07921 C:0.26733 A:0.29703 G:0.35644
position 2: T:0.29703 C:0.23762 A:0.32673 G:0.13861
position 3: T:0.15842 C:0.41584 A:0.09901 G:0.32673
Average T:0.17822 C:0.30693 A:0.24092 G:0.27393
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -390.093183 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299772 1.300022
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908587_1_1991_MLBR_RS09450: 0.000004, NC_002677_1_NP_302266_1_1138_rpsJ: 0.000004, NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565: 0.000004, NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185: 0.000004, NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250: 0.000004, NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29977
omega (dN/dS) = 1.30002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 249.7 53.3 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 249.7 53.3 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 249.7 53.3 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 249.7 53.3 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 249.7 53.3 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 249.7 53.3 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -390.093177 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000105 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908587_1_1991_MLBR_RS09450: 0.000004, NC_002677_1_NP_302266_1_1138_rpsJ: 0.000004, NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565: 0.000004, NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185: 0.000004, NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250: 0.000004, NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00010 0.99990
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 253.6 49.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 253.6 49.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 253.6 49.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 253.6 49.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 253.6 49.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 253.6 49.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -390.093176 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.001804 0.950540 0.000001 1.954540
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908587_1_1991_MLBR_RS09450: 0.000004, NC_002677_1_NP_302266_1_1138_rpsJ: 0.000004, NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565: 0.000004, NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185: 0.000004, NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250: 0.000004, NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00180 0.95054 0.04766
w: 0.00000 1.00000 1.95454
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 253.6 49.4 1.0437 0.0000 0.0000 0.0 0.0
7..2 0.000 253.6 49.4 1.0437 0.0000 0.0000 0.0 0.0
7..3 0.000 253.6 49.4 1.0437 0.0000 0.0000 0.0 0.0
7..4 0.000 253.6 49.4 1.0437 0.0000 0.0000 0.0 0.0
7..5 0.000 253.6 49.4 1.0437 0.0000 0.0000 0.0 0.0
7..6 0.000 253.6 49.4 1.0437 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908587_1_1991_MLBR_RS09450)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908587_1_1991_MLBR_RS09450)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -390.093198 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000133 0.005000 1.728387
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908587_1_1991_MLBR_RS09450: 0.000004, NC_002677_1_NP_302266_1_1138_rpsJ: 0.000004, NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565: 0.000004, NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185: 0.000004, NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250: 0.000004, NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00013
Parameters in M7 (beta):
p = 0.00500 q = 1.72839
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 253.6 49.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 253.6 49.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 253.6 49.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 253.6 49.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 253.6 49.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 253.6 49.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -390.093178 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.681588 0.005000 1.643611 2.218684
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908587_1_1991_MLBR_RS09450: 0.000004, NC_002677_1_NP_302266_1_1138_rpsJ: 0.000004, NZ_LVXE01000034_1_WP_010908587_1_1544_A3216_RS09565: 0.000004, NZ_LYPH01000037_1_WP_010908587_1_1500_A8144_RS07185: 0.000004, NZ_CP029543_1_WP_010908587_1_2014_DIJ64_RS10250: 0.000004, NZ_AP014567_1_WP_010908587_1_2068_JK2ML_RS10520: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.68159 p = 0.00500 q = 1.64361
(p1 = 0.31841) w = 2.21868
MLEs of dN/dS (w) for site classes (K=11)
p: 0.06816 0.06816 0.06816 0.06816 0.06816 0.06816 0.06816 0.06816 0.06816 0.06816 0.31841
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.21868
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 253.6 49.4 0.7065 0.0000 0.0000 0.0 0.0
7..2 0.000 253.6 49.4 0.7065 0.0000 0.0000 0.0 0.0
7..3 0.000 253.6 49.4 0.7065 0.0000 0.0000 0.0 0.0
7..4 0.000 253.6 49.4 0.7065 0.0000 0.0000 0.0 0.0
7..5 0.000 253.6 49.4 0.7065 0.0000 0.0000 0.0 0.0
7..6 0.000 253.6 49.4 0.7065 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908587_1_1991_MLBR_RS09450)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908587_1_1991_MLBR_RS09450)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Time used: 0:11
Model 1: NearlyNeutral -390.093177 Model 2: PositiveSelection -390.093176 Model 0: one-ratio -390.093183 Model 7: beta -390.093198 Model 8: beta&w>1 -390.093178 Model 0 vs 1 1.1999999969702912E-5 Model 2 vs 1 1.9999999949504854E-6 Model 8 vs 7 3.999999989900971E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
