--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:22:44 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsJ/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -416.14          -419.11
2       -416.08          -420.23
--------------------------------------
TOTAL     -416.11          -419.82
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.899483    0.089597    0.364583    1.501585    0.864806   1501.00   1501.00    1.000
r(A<->C){all}   0.163818    0.020017    0.000172    0.440772    0.122239    218.48    221.38    1.006
r(A<->G){all}   0.163237    0.019115    0.000077    0.442410    0.123656    108.44    175.65    1.000
r(A<->T){all}   0.175722    0.021346    0.000035    0.475843    0.136832    171.93    201.57    1.010
r(C<->G){all}   0.162769    0.020213    0.000006    0.463323    0.123449    252.18    262.44    1.002
r(C<->T){all}   0.172378    0.019800    0.000041    0.457056    0.137462    196.40    240.03    1.001
r(G<->T){all}   0.162076    0.018668    0.000142    0.435464    0.126256     92.93    222.73    1.011
pi(A){all}      0.240414    0.000602    0.195314    0.288970    0.239829   1205.56   1225.08    1.001
pi(C){all}      0.306584    0.000701    0.255065    0.356917    0.306737   1013.19   1199.08    1.001
pi(G){all}      0.273632    0.000670    0.227735    0.327752    0.272472   1183.58   1281.60    1.000
pi(T){all}      0.179369    0.000475    0.136185    0.220712    0.178551   1304.44   1336.90    1.000
alpha{1,2}      0.404199    0.215124    0.000154    1.305997    0.237891    950.10   1098.63    1.000
alpha{3}        0.457623    0.247215    0.000318    1.456938    0.290708   1151.13   1169.91    1.000
pinvar{all}     0.994638    0.000042    0.982411    0.999994    0.996721   1128.02   1171.28    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-390.093177
Model 2: PositiveSelection	-390.093176
Model 0: one-ratio	-390.093183
Model 7: beta	-390.093198
Model 8: beta&w>1	-390.093178


Model 0 vs 1	1.1999999969702912E-5

Model 2 vs 1	1.9999999949504854E-6

Model 8 vs 7	3.999999989900971E-5
>C1
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C2
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C3
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C4
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C5
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C6
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=101 

C1              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C2              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C3              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C4              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C5              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C6              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
                **************************************************

C1              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C2              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C3              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C4              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C5              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C6              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
                **************************************************

C1              Q
C2              Q
C3              Q
C4              Q
C5              Q
C6              Q
                *




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  101 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  101 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3030]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3030]--->[3030]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.626 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C2              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C3              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C4              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C5              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
C6              VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
                **************************************************

C1              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C2              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C3              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C4              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C5              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
C6              VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
                **************************************************

C1              Q
C2              Q
C3              Q
C4              Q
C5              Q
C6              Q
                *




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
C2              GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
C3              GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
C4              GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
C5              GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
C6              GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
                **************************************************

C1              GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
C2              GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
C3              GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
C4              GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
C5              GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
C6              GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
                **************************************************

C1              CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
C2              CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
C3              CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
C4              CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
C5              CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
C6              CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
                **************************************************

C1              GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
C2              GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
C3              GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
C4              GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
C5              GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
C6              GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
                **************************************************

C1              GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
C2              GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
C3              GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
C4              GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
C5              GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
C6              GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
                **************************************************

C1              TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
C2              TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
C3              TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
C4              TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
C5              TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
C6              TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
                **************************************************

C1              CAG
C2              CAG
C3              CAG
C4              CAG
C5              CAG
C6              CAG
                ***



>C1
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C2
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C3
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C4
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C5
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C6
GTGGCGGGACAGAAGATCCGCATCAGGCTCAAGGCCTACGACCATGAGGC
GATTGACGCCTCGGCTCGCAAAATCGTCGAGACCGTCGTACGCACCGGTG
CCAACGTCGTAGGTCCGGTGCCACTGCCGACTGAGAAGAATGTGTACTGC
GTCATCCGCTCGCCGCACAAGTACAAGGATTCGCGAGAGCACTTCGAAAT
GCGCACCCACAAGCGGCTGATAGACATCCTTGATCCAACACCGAAGACGG
TTGACGCCCTCATGCGTATCGATCTTCCGGCCAGTGTCGATGTCAACATC
CAG
>C1
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C2
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C3
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C4
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C5
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
>C6
VAGQKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 303 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579792888
      Setting output file names to "/data/11res/rpsJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 229057237
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0214631674
      Seed = 88239764
      Swapseed = 1579792888
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -678.128528 -- -24.965149
         Chain 2 -- -678.128490 -- -24.965149
         Chain 3 -- -678.128528 -- -24.965149
         Chain 4 -- -678.128425 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -678.128528 -- -24.965149
         Chain 2 -- -678.128528 -- -24.965149
         Chain 3 -- -678.128425 -- -24.965149
         Chain 4 -- -678.128425 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-678.129] (-678.128) (-678.129) (-678.128) * [-678.129] (-678.129) (-678.128) (-678.128) 
        500 -- [-425.856] (-424.173) (-425.127) (-430.859) * (-424.595) (-427.023) [-424.858] (-429.470) -- 0:00:00
       1000 -- [-435.531] (-426.529) (-425.808) (-422.767) * (-428.711) (-428.612) (-430.695) [-422.989] -- 0:00:00
       1500 -- (-426.395) (-427.346) [-428.708] (-427.528) * [-423.407] (-427.783) (-428.140) (-422.087) -- 0:00:00
       2000 -- (-421.191) (-422.457) [-426.797] (-430.016) * [-427.425] (-424.519) (-431.113) (-430.267) -- 0:00:00
       2500 -- (-424.164) (-431.581) (-424.424) [-422.049] * (-433.914) (-429.958) [-430.794] (-430.226) -- 0:00:00
       3000 -- (-429.094) (-428.506) (-423.511) [-420.243] * (-423.651) (-423.736) (-427.735) [-424.911] -- 0:00:00
       3500 -- [-420.785] (-421.540) (-422.060) (-429.846) * (-423.141) (-428.500) (-423.265) [-429.302] -- 0:00:00
       4000 -- (-427.269) [-425.846] (-427.878) (-430.687) * (-426.662) (-426.972) (-431.660) [-424.135] -- 0:00:00
       4500 -- [-424.393] (-422.181) (-424.377) (-425.595) * (-432.458) (-433.271) (-426.460) [-426.692] -- 0:00:00
       5000 -- (-422.538) (-434.537) [-421.740] (-426.258) * (-419.428) (-423.156) [-423.973] (-421.691) -- 0:00:00

      Average standard deviation of split frequencies: 0.088815

       5500 -- (-421.234) (-425.409) [-426.446] (-423.420) * (-433.925) [-424.987] (-430.303) (-424.723) -- 0:00:00
       6000 -- [-419.619] (-423.881) (-424.351) (-424.568) * [-421.748] (-425.210) (-426.607) (-432.313) -- 0:00:00
       6500 -- [-421.795] (-423.148) (-425.676) (-430.228) * (-428.819) (-421.280) [-420.992] (-424.044) -- 0:00:00
       7000 -- [-429.793] (-423.677) (-422.856) (-425.840) * (-421.378) (-428.553) [-430.198] (-430.909) -- 0:00:00
       7500 -- (-433.637) (-422.389) [-423.049] (-428.226) * [-423.348] (-425.846) (-425.812) (-430.798) -- 0:00:00
       8000 -- [-423.105] (-423.777) (-432.591) (-420.632) * (-435.524) [-425.661] (-431.107) (-430.025) -- 0:00:00
       8500 -- [-435.490] (-431.474) (-422.938) (-424.873) * (-424.442) [-433.029] (-428.633) (-427.972) -- 0:00:00
       9000 -- (-432.336) (-435.533) (-440.201) [-425.391] * (-421.620) (-430.358) (-426.180) [-421.463] -- 0:01:50
       9500 -- (-424.516) (-423.187) (-437.811) [-428.886] * [-421.841] (-423.103) (-433.903) (-421.900) -- 0:01:44
      10000 -- [-424.055] (-428.834) (-418.384) (-424.035) * (-421.949) (-433.676) [-425.230] (-420.423) -- 0:01:39

      Average standard deviation of split frequencies: 0.077990

      10500 -- (-429.989) (-430.370) [-419.816] (-428.156) * (-424.011) [-431.326] (-436.439) (-421.509) -- 0:01:34
      11000 -- (-435.090) [-424.675] (-415.118) (-427.462) * (-425.024) (-426.064) (-426.513) [-423.178] -- 0:01:29
      11500 -- (-430.160) (-429.186) (-416.918) [-425.875] * (-431.160) (-422.195) [-426.254] (-432.514) -- 0:01:25
      12000 -- (-416.447) (-425.796) (-417.035) [-421.564] * (-427.352) (-430.156) [-431.693] (-430.194) -- 0:01:22
      12500 -- (-421.035) [-428.257] (-419.219) (-421.986) * [-426.283] (-430.030) (-433.154) (-426.537) -- 0:01:19
      13000 -- [-417.449] (-427.814) (-417.506) (-426.911) * [-424.022] (-427.501) (-423.861) (-418.672) -- 0:01:15
      13500 -- (-419.513) (-426.748) [-417.006] (-426.683) * [-427.341] (-428.181) (-425.248) (-418.707) -- 0:01:13
      14000 -- [-417.633] (-430.892) (-414.931) (-427.088) * (-423.470) (-431.704) (-427.209) [-415.943] -- 0:01:10
      14500 -- (-416.479) [-426.915] (-415.500) (-428.948) * (-428.949) (-423.875) (-431.409) [-418.858] -- 0:01:07
      15000 -- (-416.070) (-427.388) (-414.850) [-425.846] * (-436.611) [-424.552] (-429.197) (-418.698) -- 0:01:05

      Average standard deviation of split frequencies: 0.047468

      15500 -- (-416.620) [-426.256] (-414.809) (-425.810) * (-427.515) (-423.405) (-422.560) [-415.689] -- 0:01:03
      16000 -- [-415.076] (-432.726) (-414.706) (-435.629) * [-420.683] (-426.421) (-421.724) (-419.347) -- 0:01:01
      16500 -- (-416.612) (-433.918) [-414.831] (-421.609) * (-435.494) (-425.610) [-421.165] (-421.036) -- 0:00:59
      17000 -- (-416.907) (-424.964) (-417.775) [-426.472] * (-427.460) (-436.025) [-430.216] (-414.824) -- 0:00:57
      17500 -- (-415.749) (-429.332) (-415.891) [-421.597] * (-416.032) [-422.420] (-430.947) (-418.914) -- 0:00:56
      18000 -- (-418.806) (-422.486) (-418.107) [-424.236] * (-419.182) [-426.196] (-424.343) (-415.873) -- 0:00:54
      18500 -- (-417.543) [-425.797] (-415.771) (-432.580) * (-415.226) (-431.775) (-431.042) [-416.889] -- 0:00:53
      19000 -- (-416.221) (-422.070) [-416.485] (-426.362) * (-416.555) (-429.936) (-430.062) [-416.630] -- 0:00:51
      19500 -- [-415.174] (-417.998) (-419.113) (-426.701) * (-416.063) (-432.928) [-426.791] (-415.634) -- 0:00:50
      20000 -- (-416.222) (-432.844) (-416.126) [-422.716] * (-417.307) [-426.506] (-433.884) (-415.443) -- 0:00:49

      Average standard deviation of split frequencies: 0.055758

      20500 -- [-415.726] (-433.663) (-417.343) (-430.796) * (-422.601) [-417.118] (-434.542) (-416.427) -- 0:00:47
      21000 -- (-416.177) (-429.072) (-419.530) [-425.553] * (-416.579) [-416.608] (-445.913) (-418.033) -- 0:00:46
      21500 -- [-414.884] (-424.457) (-417.903) (-427.954) * (-417.932) (-428.897) (-428.683) [-420.200] -- 0:00:45
      22000 -- [-419.363] (-431.348) (-418.315) (-422.178) * (-417.012) (-418.177) [-419.110] (-420.542) -- 0:00:44
      22500 -- (-416.378) (-438.866) [-414.836] (-427.937) * (-415.259) (-416.770) (-415.300) [-416.668] -- 0:00:43
      23000 -- [-414.789] (-421.010) (-416.513) (-426.745) * (-417.185) [-416.278] (-416.660) (-417.558) -- 0:00:42
      23500 -- (-418.169) (-422.604) (-415.448) [-424.795] * (-417.052) [-416.861] (-417.484) (-416.173) -- 0:00:41
      24000 -- (-416.999) [-421.796] (-416.332) (-437.579) * (-421.900) (-414.806) (-417.682) [-417.606] -- 0:00:40
      24500 -- [-414.689] (-427.626) (-415.060) (-427.631) * (-418.460) (-415.530) (-419.775) [-418.309] -- 0:00:39
      25000 -- [-415.341] (-434.862) (-419.253) (-431.573) * (-418.409) [-415.892] (-417.615) (-415.091) -- 0:00:39

      Average standard deviation of split frequencies: 0.050364

      25500 -- (-416.932) (-427.909) (-418.137) [-423.305] * (-417.655) (-415.839) (-416.720) [-415.471] -- 0:00:38
      26000 -- (-417.147) (-425.451) (-416.109) [-422.367] * (-416.048) [-416.158] (-415.831) (-419.252) -- 0:01:14
      26500 -- (-417.302) (-426.062) [-415.617] (-430.322) * [-415.602] (-417.845) (-417.419) (-418.101) -- 0:01:13
      27000 -- [-415.474] (-428.151) (-417.623) (-424.293) * (-418.480) (-416.363) [-417.377] (-417.601) -- 0:01:12
      27500 -- (-415.420) (-423.163) [-414.926] (-428.749) * [-417.626] (-418.194) (-426.717) (-417.338) -- 0:01:10
      28000 -- (-415.940) [-424.390] (-417.141) (-430.408) * (-418.201) [-418.532] (-418.431) (-417.514) -- 0:01:09
      28500 -- (-416.249) (-425.039) (-416.693) [-429.475] * (-415.330) [-418.123] (-418.468) (-416.462) -- 0:01:08
      29000 -- (-418.473) (-433.760) (-417.676) [-426.821] * (-418.107) (-415.025) [-416.300] (-416.292) -- 0:01:06
      29500 -- (-417.407) (-440.822) [-418.094] (-436.974) * (-418.783) [-417.915] (-415.882) (-417.146) -- 0:01:05
      30000 -- [-415.812] (-415.865) (-417.255) (-432.224) * [-417.454] (-415.293) (-415.662) (-418.119) -- 0:01:04

      Average standard deviation of split frequencies: 0.046116

      30500 -- (-417.166) (-417.379) [-416.901] (-415.841) * (-416.171) (-416.263) [-415.359] (-420.792) -- 0:01:03
      31000 -- [-415.983] (-416.658) (-415.395) (-417.155) * (-415.254) (-416.095) [-418.130] (-418.101) -- 0:01:02
      31500 -- (-418.104) [-417.465] (-417.121) (-416.389) * [-415.657] (-426.331) (-417.328) (-419.554) -- 0:01:01
      32000 -- (-418.499) (-418.230) [-416.730] (-419.663) * (-414.902) [-416.306] (-416.931) (-422.312) -- 0:01:00
      32500 -- (-416.524) (-419.230) (-418.119) [-416.180] * (-417.001) (-418.394) (-417.506) [-416.396] -- 0:00:59
      33000 -- (-418.527) [-419.087] (-417.255) (-416.042) * [-418.005] (-415.893) (-419.257) (-415.581) -- 0:00:58
      33500 -- (-422.742) [-414.883] (-416.875) (-418.594) * (-418.104) [-416.105] (-418.957) (-415.700) -- 0:00:57
      34000 -- [-415.547] (-419.567) (-419.105) (-418.361) * [-416.953] (-417.669) (-416.144) (-416.176) -- 0:00:56
      34500 -- (-420.991) [-416.750] (-415.925) (-415.428) * (-417.687) (-417.916) [-416.374] (-417.346) -- 0:00:55
      35000 -- (-424.321) (-416.042) [-418.530] (-416.443) * [-416.239] (-415.852) (-416.018) (-419.844) -- 0:00:55

      Average standard deviation of split frequencies: 0.047140

      35500 -- (-423.730) (-415.398) (-416.491) [-415.785] * [-415.547] (-415.072) (-421.570) (-417.064) -- 0:00:54
      36000 -- (-418.294) (-416.282) (-416.128) [-414.881] * (-414.846) (-415.296) [-420.359] (-416.274) -- 0:00:53
      36500 -- (-420.113) (-418.956) (-416.389) [-415.908] * (-415.541) [-415.437] (-417.864) (-414.709) -- 0:00:52
      37000 -- (-414.968) [-419.201] (-418.698) (-417.110) * (-417.174) (-417.713) [-417.943] (-415.625) -- 0:00:52
      37500 -- (-416.254) (-416.421) (-417.919) [-415.067] * [-416.108] (-418.217) (-416.342) (-415.140) -- 0:00:51
      38000 -- [-417.054] (-421.042) (-415.475) (-416.676) * (-414.966) (-416.108) [-417.264] (-418.231) -- 0:00:50
      38500 -- [-418.055] (-420.575) (-415.509) (-419.743) * (-414.930) (-415.345) [-417.217] (-420.258) -- 0:00:49
      39000 -- (-417.643) [-415.884] (-416.880) (-417.302) * (-417.771) (-418.551) [-418.344] (-416.091) -- 0:00:49
      39500 -- (-416.556) (-415.294) (-417.669) [-416.429] * [-417.713] (-419.016) (-417.779) (-416.197) -- 0:00:48
      40000 -- [-417.177] (-417.227) (-419.464) (-417.297) * [-415.334] (-419.816) (-418.759) (-416.350) -- 0:00:48

      Average standard deviation of split frequencies: 0.045147

      40500 -- (-419.333) (-416.340) [-416.639] (-418.990) * [-416.583] (-420.358) (-420.066) (-415.551) -- 0:00:47
      41000 -- (-415.981) (-416.392) [-415.857] (-417.870) * (-415.722) (-415.299) (-418.164) [-415.276] -- 0:00:46
      41500 -- (-416.218) (-419.265) (-417.125) [-416.827] * (-415.854) (-419.874) (-418.280) [-417.904] -- 0:00:46
      42000 -- [-419.463] (-418.972) (-415.554) (-416.807) * [-416.176] (-418.722) (-415.970) (-415.282) -- 0:00:45
      42500 -- (-416.073) (-417.328) (-415.439) [-416.176] * [-415.649] (-417.151) (-417.219) (-419.286) -- 0:00:45
      43000 -- (-416.356) (-416.724) [-416.473] (-417.266) * [-417.864] (-416.981) (-417.919) (-416.725) -- 0:01:06
      43500 -- (-421.967) (-416.158) [-418.220] (-415.179) * [-416.965] (-417.750) (-421.115) (-416.750) -- 0:01:05
      44000 -- (-419.602) [-416.489] (-416.340) (-415.540) * (-418.575) (-415.228) (-419.217) [-415.476] -- 0:01:05
      44500 -- [-416.470] (-415.852) (-417.030) (-415.563) * (-417.359) [-414.966] (-416.340) (-416.785) -- 0:01:04
      45000 -- (-417.621) [-414.931] (-417.696) (-416.117) * (-418.107) [-415.161] (-415.270) (-416.246) -- 0:01:03

      Average standard deviation of split frequencies: 0.039455

      45500 -- (-421.433) (-419.293) [-417.725] (-415.823) * (-415.314) [-416.083] (-416.360) (-417.279) -- 0:01:02
      46000 -- [-416.136] (-417.362) (-419.456) (-421.306) * (-419.742) (-416.932) [-420.542] (-416.717) -- 0:01:02
      46500 -- [-417.389] (-415.000) (-417.137) (-416.371) * (-415.311) [-419.254] (-415.749) (-415.439) -- 0:01:01
      47000 -- (-415.492) [-417.148] (-418.158) (-415.889) * (-416.048) [-416.224] (-414.919) (-416.083) -- 0:01:00
      47500 -- (-417.480) [-416.600] (-415.245) (-417.131) * (-418.842) (-418.683) [-416.631] (-416.839) -- 0:01:00
      48000 -- (-416.756) [-415.685] (-416.935) (-417.043) * (-419.747) [-415.800] (-415.766) (-418.514) -- 0:00:59
      48500 -- (-415.325) (-415.334) [-417.892] (-421.949) * (-420.565) (-417.433) (-416.587) [-418.362] -- 0:00:58
      49000 -- (-415.764) (-416.295) [-414.718] (-423.139) * [-419.084] (-419.371) (-415.121) (-418.360) -- 0:00:58
      49500 -- (-414.765) (-418.718) (-414.781) [-416.721] * (-422.589) (-415.623) [-415.988] (-417.315) -- 0:00:57
      50000 -- [-416.673] (-418.186) (-415.804) (-416.359) * (-417.345) [-415.729] (-416.516) (-416.004) -- 0:00:57

      Average standard deviation of split frequencies: 0.039665

      50500 -- (-417.440) [-416.424] (-418.275) (-416.448) * (-418.477) [-415.850] (-417.737) (-420.268) -- 0:00:56
      51000 -- (-416.753) (-414.970) [-416.317] (-416.439) * (-417.528) [-415.823] (-418.023) (-419.741) -- 0:00:55
      51500 -- (-418.972) (-418.177) [-416.433] (-415.043) * [-416.866] (-416.145) (-417.810) (-419.156) -- 0:00:55
      52000 -- [-417.468] (-418.851) (-415.406) (-416.571) * (-416.631) [-415.982] (-418.411) (-421.258) -- 0:00:54
      52500 -- (-415.720) (-419.029) [-415.028] (-416.252) * [-415.864] (-416.505) (-415.493) (-419.739) -- 0:00:54
      53000 -- [-415.904] (-416.722) (-417.072) (-416.801) * (-415.616) (-415.727) (-417.435) [-415.877] -- 0:00:53
      53500 -- [-419.842] (-416.313) (-415.916) (-415.981) * [-418.547] (-417.580) (-415.288) (-416.193) -- 0:00:53
      54000 -- (-416.720) (-424.226) [-414.824] (-416.691) * (-416.031) [-416.835] (-415.507) (-417.283) -- 0:00:52
      54500 -- [-416.866] (-417.360) (-417.216) (-416.887) * (-416.373) (-416.154) [-415.990] (-415.738) -- 0:00:52
      55000 -- (-416.812) (-418.437) (-418.553) [-415.392] * (-416.028) (-416.051) [-419.576] (-417.512) -- 0:00:51

      Average standard deviation of split frequencies: 0.037039

      55500 -- (-415.792) [-419.511] (-416.233) (-415.799) * (-415.283) (-418.718) (-418.977) [-417.745] -- 0:00:51
      56000 -- [-418.148] (-419.952) (-420.820) (-417.824) * (-415.681) (-418.086) (-417.853) [-418.704] -- 0:00:50
      56500 -- (-418.685) [-418.501] (-418.768) (-415.944) * [-414.497] (-416.063) (-418.053) (-415.054) -- 0:00:50
      57000 -- (-418.890) (-416.879) (-418.205) [-416.769] * (-416.563) (-416.555) [-415.922] (-418.971) -- 0:00:49
      57500 -- (-417.183) (-415.582) [-415.328] (-415.483) * (-416.991) (-415.444) [-415.677] (-419.415) -- 0:00:49
      58000 -- (-416.625) [-415.820] (-416.554) (-418.743) * (-415.703) (-417.046) [-415.801] (-418.398) -- 0:00:48
      58500 -- (-415.988) (-415.364) [-417.294] (-417.035) * (-416.415) [-418.136] (-417.576) (-418.646) -- 0:00:48
      59000 -- [-418.165] (-414.681) (-415.814) (-416.602) * (-416.020) (-418.054) (-414.717) [-417.684] -- 0:00:47
      59500 -- (-417.619) [-414.547] (-415.799) (-417.339) * (-414.865) (-415.805) (-415.453) [-415.614] -- 0:00:47
      60000 -- (-422.444) (-417.362) (-417.144) [-418.469] * (-415.721) [-416.512] (-414.984) (-418.339) -- 0:01:02

      Average standard deviation of split frequencies: 0.040488

      60500 -- (-417.308) (-418.735) [-415.272] (-416.408) * (-415.172) [-416.199] (-415.554) (-416.260) -- 0:01:02
      61000 -- (-416.876) (-420.302) (-415.600) [-415.873] * (-419.422) (-417.922) [-415.353] (-419.195) -- 0:01:01
      61500 -- [-417.406] (-417.290) (-416.625) (-417.077) * (-419.170) (-419.979) (-416.212) [-415.789] -- 0:01:01
      62000 -- (-420.536) (-416.127) [-415.849] (-415.102) * [-416.812] (-420.752) (-416.773) (-419.803) -- 0:01:00
      62500 -- (-418.359) (-421.537) [-415.209] (-415.355) * [-415.156] (-416.096) (-417.210) (-416.691) -- 0:01:00
      63000 -- (-417.886) (-417.882) [-414.784] (-414.806) * (-416.041) (-419.364) [-415.758] (-416.138) -- 0:00:59
      63500 -- (-416.959) [-417.324] (-420.220) (-419.603) * [-418.954] (-416.182) (-418.203) (-415.275) -- 0:00:58
      64000 -- [-418.627] (-416.173) (-417.836) (-415.270) * (-418.320) [-419.361] (-416.988) (-420.794) -- 0:00:58
      64500 -- (-415.552) (-417.963) [-416.367] (-415.991) * (-417.603) (-421.036) (-415.527) [-415.199] -- 0:00:58
      65000 -- (-418.770) (-416.730) (-420.425) [-417.681] * (-418.120) (-417.179) (-417.011) [-418.344] -- 0:00:57

      Average standard deviation of split frequencies: 0.036733

      65500 -- (-421.373) (-417.954) [-415.067] (-416.509) * (-417.424) (-417.232) [-415.000] (-418.046) -- 0:00:57
      66000 -- [-415.091] (-416.842) (-421.917) (-422.111) * (-416.205) [-418.015] (-417.699) (-418.592) -- 0:00:56
      66500 -- (-414.805) (-415.697) (-423.018) [-417.720] * (-415.781) (-414.864) (-415.488) [-416.376] -- 0:00:56
      67000 -- (-414.769) (-416.644) (-422.453) [-416.296] * (-416.740) (-419.307) (-416.851) [-416.975] -- 0:00:55
      67500 -- [-416.040] (-417.741) (-418.695) (-416.612) * [-416.406] (-416.822) (-414.929) (-416.639) -- 0:00:55
      68000 -- (-417.366) [-417.553] (-415.786) (-418.027) * [-417.830] (-417.204) (-414.823) (-420.153) -- 0:00:54
      68500 -- [-417.409] (-418.173) (-416.755) (-420.604) * (-415.841) (-418.246) [-417.174] (-415.305) -- 0:00:54
      69000 -- [-417.586] (-416.755) (-415.241) (-416.323) * (-414.903) (-416.366) (-417.039) [-415.636] -- 0:00:53
      69500 -- [-416.603] (-416.339) (-417.419) (-418.478) * [-415.577] (-420.449) (-416.466) (-416.608) -- 0:00:53
      70000 -- [-417.717] (-418.221) (-416.462) (-418.589) * (-418.264) [-418.332] (-415.344) (-420.514) -- 0:00:53

      Average standard deviation of split frequencies: 0.037484

      70500 -- (-415.114) (-418.082) (-416.837) [-416.912] * [-415.848] (-422.702) (-416.638) (-418.881) -- 0:00:52
      71000 -- [-423.552] (-417.884) (-416.732) (-421.697) * (-415.869) (-415.651) (-419.251) [-419.512] -- 0:00:52
      71500 -- (-415.746) (-417.584) [-418.955] (-417.777) * (-415.080) (-418.730) [-418.223] (-419.338) -- 0:00:51
      72000 -- [-417.798] (-424.005) (-420.961) (-414.898) * (-415.732) (-419.369) (-417.218) [-415.768] -- 0:00:51
      72500 -- (-418.152) (-423.912) [-421.512] (-414.822) * [-414.501] (-415.740) (-414.849) (-415.002) -- 0:00:51
      73000 -- [-415.391] (-417.970) (-417.431) (-415.663) * (-420.785) (-417.254) [-416.397] (-415.479) -- 0:00:50
      73500 -- (-416.005) (-416.508) [-415.450] (-416.970) * (-420.391) (-417.078) (-415.041) [-415.027] -- 0:00:50
      74000 -- (-417.336) [-417.920] (-415.988) (-415.554) * (-421.828) [-418.241] (-421.412) (-416.527) -- 0:00:50
      74500 -- (-418.108) [-416.624] (-416.332) (-415.700) * (-426.545) [-415.078] (-425.144) (-414.799) -- 0:00:49
      75000 -- (-416.255) (-416.067) [-417.817] (-414.776) * (-426.032) (-418.077) (-415.241) [-415.128] -- 0:00:49

      Average standard deviation of split frequencies: 0.032786

      75500 -- [-416.187] (-416.907) (-417.392) (-417.363) * (-416.519) (-420.517) [-415.373] (-416.186) -- 0:00:48
      76000 -- (-417.501) (-414.730) [-416.436] (-420.241) * (-416.799) (-418.143) (-416.718) [-416.947] -- 0:01:00
      76500 -- (-418.150) (-415.397) (-417.816) [-416.738] * (-416.460) (-419.891) [-415.635] (-418.836) -- 0:01:00
      77000 -- (-415.006) (-416.990) (-419.355) [-417.773] * (-418.084) (-417.383) [-415.349] (-416.916) -- 0:00:59
      77500 -- [-415.232] (-416.662) (-422.885) (-417.143) * (-415.745) [-418.810] (-414.908) (-415.767) -- 0:00:59
      78000 -- (-415.151) [-416.604] (-418.066) (-418.082) * (-417.544) (-419.788) [-418.158] (-417.322) -- 0:00:59
      78500 -- (-417.301) [-416.442] (-416.963) (-416.303) * [-417.534] (-420.859) (-417.745) (-417.165) -- 0:00:58
      79000 -- (-419.038) (-417.081) (-416.841) [-416.081] * (-415.026) (-415.205) [-419.715] (-415.589) -- 0:00:58
      79500 -- (-417.517) [-416.403] (-415.838) (-416.697) * (-417.943) [-420.112] (-415.404) (-415.253) -- 0:00:57
      80000 -- (-415.983) [-417.970] (-415.626) (-416.603) * (-417.801) (-416.176) (-415.050) [-415.629] -- 0:00:57

      Average standard deviation of split frequencies: 0.033894

      80500 -- (-414.640) [-416.085] (-417.112) (-420.214) * (-416.315) (-418.100) (-417.296) [-414.903] -- 0:00:57
      81000 -- (-416.078) [-417.399] (-419.909) (-416.832) * [-416.676] (-416.762) (-422.839) (-418.579) -- 0:00:56
      81500 -- (-417.328) [-415.565] (-418.670) (-417.197) * (-416.608) [-416.767] (-415.236) (-417.774) -- 0:00:56
      82000 -- [-415.963] (-417.902) (-422.757) (-419.283) * (-417.336) (-415.412) (-414.894) [-416.027] -- 0:00:55
      82500 -- (-417.494) [-417.175] (-415.790) (-420.045) * (-415.773) (-415.165) [-415.268] (-417.244) -- 0:00:55
      83000 -- [-419.337] (-414.936) (-417.391) (-416.686) * (-417.031) (-416.616) (-414.562) [-415.417] -- 0:00:55
      83500 -- (-418.159) (-416.123) [-417.507] (-420.229) * [-414.866] (-419.058) (-414.622) (-415.912) -- 0:00:54
      84000 -- (-417.501) (-417.446) (-416.851) [-415.869] * (-416.493) (-417.252) [-414.661] (-416.153) -- 0:00:54
      84500 -- (-418.945) (-417.805) [-416.277] (-417.396) * (-422.094) (-419.069) [-416.937] (-415.527) -- 0:00:54
      85000 -- (-416.559) (-417.776) [-415.429] (-417.881) * (-415.143) (-418.628) [-414.870] (-414.623) -- 0:00:53

      Average standard deviation of split frequencies: 0.034533

      85500 -- (-418.221) (-418.423) (-417.379) [-415.270] * (-416.290) (-417.870) [-415.471] (-420.870) -- 0:00:53
      86000 -- (-416.117) (-416.285) [-415.622] (-418.818) * (-418.815) [-416.880] (-420.359) (-417.860) -- 0:00:53
      86500 -- (-417.246) (-419.053) [-415.462] (-417.932) * (-416.498) (-417.685) [-415.424] (-421.365) -- 0:00:52
      87000 -- (-419.185) [-417.468] (-418.659) (-415.577) * (-415.725) [-416.511] (-421.621) (-418.655) -- 0:00:52
      87500 -- (-415.723) [-417.650] (-415.767) (-417.897) * (-415.677) (-415.182) (-417.560) [-417.879] -- 0:00:52
      88000 -- (-419.776) (-417.848) (-418.310) [-415.690] * (-414.450) (-416.213) (-418.985) [-415.177] -- 0:00:51
      88500 -- [-419.613] (-414.811) (-418.802) (-416.383) * [-415.735] (-419.419) (-419.753) (-415.873) -- 0:00:51
      89000 -- (-418.100) (-417.558) [-416.310] (-417.887) * (-418.157) [-418.230] (-416.015) (-416.451) -- 0:00:51
      89500 -- [-416.562] (-416.626) (-415.273) (-418.837) * [-415.749] (-418.359) (-415.676) (-415.673) -- 0:00:50
      90000 -- (-418.748) (-416.542) (-415.189) [-417.891] * [-416.165] (-417.368) (-417.552) (-416.129) -- 0:00:50

      Average standard deviation of split frequencies: 0.033276

      90500 -- (-416.551) (-420.191) (-415.768) [-415.076] * (-416.479) [-415.921] (-419.733) (-415.743) -- 0:00:50
      91000 -- [-418.387] (-417.041) (-414.781) (-416.223) * (-418.417) [-417.064] (-421.062) (-416.887) -- 0:00:49
      91500 -- [-415.955] (-416.011) (-415.917) (-415.336) * [-417.140] (-417.165) (-416.935) (-418.696) -- 0:00:49
      92000 -- (-417.120) (-415.675) [-420.382] (-416.913) * (-420.939) (-419.740) [-417.369] (-418.380) -- 0:00:59
      92500 -- (-421.010) [-418.275] (-416.893) (-416.570) * [-419.490] (-419.730) (-417.141) (-417.143) -- 0:00:58
      93000 -- (-422.373) (-416.148) [-417.184] (-417.252) * [-415.355] (-418.521) (-415.898) (-418.162) -- 0:00:58
      93500 -- (-420.984) (-415.977) (-415.164) [-414.773] * [-415.342] (-415.991) (-415.992) (-420.116) -- 0:00:58
      94000 -- [-419.272] (-418.218) (-416.265) (-416.247) * (-418.588) [-416.809] (-416.789) (-415.845) -- 0:00:57
      94500 -- (-416.573) (-417.499) (-415.830) [-418.298] * [-415.355] (-414.919) (-418.688) (-415.603) -- 0:00:57
      95000 -- (-416.973) [-416.013] (-416.169) (-417.802) * [-417.482] (-414.603) (-416.579) (-420.747) -- 0:00:57

      Average standard deviation of split frequencies: 0.028294

      95500 -- (-417.798) (-417.691) (-415.903) [-418.351] * (-416.533) [-415.582] (-417.642) (-418.374) -- 0:00:56
      96000 -- [-418.038] (-420.046) (-415.686) (-419.028) * (-417.315) [-415.099] (-417.003) (-416.513) -- 0:00:56
      96500 -- (-417.194) (-416.702) (-421.467) [-417.975] * [-415.724] (-419.470) (-418.286) (-415.466) -- 0:00:56
      97000 -- [-416.447] (-420.529) (-419.523) (-419.349) * (-415.309) (-418.503) (-418.604) [-414.929] -- 0:00:55
      97500 -- (-415.279) (-421.808) (-415.467) [-416.087] * (-416.817) (-415.213) (-423.640) [-415.722] -- 0:00:55
      98000 -- (-416.331) (-419.684) (-417.011) [-416.349] * (-415.843) (-415.807) [-414.922] (-417.591) -- 0:00:55
      98500 -- (-419.435) [-416.035] (-418.195) (-417.887) * (-420.062) (-419.700) (-415.855) [-415.869] -- 0:00:54
      99000 -- (-416.462) [-418.038] (-417.462) (-415.711) * (-415.872) (-423.429) (-417.184) [-414.912] -- 0:00:54
      99500 -- [-418.358] (-415.349) (-418.125) (-416.551) * (-417.852) (-420.014) (-415.528) [-416.923] -- 0:00:54
      100000 -- (-415.086) [-416.399] (-415.354) (-416.081) * (-419.728) [-419.014] (-416.670) (-415.803) -- 0:00:54

      Average standard deviation of split frequencies: 0.030204

      100500 -- (-415.929) [-417.405] (-414.580) (-414.746) * [-416.844] (-419.265) (-417.361) (-417.781) -- 0:00:53
      101000 -- (-415.390) (-417.365) [-423.696] (-415.271) * (-417.238) [-417.539] (-417.011) (-417.168) -- 0:00:53
      101500 -- (-415.516) [-416.573] (-415.198) (-419.208) * [-415.795] (-415.882) (-415.619) (-416.213) -- 0:00:53
      102000 -- (-414.841) (-416.063) [-415.820] (-417.641) * (-421.235) [-417.280] (-416.422) (-416.098) -- 0:00:52
      102500 -- [-416.270] (-415.298) (-416.855) (-417.424) * (-415.513) (-420.470) (-416.963) [-418.129] -- 0:00:52
      103000 -- (-417.072) (-418.484) [-417.156] (-416.847) * (-417.838) (-416.575) [-415.505] (-417.706) -- 0:00:52
      103500 -- [-416.527] (-415.731) (-416.124) (-415.936) * [-420.504] (-415.049) (-415.201) (-414.993) -- 0:00:51
      104000 -- (-416.447) [-419.657] (-418.336) (-415.154) * (-420.976) (-418.209) [-416.992] (-416.262) -- 0:00:51
      104500 -- (-415.362) (-415.947) [-415.927] (-416.487) * (-416.673) (-417.302) (-419.938) [-417.647] -- 0:00:51
      105000 -- [-415.400] (-414.811) (-417.492) (-415.878) * (-419.247) (-415.937) (-418.935) [-422.054] -- 0:00:51

      Average standard deviation of split frequencies: 0.030908

      105500 -- [-416.985] (-415.261) (-417.849) (-415.490) * (-417.034) [-415.148] (-415.115) (-418.567) -- 0:00:50
      106000 -- [-416.668] (-417.880) (-419.382) (-419.938) * (-419.786) [-417.908] (-415.726) (-416.539) -- 0:00:50
      106500 -- (-417.746) [-418.451] (-418.331) (-414.880) * (-422.116) [-415.147] (-415.269) (-417.976) -- 0:00:50
      107000 -- (-414.683) (-420.357) [-416.526] (-417.218) * [-418.936] (-418.027) (-418.294) (-417.100) -- 0:00:50
      107500 -- (-415.566) (-414.950) (-422.316) [-415.649] * (-415.814) [-417.203] (-416.924) (-415.596) -- 0:00:49
      108000 -- [-416.367] (-416.223) (-415.969) (-415.317) * (-416.176) (-416.051) [-417.615] (-417.011) -- 0:00:49
      108500 -- [-416.514] (-416.806) (-415.177) (-419.020) * [-415.571] (-416.311) (-422.047) (-416.629) -- 0:00:57
      109000 -- (-416.368) [-419.209] (-416.297) (-417.253) * (-415.347) [-417.499] (-415.606) (-416.466) -- 0:00:57
      109500 -- [-417.727] (-417.729) (-415.994) (-418.040) * (-418.183) (-417.336) [-416.189] (-417.295) -- 0:00:56
      110000 -- [-417.163] (-416.016) (-415.869) (-417.508) * [-415.460] (-418.500) (-418.855) (-423.728) -- 0:00:56

      Average standard deviation of split frequencies: 0.029605

      110500 -- (-416.389) [-415.024] (-415.117) (-418.631) * [-415.745] (-417.996) (-416.963) (-417.105) -- 0:00:56
      111000 -- (-417.909) (-415.631) [-416.131] (-415.815) * [-417.016] (-416.450) (-415.119) (-417.088) -- 0:00:56
      111500 -- (-419.577) [-417.082] (-418.894) (-416.542) * (-417.575) (-421.904) (-416.108) [-415.131] -- 0:00:55
      112000 -- (-416.978) [-419.546] (-419.529) (-419.522) * [-417.600] (-422.503) (-415.640) (-417.250) -- 0:00:55
      112500 -- (-415.397) (-417.063) (-415.341) [-418.252] * [-416.312] (-418.068) (-416.683) (-417.489) -- 0:00:55
      113000 -- (-417.215) [-416.863] (-416.388) (-416.927) * (-415.757) (-417.331) (-415.211) [-415.942] -- 0:00:54
      113500 -- (-415.392) [-418.072] (-415.830) (-414.867) * (-414.584) (-417.502) [-415.106] (-416.860) -- 0:00:54
      114000 -- (-415.728) (-416.281) (-417.221) [-414.692] * (-421.541) [-416.685] (-416.895) (-415.097) -- 0:00:54
      114500 -- [-416.170] (-415.967) (-420.338) (-416.855) * (-416.467) (-415.388) (-418.280) [-418.852] -- 0:00:54
      115000 -- (-416.241) [-415.568] (-417.991) (-418.907) * (-422.883) [-416.851] (-415.568) (-420.262) -- 0:00:53

      Average standard deviation of split frequencies: 0.029056

      115500 -- (-420.633) (-419.440) [-414.800] (-416.189) * (-415.995) (-418.173) (-415.768) [-414.709] -- 0:00:53
      116000 -- (-418.900) (-417.604) (-417.618) [-416.727] * (-419.057) (-416.683) (-416.694) [-415.300] -- 0:00:53
      116500 -- (-417.079) [-415.216] (-417.502) (-416.589) * (-424.475) [-419.294] (-418.248) (-421.383) -- 0:00:53
      117000 -- (-420.585) (-416.827) (-419.181) [-416.549] * (-416.638) (-415.425) [-414.720] (-419.926) -- 0:00:52
      117500 -- (-415.715) (-415.359) (-418.518) [-414.815] * (-416.123) (-416.307) [-416.228] (-417.104) -- 0:00:52
      118000 -- (-417.679) [-415.015] (-418.858) (-421.153) * [-415.800] (-417.202) (-416.224) (-416.348) -- 0:00:52
      118500 -- [-416.456] (-418.030) (-417.581) (-417.081) * (-420.838) (-416.133) [-416.776] (-416.265) -- 0:00:52
      119000 -- (-416.125) [-414.545] (-415.418) (-417.477) * (-420.518) [-416.449] (-416.273) (-415.850) -- 0:00:51
      119500 -- (-418.976) (-416.005) (-418.401) [-416.577] * (-416.882) [-417.152] (-418.977) (-415.940) -- 0:00:51
      120000 -- [-416.656] (-414.967) (-416.799) (-414.812) * (-418.640) (-420.815) [-418.361] (-418.168) -- 0:00:51

      Average standard deviation of split frequencies: 0.028128

      120500 -- (-417.965) (-415.565) (-420.790) [-416.903] * (-416.785) [-415.719] (-417.390) (-422.545) -- 0:00:51
      121000 -- (-418.991) [-416.044] (-415.079) (-416.856) * (-416.628) (-415.069) (-414.662) [-417.765] -- 0:00:50
      121500 -- (-417.374) (-416.397) [-417.022] (-419.148) * [-420.113] (-415.256) (-415.097) (-416.517) -- 0:00:50
      122000 -- (-422.543) (-421.285) (-418.636) [-416.001] * (-422.456) [-415.486] (-418.578) (-416.750) -- 0:00:50
      122500 -- (-418.076) [-417.435] (-415.491) (-416.482) * (-416.028) (-417.495) (-416.075) [-417.829] -- 0:00:50
      123000 -- (-420.457) [-415.839] (-416.304) (-419.997) * [-416.373] (-418.622) (-417.980) (-415.394) -- 0:00:49
      123500 -- (-417.818) [-416.586] (-417.212) (-415.692) * (-416.607) (-418.236) (-419.053) [-416.435] -- 0:00:49
      124000 -- (-415.633) [-414.719] (-420.905) (-416.001) * (-416.445) (-417.799) (-419.038) [-417.586] -- 0:00:49
      124500 -- (-416.071) [-417.902] (-424.365) (-419.555) * (-416.595) (-422.306) (-417.827) [-416.663] -- 0:00:49
      125000 -- (-421.756) (-419.752) (-418.987) [-415.465] * (-416.746) (-417.532) (-419.580) [-417.587] -- 0:00:49

      Average standard deviation of split frequencies: 0.025679

      125500 -- (-417.165) (-416.600) (-415.723) [-416.097] * [-415.416] (-416.190) (-416.913) (-416.065) -- 0:00:55
      126000 -- (-416.970) (-418.925) (-418.888) [-416.728] * (-415.357) (-415.738) [-415.366] (-418.190) -- 0:00:55
      126500 -- [-416.160] (-418.571) (-416.757) (-416.291) * (-416.454) (-417.019) [-416.382] (-415.048) -- 0:00:55
      127000 -- (-415.809) (-417.241) (-415.639) [-415.992] * (-416.475) (-417.862) [-416.650] (-416.152) -- 0:00:54
      127500 -- (-419.486) (-416.793) [-417.116] (-422.603) * (-414.887) (-426.056) [-416.444] (-416.561) -- 0:00:54
      128000 -- (-415.731) [-415.026] (-416.318) (-423.987) * (-419.405) [-417.539] (-417.875) (-414.651) -- 0:00:54
      128500 -- (-415.514) (-414.601) (-418.235) [-421.565] * (-421.699) (-418.364) (-416.484) [-414.611] -- 0:00:54
      129000 -- (-415.928) (-418.461) (-418.389) [-414.989] * [-417.746] (-415.522) (-420.774) (-417.249) -- 0:00:54
      129500 -- (-415.901) (-419.670) (-416.212) [-415.360] * (-418.771) (-415.783) (-418.128) [-415.276] -- 0:00:53
      130000 -- [-418.432] (-418.468) (-416.618) (-417.134) * [-416.458] (-416.789) (-418.686) (-414.844) -- 0:00:53

      Average standard deviation of split frequencies: 0.026697

      130500 -- (-420.472) (-416.564) [-415.480] (-417.192) * (-417.399) (-416.337) (-419.877) [-415.573] -- 0:00:53
      131000 -- (-416.153) [-415.719] (-415.743) (-417.482) * (-418.027) [-418.576] (-416.498) (-415.718) -- 0:00:53
      131500 -- (-415.989) [-416.370] (-417.319) (-415.355) * (-414.631) (-418.628) [-417.751] (-416.570) -- 0:00:52
      132000 -- [-416.679] (-414.801) (-416.526) (-416.393) * (-416.454) [-417.395] (-416.479) (-416.487) -- 0:00:52
      132500 -- (-417.399) (-425.775) [-415.962] (-416.075) * (-414.663) (-418.055) [-417.419] (-417.043) -- 0:00:52
      133000 -- [-415.679] (-419.779) (-417.730) (-420.834) * (-421.009) (-417.601) (-420.484) [-414.986] -- 0:00:52
      133500 -- (-416.426) (-423.944) [-416.465] (-420.756) * (-417.012) (-418.697) [-417.662] (-415.748) -- 0:00:51
      134000 -- (-416.188) [-417.845] (-416.702) (-415.273) * (-417.767) (-419.489) [-419.100] (-418.948) -- 0:00:51
      134500 -- (-419.761) [-416.793] (-420.182) (-416.713) * (-416.451) (-417.663) (-416.574) [-418.588] -- 0:00:51
      135000 -- (-417.938) (-417.278) (-415.585) [-418.762] * (-416.200) [-420.288] (-415.733) (-422.014) -- 0:00:51

      Average standard deviation of split frequencies: 0.028824

      135500 -- (-415.748) (-415.361) (-416.196) [-418.251] * (-416.125) (-415.736) [-416.885] (-421.382) -- 0:00:51
      136000 -- (-416.674) (-415.257) (-416.321) [-417.131] * [-415.903] (-418.661) (-416.297) (-416.891) -- 0:00:50
      136500 -- (-415.540) (-415.422) (-415.962) [-415.794] * [-416.067] (-418.772) (-418.194) (-418.915) -- 0:00:50
      137000 -- (-415.658) [-415.729] (-417.582) (-417.891) * [-422.029] (-425.322) (-417.653) (-420.307) -- 0:00:50
      137500 -- (-417.146) (-416.004) [-415.215] (-416.610) * (-416.777) (-415.360) (-415.495) [-415.984] -- 0:00:50
      138000 -- (-415.360) (-417.039) [-414.958] (-417.112) * (-424.975) (-416.113) (-417.213) [-418.293] -- 0:00:49
      138500 -- (-414.710) (-416.064) [-417.021] (-417.499) * (-415.825) (-419.429) [-417.253] (-422.687) -- 0:00:49
      139000 -- (-416.294) (-416.310) [-416.362] (-417.022) * (-418.287) (-417.335) (-416.660) [-415.731] -- 0:00:49
      139500 -- (-415.410) (-416.296) [-415.735] (-416.212) * [-415.970] (-418.653) (-416.688) (-415.259) -- 0:00:49
      140000 -- (-416.016) [-416.458] (-416.971) (-418.514) * (-417.973) [-418.836] (-417.083) (-417.804) -- 0:00:49

      Average standard deviation of split frequencies: 0.026810

      140500 -- (-414.934) (-418.495) [-415.672] (-414.658) * (-415.409) [-418.106] (-415.615) (-420.229) -- 0:00:48
      141000 -- (-415.400) (-416.741) [-415.154] (-417.394) * [-421.482] (-414.903) (-416.780) (-415.926) -- 0:00:48
      141500 -- [-414.886] (-416.334) (-416.357) (-417.242) * (-420.653) [-414.771] (-416.533) (-416.365) -- 0:00:48
      142000 -- (-416.937) (-417.838) (-423.623) [-416.968] * (-419.305) (-417.156) [-415.058] (-419.812) -- 0:00:48
      142500 -- (-419.948) [-415.153] (-421.846) (-416.193) * (-416.342) (-419.312) (-415.090) [-415.028] -- 0:00:54
      143000 -- (-417.317) (-415.122) (-421.638) [-420.302] * [-417.043] (-421.007) (-416.674) (-420.899) -- 0:00:53
      143500 -- (-416.270) (-416.072) [-420.797] (-416.761) * [-415.554] (-416.649) (-415.341) (-417.326) -- 0:00:53
      144000 -- (-418.801) [-418.372] (-420.372) (-423.074) * (-417.367) [-416.286] (-417.648) (-418.566) -- 0:00:53
      144500 -- (-414.910) [-416.840] (-417.623) (-415.545) * (-416.409) [-416.668] (-417.650) (-418.418) -- 0:00:53
      145000 -- [-416.508] (-417.471) (-419.917) (-415.754) * [-417.103] (-417.069) (-416.166) (-419.755) -- 0:00:53

      Average standard deviation of split frequencies: 0.026153

      145500 -- (-417.444) [-417.490] (-417.527) (-417.446) * (-415.772) [-417.232] (-420.860) (-417.310) -- 0:00:52
      146000 -- (-418.671) (-415.892) [-416.334] (-419.360) * [-416.865] (-416.813) (-415.149) (-419.573) -- 0:00:52
      146500 -- (-416.047) (-416.621) (-415.746) [-415.393] * (-418.022) (-414.937) [-415.898] (-415.554) -- 0:00:52
      147000 -- [-414.563] (-416.889) (-418.857) (-416.198) * (-415.948) (-414.906) [-415.162] (-416.941) -- 0:00:52
      147500 -- (-416.314) (-417.435) [-415.738] (-416.905) * (-419.544) [-415.207] (-415.967) (-418.438) -- 0:00:52
      148000 -- [-414.699] (-417.460) (-416.590) (-416.253) * (-415.582) (-415.068) [-416.065] (-414.552) -- 0:00:51
      148500 -- [-416.397] (-415.623) (-416.204) (-415.983) * [-415.622] (-415.645) (-416.286) (-415.316) -- 0:00:51
      149000 -- [-418.489] (-420.248) (-416.191) (-417.479) * (-416.712) [-415.479] (-416.350) (-420.357) -- 0:00:51
      149500 -- (-415.330) (-422.256) (-417.928) [-415.638] * (-417.298) (-418.774) [-416.810] (-416.765) -- 0:00:51
      150000 -- (-418.807) (-418.243) (-415.967) [-419.575] * [-417.339] (-418.412) (-416.005) (-414.901) -- 0:00:51

      Average standard deviation of split frequencies: 0.026282

      150500 -- (-419.608) (-418.363) [-416.575] (-417.881) * (-418.652) [-418.031] (-416.042) (-416.329) -- 0:00:50
      151000 -- (-419.359) (-416.713) (-417.316) [-415.166] * (-419.521) (-415.693) [-417.706] (-415.016) -- 0:00:50
      151500 -- (-416.744) (-416.611) (-419.092) [-415.176] * (-414.961) (-419.788) (-416.237) [-414.524] -- 0:00:50
      152000 -- (-417.608) (-416.377) (-418.942) [-420.050] * [-417.130] (-417.403) (-418.127) (-417.560) -- 0:00:50
      152500 -- (-417.256) [-416.601] (-418.794) (-417.677) * (-417.101) [-424.081] (-419.089) (-415.759) -- 0:00:50
      153000 -- (-418.958) [-415.940] (-417.150) (-416.576) * (-421.354) (-417.359) [-418.983] (-416.004) -- 0:00:49
      153500 -- [-416.243] (-416.993) (-416.680) (-416.030) * (-416.414) (-415.565) (-418.763) [-415.363] -- 0:00:49
      154000 -- [-416.782] (-418.567) (-417.105) (-415.617) * (-417.190) (-419.216) [-416.345] (-414.565) -- 0:00:49
      154500 -- (-415.529) [-416.314] (-416.274) (-415.494) * (-418.164) (-415.737) (-417.131) [-415.740] -- 0:00:49
      155000 -- (-414.651) (-419.218) (-415.692) [-415.677] * (-416.104) (-419.540) [-420.476] (-415.244) -- 0:00:49

      Average standard deviation of split frequencies: 0.025837

      155500 -- (-415.586) (-416.884) (-415.373) [-418.152] * (-414.886) [-416.105] (-417.582) (-416.070) -- 0:00:48
      156000 -- (-416.431) (-419.506) (-418.285) [-417.382] * [-417.183] (-416.806) (-416.415) (-416.291) -- 0:00:48
      156500 -- (-419.366) (-419.433) [-415.229] (-416.504) * [-418.516] (-417.743) (-416.168) (-416.789) -- 0:00:48
      157000 -- [-415.326] (-417.296) (-415.041) (-418.356) * [-416.144] (-415.114) (-418.528) (-415.652) -- 0:00:48
      157500 -- [-415.154] (-419.225) (-415.140) (-420.055) * (-417.447) (-418.517) [-415.767] (-415.683) -- 0:00:48
      158000 -- (-416.525) [-416.051] (-415.950) (-420.092) * (-420.731) (-415.653) [-414.947] (-415.161) -- 0:00:47
      158500 -- [-418.057] (-418.267) (-416.057) (-418.122) * (-418.437) (-415.665) [-417.374] (-416.453) -- 0:00:47
      159000 -- (-415.275) [-416.299] (-416.140) (-417.707) * (-418.500) (-415.601) [-415.489] (-416.867) -- 0:00:52
      159500 -- (-415.298) (-415.829) (-424.811) [-415.878] * (-417.102) (-418.267) [-416.075] (-416.989) -- 0:00:52
      160000 -- (-416.233) (-417.030) (-416.924) [-417.457] * (-421.182) (-415.224) [-416.290] (-415.280) -- 0:00:52

      Average standard deviation of split frequencies: 0.024206

      160500 -- (-417.026) (-421.833) (-419.191) [-418.509] * (-419.927) (-418.945) [-417.259] (-418.441) -- 0:00:52
      161000 -- [-416.590] (-416.722) (-416.644) (-417.057) * [-417.708] (-416.263) (-421.160) (-418.398) -- 0:00:52
      161500 -- [-416.923] (-417.391) (-417.584) (-418.675) * [-417.568] (-417.688) (-418.197) (-422.470) -- 0:00:51
      162000 -- (-417.357) [-415.340] (-417.076) (-415.896) * [-415.482] (-414.902) (-418.612) (-415.646) -- 0:00:51
      162500 -- (-416.496) (-415.229) (-416.454) [-421.001] * (-419.573) (-415.850) (-415.987) [-415.725] -- 0:00:51
      163000 -- (-416.811) [-416.083] (-414.979) (-419.910) * [-416.472] (-418.619) (-415.887) (-421.042) -- 0:00:51
      163500 -- [-416.232] (-416.104) (-415.660) (-416.703) * (-414.619) (-421.406) [-416.520] (-417.340) -- 0:00:51
      164000 -- [-415.899] (-421.482) (-417.262) (-416.742) * (-420.622) (-415.537) [-417.188] (-421.645) -- 0:00:50
      164500 -- [-418.473] (-419.340) (-419.423) (-416.792) * (-418.143) (-415.745) [-416.100] (-417.297) -- 0:00:50
      165000 -- (-417.796) (-416.976) (-415.919) [-419.059] * (-418.452) (-416.992) [-416.969] (-415.869) -- 0:00:50

      Average standard deviation of split frequencies: 0.024138

      165500 -- (-417.537) (-419.187) (-417.115) [-419.182] * (-417.792) [-417.758] (-419.962) (-417.201) -- 0:00:50
      166000 -- (-414.981) [-416.651] (-419.711) (-416.234) * [-416.377] (-419.488) (-415.553) (-418.163) -- 0:00:50
      166500 -- (-416.819) (-415.207) (-419.637) [-415.880] * (-416.425) [-417.699] (-418.052) (-417.045) -- 0:00:50
      167000 -- (-424.183) (-416.022) (-417.273) [-419.051] * (-420.239) (-415.457) [-419.710] (-418.730) -- 0:00:49
      167500 -- (-418.906) (-415.496) [-416.582] (-416.581) * (-418.178) (-416.000) [-418.263] (-421.202) -- 0:00:49
      168000 -- (-417.789) (-414.722) [-418.112] (-417.430) * (-415.967) [-418.500] (-415.566) (-416.436) -- 0:00:49
      168500 -- (-415.355) (-415.602) (-417.278) [-416.986] * [-417.092] (-415.118) (-416.938) (-418.516) -- 0:00:49
      169000 -- (-415.778) [-415.462] (-417.548) (-417.813) * [-416.674] (-416.477) (-415.360) (-416.079) -- 0:00:49
      169500 -- (-418.742) [-415.922] (-417.489) (-415.167) * (-418.711) (-416.826) (-416.215) [-417.796] -- 0:00:48
      170000 -- [-417.627] (-415.117) (-418.603) (-417.296) * (-416.737) [-417.809] (-420.082) (-415.345) -- 0:00:48

      Average standard deviation of split frequencies: 0.024991

      170500 -- (-415.356) [-416.039] (-416.700) (-417.280) * [-418.846] (-414.955) (-417.421) (-415.636) -- 0:00:48
      171000 -- (-416.809) [-418.308] (-418.503) (-416.388) * (-419.126) [-415.612] (-417.232) (-418.053) -- 0:00:48
      171500 -- [-418.120] (-417.526) (-418.279) (-417.146) * [-416.561] (-417.048) (-416.187) (-419.638) -- 0:00:48
      172000 -- (-415.471) [-416.888] (-416.581) (-416.364) * (-417.503) (-416.145) [-415.593] (-419.769) -- 0:00:48
      172500 -- (-420.453) (-416.849) (-416.213) [-416.895] * (-418.248) (-415.624) (-417.935) [-415.741] -- 0:00:47
      173000 -- (-416.849) (-417.052) [-417.433] (-418.406) * (-416.966) (-416.650) (-420.779) [-417.965] -- 0:00:47
      173500 -- [-416.680] (-422.099) (-421.097) (-417.580) * (-419.641) (-415.792) (-417.057) [-415.419] -- 0:00:47
      174000 -- (-415.998) (-416.287) (-421.948) [-417.827] * [-414.890] (-415.144) (-420.225) (-419.012) -- 0:00:47
      174500 -- [-417.370] (-421.021) (-418.101) (-416.299) * (-417.069) (-417.053) [-416.218] (-419.533) -- 0:00:47
      175000 -- (-415.290) [-416.643] (-417.428) (-416.084) * (-416.483) (-418.462) [-416.399] (-418.257) -- 0:00:47

      Average standard deviation of split frequencies: 0.024106

      175500 -- (-415.602) [-419.945] (-417.406) (-420.082) * (-414.932) (-419.515) (-416.484) [-417.599] -- 0:00:51
      176000 -- [-416.118] (-416.434) (-420.730) (-417.732) * (-415.303) [-416.579] (-416.149) (-416.211) -- 0:00:51
      176500 -- (-417.452) [-416.411] (-416.795) (-416.116) * (-416.964) [-415.997] (-414.807) (-417.975) -- 0:00:51
      177000 -- [-416.131] (-417.611) (-415.775) (-416.252) * (-416.038) [-417.459] (-414.792) (-416.631) -- 0:00:51
      177500 -- [-415.330] (-419.551) (-416.476) (-417.702) * [-416.550] (-414.874) (-416.415) (-416.527) -- 0:00:50
      178000 -- [-414.712] (-415.848) (-416.198) (-416.465) * [-417.003] (-416.717) (-416.125) (-416.883) -- 0:00:50
      178500 -- (-417.048) [-416.021] (-416.809) (-416.282) * (-417.941) (-421.817) [-417.603] (-419.282) -- 0:00:50
      179000 -- [-415.912] (-414.746) (-416.445) (-418.278) * (-416.162) (-422.305) (-416.802) [-417.007] -- 0:00:50
      179500 -- (-417.014) (-416.244) [-415.012] (-417.463) * (-415.242) (-418.067) (-415.169) [-417.431] -- 0:00:50
      180000 -- (-416.436) [-416.860] (-415.341) (-416.122) * (-414.699) [-415.973] (-415.399) (-417.085) -- 0:00:50

      Average standard deviation of split frequencies: 0.022831

      180500 -- (-415.363) (-423.648) [-415.373] (-415.604) * [-416.129] (-414.860) (-417.249) (-416.980) -- 0:00:49
      181000 -- (-415.572) (-423.689) (-416.300) [-419.202] * [-418.579] (-421.800) (-416.168) (-417.179) -- 0:00:49
      181500 -- [-416.534] (-422.880) (-415.674) (-421.214) * (-415.747) (-418.812) (-419.085) [-415.341] -- 0:00:49
      182000 -- [-417.236] (-416.456) (-417.473) (-420.527) * (-415.382) (-417.821) (-415.328) [-416.424] -- 0:00:49
      182500 -- (-416.520) [-416.910] (-415.838) (-417.937) * [-415.933] (-418.176) (-416.801) (-416.162) -- 0:00:49
      183000 -- (-415.065) [-416.859] (-419.901) (-420.055) * (-416.593) (-416.903) (-417.346) [-417.289] -- 0:00:49
      183500 -- (-415.228) [-416.077] (-418.226) (-417.245) * [-415.941] (-417.345) (-421.132) (-415.917) -- 0:00:48
      184000 -- (-416.656) (-416.673) (-417.018) [-415.206] * [-417.876] (-420.157) (-416.486) (-416.836) -- 0:00:48
      184500 -- (-417.872) (-418.164) [-418.189] (-417.026) * (-416.331) [-418.054] (-416.789) (-419.738) -- 0:00:48
      185000 -- (-415.929) (-417.103) [-418.179] (-416.548) * (-415.580) (-422.188) [-416.309] (-416.232) -- 0:00:48

      Average standard deviation of split frequencies: 0.021543

      185500 -- (-417.506) [-418.923] (-414.985) (-420.294) * (-418.717) [-415.637] (-415.536) (-417.148) -- 0:00:48
      186000 -- [-416.941] (-416.657) (-423.909) (-418.458) * (-418.748) [-416.251] (-418.072) (-417.107) -- 0:00:48
      186500 -- (-416.373) (-416.246) (-424.433) [-416.348] * (-416.097) (-416.239) (-420.336) [-421.026] -- 0:00:47
      187000 -- [-415.776] (-415.628) (-421.725) (-416.563) * (-416.106) (-416.943) (-418.810) [-418.247] -- 0:00:47
      187500 -- (-415.675) (-416.269) [-418.486] (-415.781) * [-417.913] (-416.559) (-417.676) (-416.640) -- 0:00:47
      188000 -- (-416.473) (-419.708) [-416.664] (-417.700) * (-415.112) [-414.629] (-416.454) (-416.474) -- 0:00:47
      188500 -- [-415.457] (-431.819) (-415.633) (-418.893) * (-416.547) [-420.758] (-417.958) (-417.720) -- 0:00:47
      189000 -- (-419.857) (-418.077) [-415.352] (-416.916) * (-416.983) (-420.178) (-416.498) [-415.106] -- 0:00:47
      189500 -- [-423.648] (-416.790) (-415.576) (-416.075) * (-417.576) [-417.768] (-417.011) (-416.925) -- 0:00:47
      190000 -- [-415.339] (-417.649) (-414.432) (-414.766) * (-415.390) (-415.554) (-415.446) [-416.002] -- 0:00:46

      Average standard deviation of split frequencies: 0.020026

      190500 -- (-416.121) (-417.171) [-415.526] (-415.998) * [-417.279] (-419.211) (-417.073) (-416.176) -- 0:00:46
      191000 -- (-415.503) [-417.384] (-417.680) (-416.814) * (-415.550) (-416.059) (-419.572) [-415.282] -- 0:00:46
      191500 -- (-415.384) [-415.289] (-416.189) (-415.943) * (-416.840) (-415.826) [-416.473] (-415.165) -- 0:00:46
      192000 -- (-415.094) (-416.322) [-415.645] (-418.532) * [-416.222] (-416.611) (-416.880) (-416.205) -- 0:00:50
      192500 -- (-415.502) (-416.550) (-417.034) [-418.203] * (-416.761) [-415.767] (-417.030) (-415.834) -- 0:00:50
      193000 -- (-421.140) [-415.886] (-421.461) (-417.708) * (-418.570) (-422.338) (-419.951) [-414.824] -- 0:00:50
      193500 -- (-421.130) (-418.845) (-414.774) [-417.349] * (-415.523) (-418.540) (-418.380) [-418.013] -- 0:00:50
      194000 -- (-417.684) (-418.278) (-415.557) [-417.491] * [-415.418] (-415.610) (-418.525) (-418.913) -- 0:00:49
      194500 -- (-416.957) [-417.609] (-416.968) (-415.251) * (-416.698) (-415.621) [-416.417] (-417.406) -- 0:00:49
      195000 -- (-418.074) (-416.410) (-418.059) [-420.116] * (-416.567) (-418.778) (-415.813) [-415.054] -- 0:00:49

      Average standard deviation of split frequencies: 0.020083

      195500 -- (-417.184) [-416.405] (-416.292) (-417.313) * (-418.226) (-417.948) [-418.747] (-418.612) -- 0:00:49
      196000 -- (-417.488) (-415.338) (-416.099) [-416.482] * (-420.951) (-419.094) (-420.142) [-420.449] -- 0:00:49
      196500 -- (-425.724) [-418.198] (-415.980) (-416.019) * (-420.243) [-416.858] (-419.278) (-421.294) -- 0:00:49
      197000 -- [-417.337] (-419.413) (-417.200) (-415.918) * [-416.199] (-415.401) (-415.766) (-414.740) -- 0:00:48
      197500 -- [-417.452] (-415.520) (-416.104) (-414.927) * (-417.546) [-416.213] (-416.435) (-414.842) -- 0:00:48
      198000 -- (-415.639) (-420.865) (-418.248) [-414.675] * (-417.713) (-416.889) (-418.239) [-415.136] -- 0:00:48
      198500 -- (-419.879) (-415.579) (-415.989) [-417.443] * (-418.347) (-415.912) (-421.773) [-416.904] -- 0:00:48
      199000 -- (-417.643) (-417.666) [-416.626] (-417.063) * (-419.703) [-415.782] (-419.116) (-418.148) -- 0:00:48
      199500 -- (-416.407) (-418.630) (-418.136) [-417.963] * (-417.622) (-416.926) [-415.512] (-419.299) -- 0:00:48
      200000 -- (-415.986) (-417.544) [-416.355] (-415.791) * [-416.540] (-418.805) (-416.001) (-416.214) -- 0:00:48

      Average standard deviation of split frequencies: 0.019263

      200500 -- (-415.691) (-416.468) [-415.403] (-415.400) * (-414.861) (-416.385) [-415.386] (-417.742) -- 0:00:47
      201000 -- (-416.074) (-417.078) (-420.671) [-414.615] * (-418.538) [-418.084] (-416.182) (-418.619) -- 0:00:47
      201500 -- [-415.818] (-416.863) (-419.633) (-417.988) * (-417.360) [-416.812] (-416.368) (-417.534) -- 0:00:47
      202000 -- (-414.518) [-415.833] (-415.426) (-418.976) * [-415.245] (-416.626) (-416.468) (-419.668) -- 0:00:47
      202500 -- (-415.206) (-417.227) (-415.630) [-417.569] * (-415.420) [-416.280] (-421.126) (-415.496) -- 0:00:47
      203000 -- [-416.171] (-416.007) (-418.191) (-415.841) * (-416.199) [-415.353] (-420.386) (-415.335) -- 0:00:47
      203500 -- (-424.250) (-417.281) (-414.899) [-417.272] * (-415.537) (-415.405) [-420.478] (-415.416) -- 0:00:46
      204000 -- (-418.132) [-415.246] (-415.756) (-415.877) * (-415.867) (-415.512) (-417.083) [-416.134] -- 0:00:46
      204500 -- [-417.667] (-415.993) (-414.985) (-415.283) * (-419.756) [-418.240] (-416.361) (-417.559) -- 0:00:46
      205000 -- (-419.155) (-419.450) [-415.993] (-416.258) * [-417.852] (-416.111) (-416.756) (-415.859) -- 0:00:46

      Average standard deviation of split frequencies: 0.017964

      205500 -- (-417.823) [-415.829] (-415.231) (-416.999) * (-417.232) [-415.548] (-415.728) (-416.133) -- 0:00:46
      206000 -- (-417.734) (-418.652) [-417.392] (-415.132) * (-417.030) (-418.274) [-416.051] (-415.405) -- 0:00:46
      206500 -- (-418.494) [-417.001] (-417.963) (-415.609) * [-416.267] (-419.629) (-415.347) (-418.254) -- 0:00:46
      207000 -- (-415.941) (-415.575) (-417.184) [-416.097] * (-416.671) (-415.800) [-415.383] (-420.209) -- 0:00:45
      207500 -- [-416.230] (-417.325) (-416.925) (-415.264) * (-415.564) (-415.527) (-414.990) [-416.636] -- 0:00:45
      208000 -- (-417.745) (-416.498) [-417.443] (-415.561) * [-414.569] (-417.251) (-417.274) (-419.508) -- 0:00:45
      208500 -- (-421.810) (-417.988) [-418.952] (-416.196) * (-414.560) (-420.472) (-418.065) [-417.760] -- 0:00:45
      209000 -- (-416.188) (-417.197) [-420.673] (-417.802) * (-415.040) (-421.265) (-419.097) [-417.836] -- 0:00:49
      209500 -- (-416.038) (-417.666) [-417.460] (-415.750) * [-415.966] (-414.892) (-415.706) (-417.185) -- 0:00:49
      210000 -- (-415.024) (-415.439) [-416.424] (-416.482) * (-418.984) (-416.755) [-416.489] (-415.893) -- 0:00:48

      Average standard deviation of split frequencies: 0.017901

      210500 -- (-417.788) [-416.120] (-416.735) (-416.802) * (-417.096) (-416.250) (-418.689) [-416.184] -- 0:00:48
      211000 -- (-415.504) (-421.262) [-416.637] (-417.218) * (-415.441) [-418.547] (-415.845) (-420.045) -- 0:00:48
      211500 -- (-416.015) (-419.213) [-415.360] (-414.708) * [-418.341] (-416.956) (-415.363) (-417.309) -- 0:00:48
      212000 -- (-415.966) [-416.563] (-415.133) (-415.029) * [-414.930] (-416.522) (-417.649) (-415.922) -- 0:00:48
      212500 -- [-419.240] (-420.671) (-416.080) (-418.314) * [-416.151] (-417.704) (-416.408) (-420.218) -- 0:00:48
      213000 -- (-419.925) (-421.398) (-416.575) [-415.811] * [-417.417] (-415.623) (-416.674) (-414.959) -- 0:00:48
      213500 -- [-419.295] (-417.629) (-416.167) (-417.089) * (-418.024) (-415.018) (-418.708) [-416.656] -- 0:00:47
      214000 -- (-416.275) [-416.080] (-415.777) (-421.079) * (-420.012) (-417.011) [-419.242] (-416.832) -- 0:00:47
      214500 -- (-417.584) (-416.688) (-419.505) [-418.775] * (-415.794) (-418.479) (-418.347) [-415.417] -- 0:00:47
      215000 -- (-416.830) [-417.141] (-416.065) (-418.095) * (-415.601) [-415.539] (-417.331) (-417.339) -- 0:00:47

      Average standard deviation of split frequencies: 0.018987

      215500 -- (-415.891) (-420.086) [-416.650] (-417.162) * (-416.722) [-415.432] (-418.143) (-416.090) -- 0:00:47
      216000 -- (-424.509) [-418.084] (-415.198) (-416.900) * [-419.803] (-417.622) (-420.241) (-414.818) -- 0:00:47
      216500 -- (-416.231) (-417.582) (-415.137) [-415.650] * [-415.584] (-415.715) (-420.537) (-418.959) -- 0:00:47
      217000 -- (-416.376) [-415.909] (-421.127) (-414.938) * (-416.824) (-416.373) (-416.592) [-414.868] -- 0:00:46
      217500 -- [-420.065] (-417.354) (-416.643) (-416.572) * (-415.883) [-415.563] (-416.370) (-415.521) -- 0:00:46
      218000 -- (-417.967) [-415.544] (-417.211) (-415.030) * (-416.232) (-416.125) [-415.185] (-417.858) -- 0:00:46
      218500 -- [-416.965] (-419.779) (-418.672) (-415.659) * (-418.003) (-420.220) (-418.355) [-415.960] -- 0:00:46
      219000 -- [-417.990] (-416.689) (-418.620) (-418.676) * [-416.371] (-415.813) (-416.296) (-418.740) -- 0:00:46
      219500 -- (-417.105) [-415.497] (-417.636) (-415.182) * [-416.815] (-416.078) (-416.146) (-419.969) -- 0:00:46
      220000 -- (-422.364) (-417.128) [-416.926] (-416.515) * [-417.620] (-418.404) (-416.566) (-416.051) -- 0:00:46

      Average standard deviation of split frequencies: 0.019974

      220500 -- (-419.151) [-415.192] (-415.768) (-423.731) * (-415.386) (-416.018) (-418.001) [-417.231] -- 0:00:45
      221000 -- [-416.010] (-414.715) (-421.202) (-420.296) * [-416.251] (-418.886) (-416.755) (-417.094) -- 0:00:45
      221500 -- [-415.920] (-416.535) (-417.048) (-421.826) * (-417.488) (-414.932) (-416.972) [-416.033] -- 0:00:45
      222000 -- (-416.924) (-414.588) [-417.716] (-417.222) * (-420.058) [-415.591] (-417.043) (-416.003) -- 0:00:45
      222500 -- [-416.009] (-415.353) (-416.135) (-415.088) * (-416.060) [-415.576] (-414.593) (-414.943) -- 0:00:45
      223000 -- (-417.170) [-416.017] (-415.066) (-417.230) * (-415.129) [-417.182] (-417.364) (-418.102) -- 0:00:45
      223500 -- (-418.086) [-421.692] (-419.391) (-414.862) * (-414.945) [-415.590] (-417.875) (-420.650) -- 0:00:45
      224000 -- (-421.249) [-422.952] (-419.237) (-416.136) * [-419.064] (-415.071) (-416.707) (-416.266) -- 0:00:45
      224500 -- (-415.704) [-416.769] (-419.472) (-415.195) * (-416.768) (-417.206) (-421.540) [-420.528] -- 0:00:44
      225000 -- (-414.994) (-419.340) [-417.877] (-417.512) * (-415.786) [-416.878] (-415.740) (-416.083) -- 0:00:44

      Average standard deviation of split frequencies: 0.019816

      225500 -- [-417.169] (-417.627) (-414.797) (-415.360) * (-415.382) (-417.151) [-418.702] (-415.947) -- 0:00:48
      226000 -- [-418.353] (-415.417) (-415.082) (-417.644) * (-423.422) (-415.359) (-419.324) [-420.543] -- 0:00:47
      226500 -- (-416.534) (-415.944) [-419.871] (-417.126) * (-418.874) (-425.352) [-415.466] (-416.602) -- 0:00:47
      227000 -- (-417.037) (-416.966) [-421.884] (-414.648) * [-421.247] (-422.545) (-417.583) (-421.797) -- 0:00:47
      227500 -- (-416.749) [-418.824] (-414.975) (-414.764) * (-416.682) (-419.148) [-415.825] (-417.429) -- 0:00:47
      228000 -- (-415.613) [-414.739] (-415.560) (-418.069) * (-422.834) [-414.831] (-416.613) (-418.486) -- 0:00:47
      228500 -- (-415.941) (-415.386) (-416.259) [-418.395] * (-417.009) (-415.848) (-420.877) [-417.964] -- 0:00:47
      229000 -- (-414.806) (-418.229) [-415.624] (-416.154) * (-415.707) (-414.567) (-415.901) [-418.248] -- 0:00:47
      229500 -- (-420.338) (-415.727) (-416.474) [-415.590] * [-416.547] (-415.613) (-416.609) (-427.195) -- 0:00:47
      230000 -- [-415.102] (-415.537) (-416.596) (-414.925) * (-414.658) [-416.557] (-421.133) (-416.730) -- 0:00:46

      Average standard deviation of split frequencies: 0.020550

      230500 -- (-415.450) [-419.352] (-417.624) (-416.324) * (-415.469) (-416.480) (-419.843) [-415.590] -- 0:00:46
      231000 -- [-414.716] (-417.621) (-420.179) (-420.466) * (-415.806) (-420.283) (-419.557) [-415.485] -- 0:00:46
      231500 -- (-416.360) (-415.842) (-417.921) [-417.318] * [-415.558] (-415.317) (-414.697) (-422.400) -- 0:00:46
      232000 -- (-416.388) [-415.539] (-416.301) (-420.082) * [-416.227] (-415.379) (-414.806) (-417.937) -- 0:00:46
      232500 -- (-416.697) [-418.919] (-419.538) (-418.657) * (-418.126) (-417.195) [-416.640] (-417.285) -- 0:00:46
      233000 -- [-415.245] (-418.438) (-416.515) (-416.562) * (-418.942) (-416.638) (-416.975) [-415.856] -- 0:00:46
      233500 -- (-417.752) (-417.003) [-415.420] (-414.565) * (-415.201) (-416.121) [-415.728] (-416.571) -- 0:00:45
      234000 -- (-416.519) (-416.301) [-415.028] (-414.999) * (-415.081) (-415.645) [-416.343] (-417.693) -- 0:00:45
      234500 -- (-416.457) [-415.959] (-417.121) (-414.923) * (-423.401) (-416.268) [-418.223] (-416.314) -- 0:00:45
      235000 -- [-417.651] (-416.457) (-415.724) (-417.130) * (-414.973) (-419.180) [-418.841] (-423.405) -- 0:00:45

      Average standard deviation of split frequencies: 0.020197

      235500 -- [-415.942] (-416.890) (-416.882) (-418.469) * (-416.568) [-419.110] (-418.003) (-417.897) -- 0:00:45
      236000 -- (-422.140) [-417.025] (-418.403) (-418.690) * (-417.894) (-417.481) (-415.252) [-416.309] -- 0:00:45
      236500 -- (-421.552) [-415.171] (-416.834) (-415.902) * (-416.709) [-417.465] (-417.766) (-417.113) -- 0:00:45
      237000 -- (-417.247) [-415.825] (-417.134) (-416.729) * (-416.770) (-415.986) (-415.567) [-416.459] -- 0:00:45
      237500 -- (-417.593) [-415.389] (-415.896) (-416.280) * (-421.546) (-416.152) [-417.335] (-419.655) -- 0:00:44
      238000 -- (-416.395) [-414.698] (-415.295) (-415.712) * (-421.118) (-418.891) (-417.227) [-417.241] -- 0:00:44
      238500 -- (-416.837) (-416.691) [-418.446] (-414.977) * (-415.406) [-415.895] (-415.661) (-417.654) -- 0:00:44
      239000 -- (-415.533) [-414.625] (-418.960) (-415.216) * (-415.801) (-417.552) [-414.999] (-416.555) -- 0:00:44
      239500 -- (-418.246) (-414.627) (-416.224) [-416.450] * (-415.419) (-419.354) (-416.076) [-419.799] -- 0:00:44
      240000 -- (-419.964) [-419.838] (-418.315) (-416.320) * (-420.425) [-415.933] (-415.834) (-419.061) -- 0:00:44

      Average standard deviation of split frequencies: 0.019278

      240500 -- (-416.488) (-416.893) (-417.418) [-415.700] * (-417.106) [-415.867] (-415.332) (-416.614) -- 0:00:44
      241000 -- (-417.001) (-418.021) [-417.111] (-415.822) * (-417.816) [-416.192] (-416.292) (-416.304) -- 0:00:44
      241500 -- (-415.769) (-421.702) [-417.289] (-415.282) * (-417.672) [-420.757] (-415.000) (-417.903) -- 0:00:43
      242000 -- [-419.898] (-418.673) (-417.784) (-415.197) * [-417.232] (-419.028) (-417.160) (-419.349) -- 0:00:43
      242500 -- [-418.969] (-415.139) (-415.438) (-416.919) * (-417.979) (-418.983) (-421.676) [-416.516] -- 0:00:46
      243000 -- (-417.594) [-418.366] (-418.658) (-422.027) * (-418.397) (-416.711) (-418.993) [-416.668] -- 0:00:46
      243500 -- (-414.555) (-417.045) (-419.116) [-417.297] * (-415.776) (-418.513) (-418.736) [-416.873] -- 0:00:46
      244000 -- [-415.496] (-417.014) (-419.302) (-417.117) * (-415.597) [-415.263] (-416.192) (-418.001) -- 0:00:46
      244500 -- (-422.669) (-416.454) [-415.890] (-417.311) * (-415.022) (-421.333) (-417.884) [-418.318] -- 0:00:46
      245000 -- (-421.235) (-422.188) [-416.579] (-416.694) * (-416.953) [-419.263] (-415.700) (-415.812) -- 0:00:46

      Average standard deviation of split frequencies: 0.018356

      245500 -- [-418.612] (-417.196) (-417.900) (-416.808) * (-417.586) (-419.988) [-417.920] (-415.502) -- 0:00:46
      246000 -- (-416.730) [-417.576] (-417.344) (-417.154) * (-417.827) [-416.192] (-416.597) (-416.701) -- 0:00:45
      246500 -- (-418.210) [-418.039] (-417.710) (-417.984) * (-416.037) (-415.624) (-417.513) [-417.303] -- 0:00:45
      247000 -- (-422.614) (-416.145) [-415.947] (-417.515) * (-416.119) [-416.230] (-417.048) (-420.518) -- 0:00:45
      247500 -- (-418.010) (-417.246) (-414.858) [-417.142] * [-417.588] (-417.179) (-417.669) (-416.971) -- 0:00:45
      248000 -- (-417.935) [-418.014] (-417.220) (-418.817) * [-415.991] (-417.069) (-417.002) (-415.628) -- 0:00:45
      248500 -- (-417.156) (-416.795) [-416.352] (-417.926) * (-416.855) (-416.724) [-417.205] (-417.793) -- 0:00:45
      249000 -- (-423.460) [-414.809] (-415.668) (-415.313) * (-419.997) [-421.743] (-415.644) (-418.639) -- 0:00:45
      249500 -- (-418.929) (-416.634) [-415.429] (-418.835) * (-414.578) [-416.743] (-415.535) (-421.181) -- 0:00:45
      250000 -- (-415.989) (-416.729) [-416.407] (-420.232) * (-417.712) (-419.450) (-416.152) [-416.559] -- 0:00:45

      Average standard deviation of split frequencies: 0.017239

      250500 -- (-416.506) (-417.147) [-419.579] (-418.284) * (-415.801) (-417.829) (-417.903) [-416.429] -- 0:00:44
      251000 -- (-416.445) [-415.969] (-417.795) (-415.526) * (-417.832) [-417.238] (-417.853) (-417.061) -- 0:00:44
      251500 -- [-419.747] (-420.657) (-415.192) (-416.786) * (-419.227) (-421.311) [-419.730] (-414.438) -- 0:00:44
      252000 -- (-422.212) [-416.564] (-419.730) (-418.192) * (-418.103) (-415.954) (-418.317) [-416.651] -- 0:00:44
      252500 -- (-417.551) [-418.455] (-420.443) (-416.063) * (-418.006) (-415.912) (-416.704) [-415.901] -- 0:00:44
      253000 -- (-414.704) (-416.657) [-415.745] (-415.603) * (-415.283) [-415.917] (-415.740) (-418.832) -- 0:00:44
      253500 -- (-415.090) [-415.729] (-417.614) (-417.158) * (-416.867) [-415.298] (-416.543) (-415.912) -- 0:00:44
      254000 -- (-416.900) [-416.785] (-414.675) (-415.431) * (-420.492) [-415.388] (-420.203) (-416.952) -- 0:00:44
      254500 -- [-416.816] (-416.724) (-419.035) (-415.638) * (-422.310) (-416.692) [-419.233] (-418.470) -- 0:00:43
      255000 -- (-416.191) (-417.074) [-416.032] (-420.540) * (-415.388) (-416.973) [-417.434] (-416.808) -- 0:00:43

      Average standard deviation of split frequencies: 0.016061

      255500 -- [-417.787] (-417.310) (-417.699) (-423.665) * [-415.511] (-416.479) (-417.417) (-417.513) -- 0:00:43
      256000 -- (-420.120) (-417.587) [-417.126] (-416.836) * (-417.087) [-414.899] (-415.390) (-415.931) -- 0:00:43
      256500 -- (-419.078) (-414.890) (-417.132) [-416.186] * [-416.980] (-419.979) (-415.768) (-415.229) -- 0:00:43
      257000 -- (-418.729) [-415.470] (-414.975) (-416.622) * (-415.407) [-417.365] (-417.500) (-418.419) -- 0:00:43
      257500 -- (-416.845) (-417.779) (-418.373) [-417.295] * [-417.142] (-420.667) (-418.652) (-417.696) -- 0:00:43
      258000 -- (-417.718) [-418.004] (-421.236) (-419.712) * [-417.964] (-418.077) (-416.496) (-417.691) -- 0:00:43
      258500 -- (-418.295) [-416.930] (-421.548) (-417.996) * (-417.521) [-415.958] (-417.007) (-415.534) -- 0:00:43
      259000 -- (-415.561) (-415.773) (-419.758) [-417.190] * (-416.859) [-417.390] (-417.354) (-415.733) -- 0:00:42
      259500 -- (-416.881) [-417.151] (-420.605) (-419.244) * (-427.238) [-420.010] (-417.225) (-416.628) -- 0:00:45
      260000 -- [-414.724] (-416.222) (-416.459) (-416.462) * (-416.669) [-418.100] (-416.057) (-417.334) -- 0:00:45

      Average standard deviation of split frequencies: 0.015271

      260500 -- (-416.144) [-417.402] (-418.270) (-416.588) * [-418.582] (-420.749) (-418.642) (-415.173) -- 0:00:45
      261000 -- (-415.018) [-416.912] (-416.068) (-419.849) * (-420.016) [-416.026] (-415.796) (-417.281) -- 0:00:45
      261500 -- [-418.218] (-420.791) (-417.497) (-420.992) * [-415.895] (-423.710) (-414.879) (-415.106) -- 0:00:45
      262000 -- (-416.500) [-420.636] (-418.982) (-419.491) * (-419.938) (-417.769) (-415.602) [-415.491] -- 0:00:45
      262500 -- [-415.172] (-418.887) (-417.554) (-416.368) * (-417.340) [-416.144] (-415.599) (-417.266) -- 0:00:44
      263000 -- [-414.652] (-417.884) (-417.060) (-419.026) * [-415.657] (-421.224) (-417.320) (-418.573) -- 0:00:44
      263500 -- (-414.752) (-419.822) (-420.419) [-416.157] * (-416.925) [-419.946] (-416.911) (-419.644) -- 0:00:44
      264000 -- [-419.167] (-417.925) (-415.928) (-416.762) * (-417.800) (-418.031) [-417.159] (-416.421) -- 0:00:44
      264500 -- [-416.119] (-416.052) (-415.848) (-417.586) * [-416.043] (-417.553) (-416.035) (-416.618) -- 0:00:44
      265000 -- (-415.774) (-415.598) (-416.696) [-418.318] * [-421.126] (-418.854) (-418.681) (-419.999) -- 0:00:44

      Average standard deviation of split frequencies: 0.015851

      265500 -- (-418.435) (-414.916) (-416.542) [-418.992] * (-415.009) (-423.991) [-416.181] (-416.421) -- 0:00:44
      266000 -- (-415.797) (-416.992) [-417.419] (-421.600) * (-416.337) [-418.150] (-417.999) (-417.310) -- 0:00:44
      266500 -- (-418.088) [-415.845] (-415.211) (-421.902) * (-415.603) (-418.417) [-414.788] (-415.718) -- 0:00:44
      267000 -- (-415.482) (-417.154) [-415.363] (-417.236) * (-415.971) [-417.431] (-415.039) (-417.927) -- 0:00:43
      267500 -- (-415.791) (-418.123) [-416.523] (-419.773) * [-415.862] (-415.610) (-414.976) (-416.428) -- 0:00:43
      268000 -- (-416.867) [-417.016] (-418.764) (-421.846) * (-417.420) [-419.851] (-420.403) (-416.846) -- 0:00:43
      268500 -- (-417.939) (-419.001) [-416.094] (-421.520) * [-415.820] (-420.628) (-416.237) (-415.709) -- 0:00:43
      269000 -- (-417.401) [-416.505] (-416.008) (-416.956) * (-416.235) [-415.064] (-416.234) (-414.636) -- 0:00:43
      269500 -- (-417.248) (-420.363) (-418.423) [-416.554] * [-415.893] (-416.384) (-417.741) (-414.789) -- 0:00:43
      270000 -- (-417.405) [-415.188] (-417.353) (-414.693) * (-417.045) (-417.200) [-416.639] (-416.229) -- 0:00:43

      Average standard deviation of split frequencies: 0.013016

      270500 -- [-416.787] (-416.465) (-418.664) (-417.883) * (-417.230) (-416.331) (-415.760) [-416.236] -- 0:00:43
      271000 -- (-417.019) (-415.436) (-417.841) [-416.642] * (-416.998) (-416.616) (-417.506) [-416.246] -- 0:00:43
      271500 -- (-417.354) (-416.017) (-416.614) [-416.923] * (-416.376) [-415.391] (-416.051) (-415.164) -- 0:00:42
      272000 -- (-418.646) (-417.882) [-414.975] (-416.771) * [-415.617] (-415.628) (-418.214) (-418.662) -- 0:00:42
      272500 -- (-421.716) (-416.261) (-417.239) [-416.017] * (-417.702) [-416.237] (-415.491) (-420.583) -- 0:00:42
      273000 -- [-418.070] (-416.788) (-416.234) (-416.263) * (-418.946) (-414.998) (-416.620) [-417.555] -- 0:00:42
      273500 -- (-415.709) (-418.008) [-415.768] (-419.488) * (-420.551) [-417.381] (-416.851) (-417.594) -- 0:00:42
      274000 -- (-414.633) [-419.632] (-416.254) (-418.171) * (-417.076) (-419.774) [-416.155] (-417.556) -- 0:00:42
      274500 -- [-415.347] (-419.719) (-418.485) (-415.444) * [-414.842] (-416.191) (-414.893) (-418.664) -- 0:00:42
      275000 -- (-415.714) (-415.746) (-417.715) [-414.829] * (-414.885) (-417.774) (-417.785) [-415.307] -- 0:00:42

      Average standard deviation of split frequencies: 0.012495

      275500 -- [-417.137] (-415.865) (-415.031) (-415.785) * [-415.313] (-416.511) (-417.239) (-416.971) -- 0:00:42
      276000 -- (-416.590) (-416.712) (-418.029) [-415.199] * (-417.691) [-417.437] (-418.377) (-420.185) -- 0:00:41
      276500 -- (-416.524) (-415.392) (-415.871) [-419.777] * [-419.644] (-417.422) (-418.044) (-420.966) -- 0:00:44
      277000 -- (-417.030) (-419.486) (-416.001) [-418.404] * (-416.166) (-417.630) [-417.272] (-416.074) -- 0:00:44
      277500 -- [-417.270] (-417.148) (-415.230) (-419.244) * (-416.601) (-421.978) (-416.352) [-414.967] -- 0:00:44
      278000 -- [-416.856] (-417.626) (-417.509) (-419.397) * (-418.598) (-420.702) [-416.199] (-415.375) -- 0:00:44
      278500 -- (-418.167) (-416.817) [-417.979] (-415.517) * [-416.911] (-420.061) (-416.755) (-415.844) -- 0:00:44
      279000 -- (-419.770) (-419.651) (-419.509) [-415.930] * (-424.122) (-418.325) [-416.367] (-415.338) -- 0:00:43
      279500 -- [-420.005] (-417.476) (-419.568) (-418.554) * (-423.132) [-418.390] (-415.542) (-417.192) -- 0:00:43
      280000 -- (-419.919) (-416.798) (-419.037) [-416.099] * [-417.504] (-416.745) (-417.939) (-416.157) -- 0:00:43

      Average standard deviation of split frequencies: 0.010696

      280500 -- (-420.590) (-415.039) (-419.854) [-415.211] * (-417.928) (-416.769) (-416.583) [-418.435] -- 0:00:43
      281000 -- (-416.937) (-415.519) [-416.502] (-416.361) * (-424.674) [-419.037] (-421.424) (-416.917) -- 0:00:43
      281500 -- (-424.540) [-415.476] (-421.821) (-415.394) * (-419.603) (-414.741) [-417.311] (-420.186) -- 0:00:43
      282000 -- (-418.667) (-418.367) [-415.461] (-417.276) * (-418.101) (-415.810) (-417.897) [-415.781] -- 0:00:43
      282500 -- (-415.922) (-418.040) [-415.031] (-416.379) * [-418.009] (-417.156) (-416.142) (-418.503) -- 0:00:43
      283000 -- (-422.686) (-415.956) [-415.444] (-414.955) * (-420.912) [-417.410] (-419.935) (-416.622) -- 0:00:43
      283500 -- (-418.783) (-416.986) (-418.946) [-416.185] * (-417.235) (-420.402) (-416.320) [-417.082] -- 0:00:42
      284000 -- (-416.915) [-416.629] (-424.079) (-417.316) * (-415.287) (-415.965) [-417.355] (-417.213) -- 0:00:42
      284500 -- (-415.441) [-415.223] (-417.505) (-415.582) * [-416.174] (-422.313) (-415.922) (-417.777) -- 0:00:42
      285000 -- (-416.054) (-416.514) (-415.772) [-417.375] * (-415.594) [-416.064] (-418.597) (-416.017) -- 0:00:42

      Average standard deviation of split frequencies: 0.010584

      285500 -- [-416.185] (-415.061) (-419.158) (-420.501) * (-420.062) [-416.530] (-414.835) (-418.385) -- 0:00:42
      286000 -- (-415.534) (-417.556) (-421.490) [-417.968] * [-415.484] (-417.770) (-415.043) (-416.136) -- 0:00:42
      286500 -- [-415.155] (-416.023) (-422.403) (-416.862) * (-419.263) (-415.463) [-417.894] (-417.177) -- 0:00:42
      287000 -- (-418.182) [-415.825] (-420.768) (-417.237) * (-417.647) (-415.053) (-419.526) [-415.419] -- 0:00:42
      287500 -- (-418.409) [-416.683] (-416.730) (-417.156) * (-414.662) (-414.779) [-416.349] (-423.226) -- 0:00:42
      288000 -- [-414.780] (-415.067) (-417.721) (-422.104) * [-416.365] (-414.957) (-418.716) (-417.148) -- 0:00:42
      288500 -- (-414.833) (-417.700) [-418.117] (-416.496) * (-415.134) (-419.732) [-416.075] (-415.262) -- 0:00:41
      289000 -- (-414.956) [-415.877] (-415.489) (-419.002) * (-415.788) (-418.808) [-421.117] (-417.889) -- 0:00:41
      289500 -- [-415.154] (-415.404) (-416.841) (-416.192) * [-415.264] (-416.054) (-418.569) (-418.612) -- 0:00:41
      290000 -- (-414.780) (-418.359) [-416.269] (-415.913) * (-415.355) (-416.017) (-415.681) [-415.285] -- 0:00:41

      Average standard deviation of split frequencies: 0.011523

      290500 -- (-417.710) [-415.700] (-417.891) (-415.516) * (-420.391) (-420.842) (-417.928) [-416.135] -- 0:00:41
      291000 -- (-419.804) (-415.688) (-415.720) [-418.609] * (-416.827) [-418.319] (-416.607) (-417.450) -- 0:00:41
      291500 -- (-416.814) (-417.191) (-415.077) [-416.981] * (-418.900) (-417.713) (-415.734) [-420.284] -- 0:00:41
      292000 -- [-416.136] (-415.892) (-416.290) (-415.122) * [-416.706] (-416.168) (-417.290) (-415.928) -- 0:00:41
      292500 -- (-415.636) (-419.265) (-416.785) [-416.995] * [-417.174] (-417.320) (-414.967) (-416.601) -- 0:00:41
      293000 -- [-416.646] (-419.306) (-417.946) (-417.124) * (-418.104) (-417.880) (-414.968) [-417.311] -- 0:00:43
      293500 -- (-418.099) (-415.017) (-414.790) [-417.279] * (-417.602) [-415.042] (-418.402) (-417.865) -- 0:00:43
      294000 -- (-416.613) (-416.484) [-416.443] (-418.205) * (-415.387) (-418.648) [-417.339] (-416.746) -- 0:00:43
      294500 -- (-416.200) (-416.190) [-415.320] (-420.128) * (-415.881) (-418.646) [-417.333] (-418.854) -- 0:00:43
      295000 -- [-415.780] (-418.189) (-415.474) (-418.839) * (-416.918) (-417.683) (-416.745) [-414.820] -- 0:00:43

      Average standard deviation of split frequencies: 0.011767

      295500 -- (-418.846) (-419.592) [-415.551] (-421.072) * (-416.122) (-417.765) [-416.372] (-416.329) -- 0:00:42
      296000 -- (-415.177) (-415.835) [-415.739] (-417.773) * (-414.888) [-419.870] (-415.672) (-417.885) -- 0:00:42
      296500 -- (-418.287) [-416.552] (-416.707) (-415.905) * [-417.980] (-416.615) (-415.643) (-415.574) -- 0:00:42
      297000 -- [-418.896] (-416.790) (-416.137) (-417.381) * (-415.321) (-418.513) [-417.946] (-420.240) -- 0:00:42
      297500 -- (-417.177) [-416.572] (-416.979) (-417.625) * [-416.217] (-415.866) (-418.738) (-416.522) -- 0:00:42
      298000 -- (-415.237) (-416.803) [-416.692] (-417.448) * (-422.358) (-417.172) (-416.649) [-416.240] -- 0:00:42
      298500 -- (-418.796) (-416.815) (-417.395) [-415.962] * (-421.730) (-416.542) [-420.024] (-416.654) -- 0:00:42
      299000 -- (-417.340) (-417.821) [-416.597] (-416.417) * (-421.525) [-416.916] (-420.305) (-416.033) -- 0:00:42
      299500 -- (-417.062) [-418.591] (-418.865) (-415.696) * (-416.139) [-415.147] (-417.712) (-416.317) -- 0:00:42
      300000 -- (-419.716) (-415.951) [-419.131] (-416.078) * (-418.778) [-415.828] (-417.098) (-418.439) -- 0:00:42

      Average standard deviation of split frequencies: 0.010801

      300500 -- (-415.895) [-416.774] (-415.006) (-418.948) * (-417.125) [-416.899] (-416.668) (-421.993) -- 0:00:41
      301000 -- (-416.794) (-418.792) (-415.892) [-416.209] * (-417.019) (-414.959) (-416.623) [-417.678] -- 0:00:41
      301500 -- (-418.338) [-418.843] (-416.885) (-416.440) * (-424.184) [-416.284] (-416.836) (-418.002) -- 0:00:41
      302000 -- (-417.765) (-416.162) (-418.771) [-418.616] * [-416.572] (-416.956) (-415.561) (-414.723) -- 0:00:41
      302500 -- (-419.078) (-416.699) (-416.271) [-418.041] * (-415.618) (-417.799) (-417.557) [-416.037] -- 0:00:41
      303000 -- (-420.319) (-417.657) [-415.919] (-418.394) * [-416.360] (-418.167) (-417.592) (-418.807) -- 0:00:41
      303500 -- [-419.698] (-416.452) (-419.680) (-415.518) * (-415.426) (-416.906) (-416.748) [-415.059] -- 0:00:41
      304000 -- [-417.691] (-419.604) (-415.762) (-415.261) * (-416.152) [-417.186] (-417.911) (-418.634) -- 0:00:41
      304500 -- (-414.703) (-418.283) (-419.130) [-416.177] * [-418.028] (-416.931) (-417.366) (-418.248) -- 0:00:41
      305000 -- (-417.226) (-418.410) (-415.805) [-416.071] * [-415.149] (-417.541) (-417.437) (-415.087) -- 0:00:41

      Average standard deviation of split frequencies: 0.010703

      305500 -- (-419.195) [-418.906] (-420.274) (-418.856) * [-415.086] (-418.814) (-416.149) (-415.655) -- 0:00:40
      306000 -- (-418.468) (-417.571) [-417.753] (-417.406) * (-416.431) [-416.484] (-416.304) (-415.878) -- 0:00:40
      306500 -- (-417.432) (-417.070) [-418.452] (-418.074) * (-418.575) (-414.768) [-421.012] (-418.388) -- 0:00:40
      307000 -- (-416.733) (-417.069) [-417.534] (-419.528) * [-415.977] (-416.202) (-416.326) (-416.683) -- 0:00:40
      307500 -- (-417.208) (-419.239) (-419.929) [-417.240] * (-414.863) (-414.768) [-416.301] (-416.668) -- 0:00:40
      308000 -- (-418.001) (-416.833) [-416.838] (-417.802) * (-417.792) (-415.157) (-419.294) [-414.753] -- 0:00:40
      308500 -- (-419.021) (-415.800) [-415.405] (-414.450) * (-414.919) (-414.583) [-417.972] (-417.368) -- 0:00:40
      309000 -- [-417.386] (-416.267) (-417.359) (-418.651) * (-415.048) (-416.149) (-419.231) [-416.716] -- 0:00:40
      309500 -- (-417.662) [-417.016] (-419.589) (-416.346) * (-415.461) [-415.249] (-417.478) (-423.296) -- 0:00:40
      310000 -- (-416.695) [-421.178] (-418.692) (-418.138) * (-416.490) (-415.219) [-418.732] (-420.306) -- 0:00:42

      Average standard deviation of split frequencies: 0.009694

      310500 -- (-416.056) (-417.550) (-416.887) [-418.192] * (-418.785) (-416.039) [-417.281] (-416.164) -- 0:00:42
      311000 -- (-416.260) (-415.521) (-416.361) [-417.862] * (-415.275) [-415.789] (-415.652) (-417.906) -- 0:00:42
      311500 -- (-417.428) (-415.842) [-416.699] (-418.753) * [-417.780] (-415.741) (-415.400) (-416.824) -- 0:00:41
      312000 -- [-416.462] (-416.840) (-418.303) (-415.954) * (-417.396) [-417.661] (-417.503) (-416.616) -- 0:00:41
      312500 -- (-415.084) (-416.231) [-416.720] (-416.936) * (-419.588) (-418.059) (-418.729) [-417.258] -- 0:00:41
      313000 -- (-415.129) [-417.025] (-418.635) (-421.188) * (-415.429) (-415.448) [-416.330] (-415.120) -- 0:00:41
      313500 -- (-416.384) (-416.485) [-418.714] (-416.083) * (-415.564) [-416.394] (-417.035) (-416.508) -- 0:00:41
      314000 -- (-416.099) (-415.670) [-417.021] (-417.678) * (-422.837) [-420.538] (-416.663) (-415.308) -- 0:00:41
      314500 -- (-417.131) [-416.307] (-415.695) (-418.654) * (-415.492) (-420.716) [-417.522] (-418.634) -- 0:00:41
      315000 -- (-417.030) (-417.250) (-414.819) [-416.219] * (-415.551) [-415.856] (-415.421) (-415.795) -- 0:00:41

      Average standard deviation of split frequencies: 0.009214

      315500 -- (-415.899) [-416.998] (-416.686) (-422.265) * (-415.512) (-416.933) [-417.588] (-417.169) -- 0:00:41
      316000 -- [-416.544] (-417.813) (-418.822) (-422.969) * (-418.428) (-417.012) [-418.330] (-416.008) -- 0:00:41
      316500 -- [-415.525] (-417.955) (-418.293) (-419.949) * (-416.947) [-416.392] (-417.172) (-415.915) -- 0:00:41
      317000 -- (-414.599) [-415.586] (-417.574) (-415.747) * [-421.900] (-417.438) (-420.080) (-417.356) -- 0:00:40
      317500 -- [-416.478] (-415.130) (-416.456) (-416.363) * [-415.726] (-417.233) (-416.986) (-418.231) -- 0:00:40
      318000 -- [-419.261] (-416.370) (-414.852) (-418.320) * (-415.133) (-417.520) [-418.141] (-415.128) -- 0:00:40
      318500 -- (-423.417) (-416.171) [-416.158] (-418.540) * (-415.904) (-415.726) (-421.730) [-417.595] -- 0:00:40
      319000 -- (-416.912) (-416.257) [-417.862] (-424.009) * (-417.675) (-417.513) (-417.215) [-415.328] -- 0:00:40
      319500 -- (-416.582) [-415.464] (-417.260) (-418.118) * (-418.102) [-415.559] (-416.924) (-416.441) -- 0:00:40
      320000 -- (-414.715) (-416.659) (-416.789) [-416.812] * (-415.906) (-416.777) (-418.021) [-416.949] -- 0:00:40

      Average standard deviation of split frequencies: 0.009858

      320500 -- (-415.738) [-415.830] (-417.320) (-417.355) * (-417.458) [-417.931] (-418.571) (-416.039) -- 0:00:40
      321000 -- (-420.347) (-417.072) [-414.679] (-421.649) * (-418.806) (-416.024) (-421.121) [-415.639] -- 0:00:40
      321500 -- (-416.450) [-415.923] (-417.632) (-417.499) * (-419.451) [-414.819] (-416.380) (-417.042) -- 0:00:40
      322000 -- (-416.619) (-418.603) [-417.363] (-421.769) * (-416.563) (-415.547) [-416.469] (-418.353) -- 0:00:40
      322500 -- (-417.346) [-419.714] (-416.537) (-418.735) * (-415.967) (-416.521) (-416.335) [-414.611] -- 0:00:39
      323000 -- (-415.214) (-415.309) [-417.989] (-416.002) * (-418.628) (-417.327) [-417.357] (-415.403) -- 0:00:39
      323500 -- (-416.341) (-416.982) (-417.113) [-416.116] * [-416.575] (-416.775) (-421.002) (-417.203) -- 0:00:39
      324000 -- (-416.602) (-415.771) [-416.122] (-416.109) * (-415.840) (-415.022) (-416.994) [-415.970] -- 0:00:39
      324500 -- (-415.460) (-419.961) [-420.145] (-415.920) * (-416.235) (-415.809) (-417.687) [-417.093] -- 0:00:39
      325000 -- (-417.685) (-416.990) (-416.360) [-418.554] * [-415.493] (-417.805) (-419.405) (-417.143) -- 0:00:39

      Average standard deviation of split frequencies: 0.009782

      325500 -- (-418.459) (-414.965) (-417.405) [-419.296] * (-415.546) (-419.856) (-417.597) [-419.963] -- 0:00:41
      326000 -- (-421.292) [-416.655] (-421.392) (-418.181) * [-415.237] (-418.266) (-416.729) (-417.846) -- 0:00:41
      326500 -- [-415.715] (-414.901) (-416.784) (-416.187) * (-422.194) (-416.218) [-416.476] (-420.011) -- 0:00:41
      327000 -- (-418.268) (-416.528) (-417.023) [-417.476] * (-417.789) (-415.963) [-417.148] (-415.837) -- 0:00:41
      327500 -- (-418.052) [-415.000] (-417.125) (-416.527) * (-419.445) (-415.252) [-415.842] (-415.312) -- 0:00:41
      328000 -- (-418.877) (-414.701) [-421.506] (-418.071) * (-418.694) (-417.009) (-416.204) [-416.296] -- 0:00:40
      328500 -- (-422.243) (-416.803) (-417.832) [-416.516] * (-417.169) (-420.288) [-415.813] (-417.616) -- 0:00:40
      329000 -- (-416.085) (-416.311) [-416.413] (-416.302) * [-415.056] (-417.737) (-417.509) (-415.776) -- 0:00:40
      329500 -- (-416.772) (-417.248) (-417.375) [-423.739] * (-418.405) (-420.536) (-417.453) [-416.251] -- 0:00:40
      330000 -- (-419.562) [-419.400] (-416.938) (-416.891) * (-419.756) (-416.386) (-423.304) [-415.273] -- 0:00:40

      Average standard deviation of split frequencies: 0.010482

      330500 -- (-416.391) (-417.202) (-415.133) [-422.728] * (-419.241) (-416.332) (-425.876) [-416.063] -- 0:00:40
      331000 -- (-416.401) (-416.379) (-420.493) [-421.514] * (-416.259) (-418.360) (-425.760) [-416.456] -- 0:00:40
      331500 -- (-417.997) (-417.658) (-417.574) [-416.244] * (-416.381) (-416.025) [-415.460] (-415.360) -- 0:00:40
      332000 -- (-416.601) (-415.845) [-418.539] (-420.098) * (-418.083) [-416.289] (-415.182) (-416.250) -- 0:00:40
      332500 -- [-415.966] (-417.222) (-415.810) (-415.514) * (-415.954) (-420.130) [-416.221] (-418.746) -- 0:00:40
      333000 -- (-417.101) [-418.350] (-419.331) (-415.082) * (-415.320) (-416.760) (-415.979) [-417.863] -- 0:00:40
      333500 -- [-416.619] (-416.338) (-416.798) (-414.759) * (-415.304) (-415.037) [-416.708] (-419.116) -- 0:00:39
      334000 -- (-415.119) [-416.156] (-416.608) (-415.982) * (-416.145) (-420.520) (-418.065) [-416.865] -- 0:00:39
      334500 -- [-414.767] (-416.444) (-415.422) (-420.051) * (-415.676) (-416.882) [-416.786] (-417.300) -- 0:00:39
      335000 -- (-415.814) (-418.869) (-414.896) [-415.944] * (-415.390) (-417.972) (-417.757) [-416.700] -- 0:00:39

      Average standard deviation of split frequencies: 0.010069

      335500 -- (-416.068) (-416.613) [-415.394] (-415.267) * [-419.710] (-417.011) (-416.071) (-419.114) -- 0:00:39
      336000 -- (-417.682) (-415.555) (-417.321) [-414.807] * (-417.897) (-414.682) [-417.536] (-418.199) -- 0:00:39
      336500 -- (-422.732) (-415.408) [-418.504] (-415.330) * [-417.182] (-419.893) (-415.688) (-415.973) -- 0:00:39
      337000 -- (-416.375) [-415.745] (-418.172) (-414.920) * [-415.652] (-415.548) (-416.094) (-417.782) -- 0:00:39
      337500 -- [-416.105] (-417.140) (-416.276) (-415.558) * (-416.815) [-416.593] (-417.512) (-418.074) -- 0:00:39
      338000 -- (-414.788) [-417.656] (-416.074) (-415.836) * (-416.418) (-417.201) [-421.135] (-416.202) -- 0:00:39
      338500 -- (-420.174) (-418.483) [-417.147] (-416.317) * [-415.146] (-416.324) (-419.477) (-416.257) -- 0:00:39
      339000 -- (-416.109) (-417.122) [-416.511] (-417.312) * (-417.021) [-420.582] (-416.638) (-415.061) -- 0:00:38
      339500 -- (-416.030) (-414.997) [-418.067] (-419.174) * (-416.796) (-416.913) [-415.236] (-415.075) -- 0:00:38
      340000 -- [-415.714] (-418.547) (-418.815) (-420.542) * (-416.065) [-414.591] (-415.714) (-416.940) -- 0:00:38

      Average standard deviation of split frequencies: 0.009686

      340500 -- (-415.148) (-419.278) [-415.750] (-415.676) * (-415.834) [-418.572] (-415.310) (-415.989) -- 0:00:40
      341000 -- [-416.814] (-416.569) (-419.455) (-418.368) * (-414.649) [-419.486] (-415.087) (-417.420) -- 0:00:40
      341500 -- [-416.786] (-415.226) (-417.664) (-421.644) * (-414.744) (-416.826) [-418.766] (-417.504) -- 0:00:40
      342000 -- [-419.652] (-418.908) (-415.909) (-417.233) * (-418.357) (-416.497) [-414.805] (-417.216) -- 0:00:40
      342500 -- (-417.792) [-420.468] (-417.741) (-416.309) * (-415.786) (-416.949) [-416.620] (-418.640) -- 0:00:40
      343000 -- [-415.360] (-417.718) (-415.626) (-418.735) * (-416.165) (-414.870) (-418.648) [-417.803] -- 0:00:40
      343500 -- (-416.087) [-418.368] (-416.866) (-418.621) * [-415.977] (-415.192) (-417.713) (-418.899) -- 0:00:40
      344000 -- (-416.394) (-415.393) (-417.352) [-417.903] * (-416.754) (-414.770) (-416.221) [-419.331] -- 0:00:40
      344500 -- [-416.150] (-416.283) (-418.357) (-423.195) * (-416.021) [-415.296] (-416.241) (-416.916) -- 0:00:39
      345000 -- [-417.902] (-416.618) (-421.316) (-418.079) * [-415.274] (-415.392) (-415.946) (-415.540) -- 0:00:39

      Average standard deviation of split frequencies: 0.010499

      345500 -- (-414.797) (-417.624) [-414.989] (-415.892) * [-416.152] (-414.903) (-416.148) (-418.548) -- 0:00:39
      346000 -- (-417.193) (-417.270) (-418.387) [-415.365] * (-417.356) (-419.526) [-417.288] (-416.202) -- 0:00:39
      346500 -- (-416.341) (-417.551) [-417.593] (-419.583) * (-417.365) (-419.147) (-416.488) [-414.644] -- 0:00:39
      347000 -- [-416.152] (-418.109) (-417.846) (-415.933) * (-419.786) [-415.765] (-416.176) (-415.267) -- 0:00:39
      347500 -- [-416.371] (-415.960) (-417.584) (-416.691) * (-417.790) [-417.201] (-419.188) (-416.110) -- 0:00:39
      348000 -- (-416.219) (-419.004) [-422.333] (-416.822) * [-415.660] (-420.046) (-419.073) (-416.706) -- 0:00:39
      348500 -- (-415.677) (-415.934) [-416.757] (-414.733) * [-416.948] (-419.668) (-416.080) (-417.593) -- 0:00:39
      349000 -- (-416.338) (-417.962) [-420.708] (-419.685) * (-422.623) [-415.909] (-421.369) (-417.347) -- 0:00:39
      349500 -- (-414.905) [-416.677] (-421.823) (-417.828) * [-416.286] (-416.106) (-421.653) (-415.078) -- 0:00:39
      350000 -- (-418.044) (-422.065) (-418.815) [-415.062] * (-418.082) (-422.991) (-418.313) [-414.947] -- 0:00:39

      Average standard deviation of split frequencies: 0.009252

      350500 -- [-419.232] (-416.792) (-419.614) (-414.841) * [-415.569] (-419.568) (-420.144) (-416.816) -- 0:00:38
      351000 -- (-418.633) (-417.022) [-417.330] (-415.314) * (-416.264) (-416.766) (-417.040) [-416.282] -- 0:00:38
      351500 -- [-416.204] (-416.481) (-416.990) (-415.879) * [-415.593] (-415.684) (-418.644) (-415.837) -- 0:00:38
      352000 -- (-415.723) (-415.536) [-416.074] (-415.944) * (-416.823) (-416.196) [-419.223] (-415.497) -- 0:00:38
      352500 -- (-418.842) [-415.944] (-419.273) (-416.491) * (-421.699) (-422.565) [-416.792] (-415.372) -- 0:00:38
      353000 -- [-416.160] (-420.249) (-418.681) (-415.062) * (-429.115) (-417.557) [-418.885] (-416.957) -- 0:00:38
      353500 -- (-418.720) (-417.151) (-417.630) [-415.062] * (-417.257) [-416.399] (-418.464) (-416.666) -- 0:00:38
      354000 -- (-418.170) [-418.820] (-416.156) (-414.996) * [-418.225] (-414.833) (-416.309) (-419.935) -- 0:00:38
      354500 -- (-419.158) (-417.150) [-420.483] (-417.412) * (-416.414) (-416.874) (-417.317) [-418.008] -- 0:00:38
      355000 -- (-417.699) [-416.088] (-419.995) (-415.708) * (-418.817) (-417.183) (-418.010) [-416.754] -- 0:00:38

      Average standard deviation of split frequencies: 0.009191

      355500 -- (-415.582) (-419.069) (-420.374) [-417.287] * (-419.655) [-419.834] (-417.110) (-417.115) -- 0:00:38
      356000 -- (-418.226) (-417.723) (-419.035) [-417.440] * (-417.300) (-417.268) [-417.034] (-419.513) -- 0:00:37
      356500 -- (-418.310) (-417.251) [-415.105] (-416.739) * (-422.471) [-418.927] (-417.056) (-419.417) -- 0:00:37
      357000 -- (-415.777) (-418.284) (-414.890) [-418.118] * (-416.053) (-418.345) (-417.251) [-415.407] -- 0:00:37
      357500 -- [-415.713] (-417.883) (-417.162) (-417.816) * (-415.843) [-418.107] (-417.266) (-419.066) -- 0:00:39
      358000 -- (-415.576) (-416.034) (-415.948) [-419.308] * (-415.003) (-416.950) [-415.348] (-420.439) -- 0:00:39
      358500 -- (-424.023) (-416.363) (-415.953) [-416.992] * (-419.327) (-416.539) [-414.590] (-418.926) -- 0:00:39
      359000 -- (-416.274) [-416.240] (-417.381) (-418.892) * [-418.110] (-420.117) (-419.011) (-414.814) -- 0:00:39
      359500 -- [-416.236] (-416.069) (-415.068) (-415.762) * (-418.088) [-420.520] (-419.794) (-415.912) -- 0:00:39
      360000 -- [-415.459] (-415.879) (-415.559) (-417.766) * (-416.070) [-416.486] (-416.343) (-417.262) -- 0:00:39

      Average standard deviation of split frequencies: 0.009457

      360500 -- [-416.567] (-421.045) (-415.657) (-423.389) * (-414.911) [-416.142] (-417.052) (-416.959) -- 0:00:39
      361000 -- (-422.178) (-417.844) [-417.205] (-427.659) * (-419.303) (-415.283) [-415.495] (-419.038) -- 0:00:38
      361500 -- (-422.960) (-418.194) [-417.013] (-416.572) * (-421.497) (-416.574) (-418.700) [-416.296] -- 0:00:38
      362000 -- (-419.060) (-415.678) (-417.945) [-419.348] * [-417.069] (-418.150) (-414.983) (-417.614) -- 0:00:38
      362500 -- (-415.687) (-417.452) (-418.960) [-416.783] * (-415.556) [-415.303] (-415.427) (-416.389) -- 0:00:38
      363000 -- (-415.303) (-416.280) (-418.907) [-417.534] * (-417.509) (-414.954) (-416.618) [-419.635] -- 0:00:38
      363500 -- (-421.644) [-418.494] (-418.563) (-416.301) * (-423.352) (-416.640) (-415.851) [-414.446] -- 0:00:38
      364000 -- (-419.370) (-417.021) [-415.643] (-416.052) * (-419.579) (-417.823) [-416.129] (-417.635) -- 0:00:38
      364500 -- (-420.151) (-419.258) [-415.113] (-416.691) * (-417.148) (-419.677) [-415.358] (-418.607) -- 0:00:38
      365000 -- (-414.781) [-415.236] (-418.828) (-419.057) * [-418.654] (-421.850) (-426.679) (-416.630) -- 0:00:38

      Average standard deviation of split frequencies: 0.009622

      365500 -- (-417.502) (-416.671) [-417.083] (-416.577) * (-415.333) [-417.038] (-417.563) (-416.315) -- 0:00:38
      366000 -- (-417.049) [-417.391] (-418.417) (-417.172) * (-417.014) (-418.473) (-416.269) [-415.994] -- 0:00:38
      366500 -- (-415.422) [-415.644] (-415.031) (-415.176) * [-414.490] (-422.104) (-417.591) (-416.935) -- 0:00:38
      367000 -- (-418.912) (-417.917) (-415.678) [-416.157] * (-415.983) (-415.327) (-416.845) [-417.911] -- 0:00:37
      367500 -- [-418.017] (-418.387) (-416.284) (-416.982) * (-421.131) (-419.096) [-415.490] (-415.453) -- 0:00:37
      368000 -- (-419.063) (-420.985) (-415.063) [-420.433] * (-417.130) (-415.247) [-417.965] (-418.734) -- 0:00:37
      368500 -- (-419.370) (-421.951) (-417.053) [-416.802] * (-418.555) (-415.963) (-416.770) [-414.953] -- 0:00:37
      369000 -- [-417.768] (-418.430) (-416.780) (-418.105) * (-418.105) (-415.849) [-417.621] (-417.833) -- 0:00:37
      369500 -- (-416.193) [-415.728] (-416.575) (-416.548) * (-416.033) (-416.410) [-417.526] (-418.058) -- 0:00:37
      370000 -- (-416.784) [-419.680] (-417.247) (-418.289) * (-415.586) (-415.716) [-415.886] (-417.306) -- 0:00:37

      Average standard deviation of split frequencies: 0.009202

      370500 -- (-416.838) [-416.130] (-417.803) (-416.955) * (-415.541) (-419.073) (-415.703) [-418.759] -- 0:00:37
      371000 -- [-420.116] (-416.240) (-419.714) (-416.936) * (-416.713) (-415.653) (-419.337) [-417.233] -- 0:00:37
      371500 -- (-415.695) [-417.044] (-418.229) (-415.965) * (-416.338) [-415.669] (-420.019) (-417.595) -- 0:00:37
      372000 -- [-415.139] (-415.372) (-416.813) (-416.385) * [-416.496] (-418.755) (-416.304) (-416.972) -- 0:00:37
      372500 -- (-418.279) (-415.895) [-419.297] (-416.826) * (-419.060) [-415.404] (-415.816) (-416.881) -- 0:00:37
      373000 -- [-418.697] (-418.326) (-417.099) (-415.114) * (-416.746) [-417.203] (-414.925) (-417.181) -- 0:00:36
      373500 -- (-417.959) (-415.447) [-416.451] (-416.502) * (-414.844) [-415.394] (-417.374) (-416.661) -- 0:00:36
      374000 -- (-416.961) (-420.005) [-415.230] (-416.003) * (-415.475) (-416.035) [-416.273] (-417.854) -- 0:00:36
      374500 -- [-417.409] (-415.745) (-416.115) (-416.447) * (-418.593) (-415.462) (-417.438) [-417.466] -- 0:00:38
      375000 -- (-420.700) (-417.671) (-415.373) [-416.204] * (-419.281) [-417.337] (-415.477) (-416.996) -- 0:00:38

      Average standard deviation of split frequencies: 0.009587

      375500 -- (-419.654) (-419.738) [-416.950] (-420.632) * (-416.895) (-416.654) [-414.839] (-418.417) -- 0:00:38
      376000 -- (-417.816) (-416.275) (-417.578) [-418.944] * (-417.287) [-416.162] (-416.670) (-419.985) -- 0:00:38
      376500 -- (-418.729) (-417.498) [-416.362] (-415.143) * (-414.909) (-416.150) (-421.354) [-420.101] -- 0:00:38
      377000 -- (-420.236) [-416.926] (-415.928) (-414.785) * (-420.609) [-415.852] (-422.954) (-416.356) -- 0:00:38
      377500 -- (-418.773) [-420.501] (-417.817) (-418.704) * (-418.983) [-418.565] (-419.040) (-415.653) -- 0:00:37
      378000 -- (-416.812) (-417.520) (-418.930) [-422.411] * (-415.496) (-416.186) [-418.055] (-416.301) -- 0:00:37
      378500 -- (-418.323) (-420.950) [-417.565] (-416.024) * (-415.192) [-417.305] (-414.443) (-416.547) -- 0:00:37
      379000 -- (-418.938) [-418.242] (-416.892) (-418.059) * [-416.218] (-417.413) (-420.041) (-416.674) -- 0:00:37
      379500 -- (-416.255) (-415.950) [-415.821] (-416.689) * (-417.845) [-416.186] (-417.044) (-418.884) -- 0:00:37
      380000 -- (-417.844) (-417.680) (-417.818) [-415.455] * (-414.924) [-416.522] (-415.888) (-418.752) -- 0:00:37

      Average standard deviation of split frequencies: 0.010708

      380500 -- (-415.833) (-415.369) [-415.825] (-416.666) * (-418.642) (-416.486) (-421.748) [-417.498] -- 0:00:37
      381000 -- (-417.606) (-415.111) [-415.796] (-416.310) * (-415.352) [-418.233] (-416.298) (-415.439) -- 0:00:37
      381500 -- (-415.364) [-414.576] (-415.064) (-416.118) * (-414.602) (-416.715) [-415.657] (-415.868) -- 0:00:37
      382000 -- (-415.326) [-416.810] (-414.598) (-417.496) * (-416.782) [-415.333] (-416.151) (-419.130) -- 0:00:37
      382500 -- [-418.519] (-417.550) (-416.987) (-418.329) * (-417.159) (-416.629) [-415.939] (-415.443) -- 0:00:37
      383000 -- (-415.434) [-418.721] (-417.786) (-419.660) * (-419.498) (-420.068) [-415.088] (-414.967) -- 0:00:37
      383500 -- (-421.020) (-415.774) [-417.440] (-415.811) * [-417.230] (-420.122) (-417.067) (-417.908) -- 0:00:36
      384000 -- (-417.623) [-418.276] (-418.422) (-415.257) * (-416.566) [-417.630] (-416.610) (-417.123) -- 0:00:36
      384500 -- (-416.168) [-416.264] (-417.665) (-416.290) * [-416.537] (-415.490) (-420.580) (-416.717) -- 0:00:36
      385000 -- (-416.042) (-416.255) [-416.550] (-417.445) * (-422.073) [-416.763] (-416.973) (-420.802) -- 0:00:36

      Average standard deviation of split frequencies: 0.010856

      385500 -- (-416.125) (-418.172) (-415.250) [-415.205] * [-420.844] (-416.681) (-417.512) (-418.593) -- 0:00:36
      386000 -- [-420.896] (-418.302) (-415.712) (-418.540) * (-417.819) [-418.686] (-415.486) (-416.230) -- 0:00:36
      386500 -- (-421.040) (-416.637) (-417.780) [-419.391] * (-418.541) (-416.056) [-417.518] (-415.318) -- 0:00:36
      387000 -- [-418.659] (-418.683) (-415.835) (-420.051) * [-415.861] (-415.743) (-415.597) (-414.897) -- 0:00:36
      387500 -- (-421.620) (-418.579) (-419.714) [-417.028] * [-415.963] (-419.592) (-414.986) (-417.174) -- 0:00:36
      388000 -- [-417.330] (-415.923) (-415.621) (-418.250) * [-415.542] (-420.168) (-415.229) (-418.237) -- 0:00:36
      388500 -- (-417.717) (-416.712) (-414.987) [-417.892] * [-416.415] (-415.648) (-415.849) (-424.594) -- 0:00:36
      389000 -- (-414.613) [-417.946] (-418.607) (-419.754) * [-416.942] (-415.439) (-418.328) (-416.091) -- 0:00:36
      389500 -- (-416.391) (-417.670) (-423.043) [-418.253] * (-416.038) [-414.717] (-418.557) (-417.874) -- 0:00:36
      390000 -- (-417.789) (-420.221) [-417.911] (-416.178) * (-414.814) [-415.813] (-418.049) (-416.239) -- 0:00:35

      Average standard deviation of split frequencies: 0.011495

      390500 -- (-418.668) [-418.970] (-415.671) (-417.870) * [-415.947] (-416.349) (-415.721) (-417.045) -- 0:00:35
      391000 -- (-420.175) [-415.580] (-419.592) (-415.137) * (-416.132) (-414.900) [-416.390] (-416.062) -- 0:00:35
      391500 -- [-417.167] (-416.385) (-415.547) (-417.421) * [-414.770] (-418.617) (-418.112) (-416.311) -- 0:00:37
      392000 -- (-416.039) [-421.062] (-416.316) (-415.051) * [-417.475] (-419.695) (-417.129) (-415.621) -- 0:00:37
      392500 -- (-416.435) (-418.647) (-417.220) [-419.666] * [-415.070] (-420.537) (-417.218) (-418.988) -- 0:00:37
      393000 -- (-417.636) (-416.223) [-417.327] (-416.722) * [-418.464] (-415.887) (-416.882) (-416.334) -- 0:00:37
      393500 -- (-421.524) (-416.898) (-417.625) [-417.391] * (-416.515) (-414.887) (-414.997) [-415.937] -- 0:00:36
      394000 -- (-418.641) (-418.499) (-420.725) [-420.285] * [-417.134] (-416.610) (-416.223) (-417.672) -- 0:00:36
      394500 -- (-415.999) (-415.860) (-415.827) [-421.842] * (-415.861) (-416.123) (-416.533) [-418.133] -- 0:00:36
      395000 -- (-415.937) [-415.013] (-416.118) (-414.909) * (-417.557) (-417.635) (-419.216) [-414.751] -- 0:00:36

      Average standard deviation of split frequencies: 0.010776

      395500 -- (-416.269) (-415.633) [-415.827] (-419.736) * (-415.750) (-418.358) [-419.439] (-415.401) -- 0:00:36
      396000 -- [-416.883] (-415.347) (-415.067) (-416.777) * (-415.851) [-415.797] (-415.481) (-420.054) -- 0:00:36
      396500 -- (-420.842) (-416.276) [-414.923] (-418.780) * (-415.946) [-415.544] (-414.476) (-422.417) -- 0:00:36
      397000 -- (-416.048) (-417.337) [-416.166] (-419.148) * (-417.360) (-417.645) (-416.712) [-416.399] -- 0:00:36
      397500 -- [-417.999] (-417.963) (-417.171) (-415.002) * (-417.594) (-416.036) (-417.217) [-416.096] -- 0:00:36
      398000 -- (-418.275) (-418.872) [-421.112] (-415.085) * (-420.119) (-417.403) (-416.232) [-416.281] -- 0:00:36
      398500 -- (-416.616) (-417.211) (-419.438) [-416.892] * [-417.062] (-415.311) (-415.911) (-420.329) -- 0:00:36
      399000 -- (-417.683) (-417.709) [-416.802] (-415.442) * (-423.747) [-418.043] (-415.931) (-414.595) -- 0:00:36
      399500 -- (-415.550) (-421.807) [-417.481] (-417.576) * (-416.603) [-418.328] (-420.535) (-416.774) -- 0:00:36
      400000 -- (-416.322) (-417.941) [-416.652] (-418.053) * (-418.572) (-417.732) [-418.299] (-415.118) -- 0:00:36

      Average standard deviation of split frequencies: 0.011635

      400500 -- [-416.458] (-416.480) (-417.410) (-418.022) * (-414.975) (-416.210) [-419.303] (-416.616) -- 0:00:35
      401000 -- (-415.736) (-421.940) [-415.473] (-414.485) * [-415.591] (-418.429) (-419.071) (-417.805) -- 0:00:35
      401500 -- (-415.801) [-415.974] (-417.012) (-414.937) * (-416.427) [-419.781] (-414.710) (-415.073) -- 0:00:35
      402000 -- (-415.324) (-419.033) (-416.354) [-416.692] * [-415.978] (-415.915) (-417.262) (-418.771) -- 0:00:35
      402500 -- (-418.130) (-415.749) [-417.213] (-417.953) * (-415.889) [-415.882] (-416.846) (-415.801) -- 0:00:35
      403000 -- [-416.315] (-421.912) (-417.447) (-419.802) * (-414.839) (-416.743) [-418.632] (-417.867) -- 0:00:35
      403500 -- [-416.258] (-416.907) (-416.638) (-419.933) * (-418.312) (-416.942) [-415.512] (-415.960) -- 0:00:35
      404000 -- (-415.291) (-415.666) (-418.499) [-420.700] * (-415.624) [-417.402] (-417.053) (-415.567) -- 0:00:35
      404500 -- [-416.116] (-419.066) (-418.053) (-418.128) * (-415.868) (-416.852) (-416.367) [-420.520] -- 0:00:35
      405000 -- (-416.046) (-415.255) [-419.387] (-419.425) * (-416.584) (-417.402) (-415.359) [-416.705] -- 0:00:35

      Average standard deviation of split frequencies: 0.011611

      405500 -- (-416.090) (-415.510) (-417.445) [-416.266] * (-418.402) [-416.392] (-418.674) (-415.926) -- 0:00:35
      406000 -- (-416.637) [-416.342] (-416.229) (-416.024) * [-416.120] (-418.201) (-417.385) (-415.960) -- 0:00:35
      406500 -- (-418.110) [-417.373] (-417.873) (-417.046) * (-415.362) (-415.913) (-417.845) [-416.327] -- 0:00:35
      407000 -- (-420.387) [-416.252] (-416.791) (-414.815) * (-416.490) (-415.637) (-416.489) [-415.771] -- 0:00:34
      407500 -- [-414.976] (-415.976) (-418.497) (-417.193) * (-415.412) (-418.404) [-416.671] (-419.765) -- 0:00:34
      408000 -- [-416.255] (-425.196) (-419.189) (-420.277) * (-416.877) (-416.340) [-416.051] (-422.886) -- 0:00:36
      408500 -- [-419.458] (-417.251) (-418.001) (-419.609) * [-421.422] (-418.694) (-417.775) (-419.099) -- 0:00:36
      409000 -- [-418.297] (-419.154) (-415.246) (-416.317) * (-422.648) [-417.276] (-420.858) (-420.947) -- 0:00:36
      409500 -- [-415.209] (-423.015) (-415.133) (-418.684) * (-416.811) (-417.746) [-418.190] (-416.281) -- 0:00:36
      410000 -- (-416.052) (-416.387) (-417.955) [-417.605] * (-417.922) (-417.329) [-417.706] (-417.734) -- 0:00:35

      Average standard deviation of split frequencies: 0.010522

      410500 -- (-417.824) (-417.673) [-416.645] (-417.625) * [-416.097] (-417.119) (-417.755) (-415.950) -- 0:00:35
      411000 -- [-419.605] (-417.855) (-415.913) (-422.826) * (-420.177) [-416.185] (-414.996) (-416.525) -- 0:00:35
      411500 -- [-417.325] (-416.469) (-415.901) (-416.617) * (-418.043) [-417.607] (-416.587) (-417.855) -- 0:00:35
      412000 -- (-416.245) [-416.606] (-417.885) (-416.323) * [-417.318] (-417.924) (-414.800) (-416.591) -- 0:00:35
      412500 -- (-415.945) (-415.568) (-416.039) [-416.749] * (-416.469) (-415.340) (-414.663) [-415.113] -- 0:00:35
      413000 -- (-415.403) (-416.148) (-415.154) [-415.862] * (-417.457) (-416.913) [-414.614] (-416.312) -- 0:00:35
      413500 -- (-416.092) [-417.330] (-416.546) (-415.290) * (-418.839) (-415.884) (-415.863) [-414.595] -- 0:00:35
      414000 -- (-415.898) (-416.178) (-416.822) [-415.556] * (-416.518) [-419.106] (-415.465) (-417.002) -- 0:00:35
      414500 -- [-416.782] (-417.143) (-418.720) (-416.098) * [-417.762] (-416.590) (-417.822) (-417.144) -- 0:00:35
      415000 -- (-416.954) (-415.714) (-423.296) [-417.919] * (-417.322) (-417.202) (-418.387) [-418.030] -- 0:00:35

      Average standard deviation of split frequencies: 0.010828

      415500 -- [-417.533] (-415.720) (-419.798) (-417.974) * [-417.667] (-415.711) (-419.399) (-416.811) -- 0:00:35
      416000 -- (-415.421) (-427.767) (-418.491) [-416.725] * [-415.618] (-416.954) (-419.300) (-416.985) -- 0:00:35
      416500 -- [-417.154] (-418.585) (-414.704) (-418.988) * [-418.099] (-417.321) (-419.765) (-418.170) -- 0:00:35
      417000 -- (-416.092) [-415.873] (-416.158) (-417.907) * (-414.629) (-417.818) (-420.229) [-417.388] -- 0:00:34
      417500 -- (-415.344) (-418.335) (-421.244) [-415.867] * [-415.486] (-421.436) (-415.426) (-420.482) -- 0:00:34
      418000 -- (-416.905) (-415.362) (-418.744) [-415.353] * (-415.289) (-417.368) [-416.354] (-415.508) -- 0:00:34
      418500 -- (-416.198) (-416.266) (-415.836) [-415.026] * (-414.981) (-414.684) [-415.887] (-415.821) -- 0:00:34
      419000 -- (-422.113) (-416.545) [-415.712] (-416.367) * (-417.233) (-414.769) [-415.763] (-416.265) -- 0:00:34
      419500 -- (-415.568) (-416.098) [-416.511] (-416.030) * (-415.286) (-419.687) (-416.015) [-416.133] -- 0:00:34
      420000 -- (-415.004) [-415.707] (-416.983) (-417.234) * [-416.370] (-417.366) (-416.848) (-416.466) -- 0:00:34

      Average standard deviation of split frequencies: 0.010708

      420500 -- (-417.272) (-418.821) (-415.150) [-416.098] * (-416.914) (-417.899) [-416.403] (-422.093) -- 0:00:34
      421000 -- (-417.064) (-416.334) (-417.755) [-415.946] * (-422.683) [-420.606] (-416.380) (-420.401) -- 0:00:34
      421500 -- (-416.933) (-418.268) (-417.126) [-416.591] * (-420.278) (-415.399) [-417.027] (-417.583) -- 0:00:34
      422000 -- (-417.552) (-421.069) [-415.651] (-416.370) * (-416.970) (-418.088) [-415.086] (-418.633) -- 0:00:34
      422500 -- (-416.344) (-415.205) (-415.556) [-416.996] * [-419.851] (-416.126) (-416.766) (-416.250) -- 0:00:34
      423000 -- [-415.718] (-414.895) (-417.601) (-415.846) * (-417.544) (-417.390) [-415.229] (-415.026) -- 0:00:34
      423500 -- (-415.768) (-417.839) [-418.017] (-416.195) * [-417.875] (-414.639) (-414.790) (-419.801) -- 0:00:35
      424000 -- (-415.279) [-415.440] (-416.014) (-414.826) * (-416.381) (-415.414) (-416.414) [-415.690] -- 0:00:35
      424500 -- [-418.197] (-416.986) (-415.539) (-416.937) * (-416.473) (-415.062) [-418.179] (-419.016) -- 0:00:35
      425000 -- (-419.886) (-422.990) (-417.543) [-416.535] * [-415.887] (-418.150) (-417.366) (-422.075) -- 0:00:35

      Average standard deviation of split frequencies: 0.011299

      425500 -- (-423.138) [-418.312] (-417.596) (-417.741) * (-416.317) (-416.650) (-415.122) [-419.456] -- 0:00:35
      426000 -- [-416.865] (-418.048) (-417.752) (-416.504) * (-418.007) [-415.176] (-414.849) (-415.807) -- 0:00:35
      426500 -- [-417.981] (-418.886) (-418.976) (-414.589) * (-417.780) (-417.149) [-415.009] (-416.862) -- 0:00:34
      427000 -- (-414.847) [-416.084] (-418.286) (-416.824) * (-416.890) (-416.561) [-415.784] (-417.520) -- 0:00:34
      427500 -- (-416.305) (-417.699) [-415.611] (-415.592) * (-417.201) (-416.471) [-416.921] (-414.901) -- 0:00:34
      428000 -- [-415.231] (-419.294) (-418.658) (-416.738) * (-416.828) (-420.863) (-416.187) [-416.761] -- 0:00:34
      428500 -- (-417.587) [-417.683] (-414.572) (-416.960) * (-415.107) (-420.356) (-417.098) [-417.332] -- 0:00:34
      429000 -- (-415.711) (-416.679) [-417.242] (-416.482) * (-416.967) (-420.094) (-415.814) [-418.110] -- 0:00:34
      429500 -- [-415.878] (-418.797) (-419.015) (-417.375) * (-416.487) (-420.409) [-415.135] (-418.564) -- 0:00:34
      430000 -- (-418.615) (-415.906) (-418.079) [-414.953] * (-416.835) (-418.579) (-417.216) [-418.314] -- 0:00:34

      Average standard deviation of split frequencies: 0.011189

      430500 -- [-414.891] (-416.379) (-415.079) (-417.764) * (-415.962) (-421.409) (-416.660) [-417.089] -- 0:00:34
      431000 -- (-422.178) (-415.733) (-416.274) [-415.179] * (-419.501) (-420.196) (-416.279) [-415.839] -- 0:00:34
      431500 -- [-417.163] (-416.173) (-415.046) (-415.344) * [-416.736] (-419.013) (-417.100) (-414.830) -- 0:00:34
      432000 -- (-416.217) [-414.758] (-421.014) (-415.026) * (-416.789) [-421.241] (-416.704) (-418.446) -- 0:00:34
      432500 -- (-419.258) (-414.396) [-417.375] (-414.750) * [-416.759] (-417.065) (-418.978) (-418.903) -- 0:00:34
      433000 -- (-418.521) (-414.833) (-418.439) [-417.713] * (-415.338) [-421.306] (-417.533) (-416.143) -- 0:00:34
      433500 -- (-416.291) [-414.887] (-415.590) (-414.786) * (-415.661) [-417.826] (-420.189) (-418.880) -- 0:00:33
      434000 -- (-416.031) (-414.766) (-417.565) [-416.897] * (-414.864) [-416.956] (-417.941) (-414.986) -- 0:00:33
      434500 -- (-416.441) (-419.384) (-419.496) [-417.193] * [-415.717] (-415.815) (-419.742) (-419.736) -- 0:00:33
      435000 -- [-419.436] (-415.886) (-415.786) (-417.260) * (-415.000) (-415.627) (-416.048) [-417.319] -- 0:00:33

      Average standard deviation of split frequencies: 0.010452

      435500 -- (-417.512) (-416.002) (-415.041) [-415.221] * [-416.477] (-424.467) (-416.001) (-418.182) -- 0:00:33
      436000 -- (-418.419) [-415.853] (-418.830) (-415.569) * (-416.126) (-415.853) (-419.085) [-416.932] -- 0:00:33
      436500 -- [-415.840] (-416.069) (-418.539) (-415.088) * (-422.096) (-416.835) (-419.662) [-415.417] -- 0:00:33
      437000 -- (-419.828) (-415.586) [-423.037] (-414.950) * [-424.454] (-417.712) (-420.812) (-417.959) -- 0:00:33
      437500 -- (-415.876) [-418.958] (-415.229) (-416.598) * [-416.586] (-419.134) (-415.561) (-416.161) -- 0:00:33
      438000 -- [-416.044] (-416.231) (-415.369) (-417.487) * (-416.125) (-415.394) (-417.164) [-416.050] -- 0:00:33
      438500 -- (-414.925) [-415.743] (-415.736) (-418.303) * [-416.035] (-415.796) (-418.637) (-417.512) -- 0:00:34
      439000 -- [-417.729] (-415.673) (-416.997) (-416.736) * (-419.642) [-418.735] (-415.669) (-418.017) -- 0:00:34
      439500 -- (-417.407) [-416.573] (-416.602) (-418.567) * (-417.776) (-419.401) (-415.553) [-420.358] -- 0:00:34
      440000 -- (-416.945) [-417.149] (-415.945) (-419.072) * (-421.453) (-416.370) [-415.287] (-416.759) -- 0:00:34

      Average standard deviation of split frequencies: 0.011138

      440500 -- (-416.280) (-414.802) (-418.138) [-416.194] * (-416.725) (-415.085) [-417.882] (-417.609) -- 0:00:34
      441000 -- [-415.567] (-415.324) (-416.319) (-417.060) * (-416.002) (-415.566) [-417.536] (-417.585) -- 0:00:34
      441500 -- (-414.626) [-415.070] (-418.676) (-415.864) * [-418.467] (-418.838) (-418.029) (-418.214) -- 0:00:34
      442000 -- (-415.379) (-416.799) (-416.497) [-415.476] * [-416.008] (-419.926) (-416.649) (-416.117) -- 0:00:34
      442500 -- (-420.912) (-416.031) (-415.977) [-417.486] * (-419.156) [-416.086] (-415.690) (-418.991) -- 0:00:34
      443000 -- (-418.448) [-416.727] (-417.679) (-416.296) * [-417.137] (-415.540) (-415.189) (-415.792) -- 0:00:33
      443500 -- (-415.639) (-417.355) [-420.020] (-415.471) * (-415.188) (-418.043) (-416.134) [-416.628] -- 0:00:33
      444000 -- (-416.123) [-415.771] (-418.130) (-414.839) * [-414.514] (-419.530) (-415.602) (-416.097) -- 0:00:33
      444500 -- (-417.762) (-416.089) (-416.831) [-416.124] * [-416.411] (-414.559) (-414.647) (-415.928) -- 0:00:33
      445000 -- (-418.701) [-416.849] (-415.228) (-420.142) * (-418.839) (-416.694) (-414.420) [-418.697] -- 0:00:33

      Average standard deviation of split frequencies: 0.010687

      445500 -- (-417.430) [-415.816] (-417.559) (-416.622) * (-416.265) (-420.635) (-415.123) [-419.056] -- 0:00:33
      446000 -- [-416.644] (-417.464) (-419.490) (-417.798) * [-414.895] (-417.970) (-416.017) (-418.544) -- 0:00:33
      446500 -- (-416.531) (-417.205) [-418.857] (-416.036) * (-417.325) [-416.896] (-416.271) (-417.958) -- 0:00:33
      447000 -- (-414.431) [-415.796] (-419.829) (-416.809) * (-415.997) (-417.415) [-415.595] (-419.598) -- 0:00:33
      447500 -- (-421.385) (-417.011) [-416.663] (-416.556) * (-416.519) [-415.722] (-415.494) (-416.025) -- 0:00:33
      448000 -- (-415.823) [-417.608] (-414.786) (-417.786) * (-418.953) [-415.483] (-418.978) (-416.813) -- 0:00:33
      448500 -- (-416.318) (-416.639) (-414.754) [-415.247] * (-415.711) (-415.147) [-422.364] (-416.237) -- 0:00:33
      449000 -- (-416.662) (-420.136) (-417.028) [-415.533] * [-415.128] (-417.421) (-417.236) (-417.071) -- 0:00:33
      449500 -- [-416.750] (-417.338) (-418.012) (-418.977) * (-420.124) (-419.387) [-415.392] (-419.752) -- 0:00:33
      450000 -- (-417.476) (-417.544) (-414.634) [-415.446] * [-417.571] (-419.841) (-416.648) (-420.114) -- 0:00:33

      Average standard deviation of split frequencies: 0.010402

      450500 -- (-414.487) (-416.356) (-419.286) [-415.291] * (-414.894) (-416.475) (-416.615) [-416.664] -- 0:00:32
      451000 -- [-415.073] (-417.423) (-416.589) (-419.218) * (-417.155) (-418.411) [-416.865] (-418.933) -- 0:00:32
      451500 -- [-416.253] (-416.428) (-419.895) (-418.029) * (-418.511) [-415.788] (-420.835) (-418.950) -- 0:00:32
      452000 -- (-418.584) [-415.968] (-418.454) (-416.387) * (-418.419) (-415.470) (-418.809) [-419.435] -- 0:00:32
      452500 -- (-415.026) (-420.363) [-416.565] (-416.520) * (-419.202) (-418.467) (-418.918) [-417.347] -- 0:00:32
      453000 -- (-415.159) [-419.041] (-418.128) (-423.278) * [-415.078] (-420.420) (-420.564) (-416.370) -- 0:00:32
      453500 -- (-417.783) (-417.886) [-416.673] (-416.138) * (-415.353) [-415.166] (-415.474) (-420.903) -- 0:00:33
      454000 -- (-417.167) [-415.096] (-418.336) (-414.993) * (-419.438) (-422.708) [-417.802] (-415.686) -- 0:00:33
      454500 -- [-418.872] (-414.883) (-415.638) (-414.525) * (-417.715) (-417.318) [-418.131] (-421.567) -- 0:00:33
      455000 -- [-417.239] (-417.542) (-419.559) (-416.352) * (-417.050) [-416.506] (-417.399) (-425.485) -- 0:00:33

      Average standard deviation of split frequencies: 0.010338

      455500 -- (-417.244) [-417.016] (-417.970) (-415.842) * [-415.671] (-416.289) (-418.774) (-418.085) -- 0:00:33
      456000 -- [-415.820] (-414.952) (-417.583) (-417.527) * [-415.510] (-416.222) (-421.583) (-416.159) -- 0:00:33
      456500 -- (-418.716) (-415.684) [-415.871] (-415.718) * (-416.170) (-415.520) [-418.076] (-418.282) -- 0:00:33
      457000 -- (-417.880) (-418.527) [-415.340] (-416.735) * (-417.171) (-422.109) (-414.625) [-419.385] -- 0:00:33
      457500 -- (-416.363) (-415.587) [-416.982] (-417.080) * (-419.058) [-415.658] (-414.632) (-416.745) -- 0:00:33
      458000 -- (-416.394) (-415.333) (-417.966) [-415.619] * (-419.102) (-418.609) [-420.808] (-422.184) -- 0:00:33
      458500 -- (-414.750) [-416.803] (-419.556) (-416.062) * (-415.361) (-415.558) (-415.907) [-416.204] -- 0:00:33
      459000 -- (-416.351) [-417.487] (-419.447) (-419.722) * (-417.071) (-417.903) [-418.339] (-415.526) -- 0:00:33
      459500 -- (-423.583) (-418.025) (-416.090) [-420.953] * (-415.242) (-415.931) (-420.572) [-418.834] -- 0:00:32
      460000 -- (-415.062) (-417.256) (-416.164) [-419.352] * (-415.588) [-415.718] (-415.968) (-415.421) -- 0:00:32

      Average standard deviation of split frequencies: 0.010006

      460500 -- [-416.361] (-416.157) (-416.897) (-418.312) * (-418.155) (-416.349) [-415.103] (-415.660) -- 0:00:32
      461000 -- (-415.795) [-414.857] (-418.189) (-422.871) * (-415.620) [-415.025] (-415.360) (-417.318) -- 0:00:32
      461500 -- (-418.715) (-414.578) (-418.122) [-417.620] * [-416.867] (-418.589) (-415.601) (-417.646) -- 0:00:32
      462000 -- (-416.385) [-417.784] (-420.615) (-415.611) * [-416.284] (-416.465) (-415.647) (-424.357) -- 0:00:32
      462500 -- (-415.553) (-414.761) [-417.407] (-417.589) * [-416.264] (-415.015) (-418.407) (-423.417) -- 0:00:32
      463000 -- [-415.358] (-416.735) (-416.557) (-416.140) * [-416.542] (-417.348) (-415.875) (-418.269) -- 0:00:32
      463500 -- (-417.810) (-415.131) [-416.897] (-415.852) * (-416.247) (-415.553) [-415.957] (-417.382) -- 0:00:32
      464000 -- (-418.397) (-416.258) (-416.906) [-416.910] * [-416.476] (-419.200) (-419.037) (-415.566) -- 0:00:32
      464500 -- (-417.531) (-419.091) (-417.459) [-418.810] * (-425.464) (-418.836) [-416.725] (-415.407) -- 0:00:32
      465000 -- (-417.644) (-416.889) (-416.657) [-416.964] * (-415.020) (-418.683) (-418.355) [-414.633] -- 0:00:32

      Average standard deviation of split frequencies: 0.009947

      465500 -- (-416.416) [-418.409] (-418.153) (-419.494) * (-417.041) (-416.956) (-419.174) [-414.616] -- 0:00:32
      466000 -- (-418.361) [-416.853] (-418.686) (-418.161) * [-418.007] (-418.004) (-416.592) (-418.710) -- 0:00:32
      466500 -- [-416.502] (-415.415) (-414.932) (-417.289) * (-416.182) [-415.639] (-417.176) (-418.475) -- 0:00:32
      467000 -- (-416.007) (-418.229) (-418.773) [-414.961] * (-415.773) (-418.768) (-418.060) [-416.173] -- 0:00:31
      467500 -- (-417.539) (-419.186) (-419.646) [-416.869] * (-422.187) (-418.097) (-418.570) [-416.122] -- 0:00:31
      468000 -- (-414.567) (-416.548) (-416.673) [-419.827] * (-418.999) (-416.981) [-418.622] (-418.617) -- 0:00:31
      468500 -- [-415.668] (-421.805) (-416.144) (-419.921) * (-419.786) (-416.649) [-417.235] (-415.280) -- 0:00:31
      469000 -- (-418.252) (-417.647) (-416.100) [-418.717] * (-422.620) (-416.511) [-414.838] (-417.654) -- 0:00:32
      469500 -- (-419.934) [-418.423] (-416.370) (-415.365) * (-417.596) [-417.881] (-416.525) (-415.792) -- 0:00:32
      470000 -- (-416.227) (-414.996) [-416.220] (-418.220) * (-418.898) (-417.135) (-416.543) [-417.613] -- 0:00:32

      Average standard deviation of split frequencies: 0.008792

      470500 -- (-420.858) (-419.925) (-419.658) [-416.804] * (-418.351) (-419.467) (-417.993) [-417.002] -- 0:00:32
      471000 -- (-417.439) (-415.913) [-417.965] (-416.230) * (-416.759) (-419.570) (-418.985) [-414.918] -- 0:00:32
      471500 -- (-417.605) (-415.235) (-418.540) [-415.787] * (-418.351) (-419.262) (-416.053) [-418.217] -- 0:00:32
      472000 -- (-422.599) [-415.726] (-417.676) (-415.279) * (-416.545) (-418.064) (-419.172) [-416.545] -- 0:00:32
      472500 -- (-415.918) (-417.389) (-416.999) [-415.564] * (-416.248) [-415.872] (-424.353) (-414.929) -- 0:00:32
      473000 -- (-417.091) (-416.765) (-415.363) [-416.614] * (-421.374) (-416.302) (-420.857) [-416.036] -- 0:00:32
      473500 -- (-414.571) (-416.636) (-417.722) [-418.201] * (-422.571) (-417.640) [-417.752] (-416.852) -- 0:00:32
      474000 -- [-415.616] (-417.038) (-416.018) (-415.408) * (-416.071) (-415.938) (-417.267) [-415.528] -- 0:00:32
      474500 -- (-415.732) [-416.388] (-416.036) (-417.113) * [-415.526] (-416.574) (-417.956) (-415.172) -- 0:00:32
      475000 -- [-416.928] (-416.878) (-417.115) (-418.103) * (-417.295) (-417.840) (-422.399) [-415.350] -- 0:00:32

      Average standard deviation of split frequencies: 0.008858

      475500 -- (-415.582) (-418.269) [-414.818] (-416.291) * [-415.154] (-418.542) (-418.846) (-416.933) -- 0:00:31
      476000 -- (-417.173) (-418.379) (-416.918) [-417.400] * [-418.881] (-415.806) (-422.030) (-415.889) -- 0:00:31
      476500 -- [-418.073] (-416.411) (-416.776) (-422.914) * [-415.108] (-417.825) (-415.385) (-418.884) -- 0:00:31
      477000 -- (-415.361) (-417.485) (-421.475) [-417.416] * (-416.626) (-416.330) (-420.963) [-416.070] -- 0:00:31
      477500 -- (-417.292) [-415.490] (-417.782) (-418.019) * (-416.015) [-415.142] (-416.720) (-418.443) -- 0:00:31
      478000 -- (-415.775) (-417.820) [-415.321] (-415.952) * (-418.897) (-417.166) (-415.178) [-415.482] -- 0:00:31
      478500 -- (-417.528) [-415.698] (-415.073) (-418.220) * (-416.752) [-416.785] (-415.991) (-420.143) -- 0:00:31
      479000 -- (-417.495) (-416.424) (-421.252) [-415.514] * (-417.081) [-417.410] (-416.685) (-422.184) -- 0:00:31
      479500 -- [-416.879] (-415.170) (-416.280) (-420.036) * (-417.113) [-418.708] (-419.750) (-415.527) -- 0:00:31
      480000 -- (-415.992) (-416.810) (-417.389) [-416.960] * (-416.054) [-417.291] (-416.167) (-414.839) -- 0:00:31

      Average standard deviation of split frequencies: 0.008942

      480500 -- (-416.702) (-415.792) [-416.019] (-417.016) * (-421.635) (-419.255) [-417.148] (-415.754) -- 0:00:31
      481000 -- [-416.126] (-418.933) (-415.765) (-414.645) * (-418.628) [-415.385] (-416.063) (-418.489) -- 0:00:31
      481500 -- (-417.283) (-419.550) [-418.628] (-416.220) * (-414.693) (-422.706) (-415.844) [-417.356] -- 0:00:31
      482000 -- (-415.730) (-418.740) [-419.630] (-416.041) * [-415.910] (-416.847) (-415.781) (-417.180) -- 0:00:31
      482500 -- [-414.646] (-416.980) (-415.406) (-421.473) * (-416.228) (-416.930) (-415.054) [-418.328] -- 0:00:31
      483000 -- (-415.342) [-416.872] (-415.496) (-419.052) * (-416.820) (-416.550) (-417.001) [-417.959] -- 0:00:31
      483500 -- (-415.938) [-416.229] (-417.168) (-416.463) * (-417.668) (-420.152) (-417.440) [-416.776] -- 0:00:30
      484000 -- (-415.043) (-415.650) [-416.671] (-421.349) * (-416.434) (-417.536) (-419.062) [-415.273] -- 0:00:30
      484500 -- (-417.323) [-417.832] (-416.499) (-417.250) * [-415.406] (-418.240) (-418.836) (-415.544) -- 0:00:30
      485000 -- (-418.645) (-416.374) [-417.256] (-416.761) * [-418.812] (-418.518) (-414.910) (-417.953) -- 0:00:30

      Average standard deviation of split frequencies: 0.008730

      485500 -- (-415.758) (-418.539) (-416.154) [-415.442] * (-415.331) (-416.534) (-419.241) [-420.373] -- 0:00:30
      486000 -- [-416.754] (-418.720) (-417.380) (-418.875) * [-414.750] (-417.218) (-415.471) (-415.028) -- 0:00:31
      486500 -- [-418.027] (-419.069) (-416.754) (-416.735) * (-416.431) (-418.449) [-415.650] (-415.462) -- 0:00:31
      487000 -- [-414.986] (-420.751) (-416.163) (-418.411) * (-417.641) (-416.531) (-416.968) [-417.273] -- 0:00:31
      487500 -- (-415.847) (-420.652) [-416.856] (-417.797) * (-420.855) (-416.149) (-418.032) [-418.503] -- 0:00:31
      488000 -- (-420.270) (-417.087) (-418.317) [-417.056] * (-419.133) (-415.778) [-418.221] (-420.065) -- 0:00:31
      488500 -- (-416.728) [-415.696] (-420.775) (-420.991) * (-422.278) (-421.633) (-416.514) [-417.131] -- 0:00:31
      489000 -- (-416.917) [-416.957] (-420.341) (-420.961) * [-416.883] (-416.977) (-418.236) (-415.112) -- 0:00:31
      489500 -- (-416.984) (-415.435) [-416.402] (-415.182) * [-416.855] (-416.774) (-416.881) (-416.470) -- 0:00:31
      490000 -- [-421.766] (-418.235) (-417.121) (-416.953) * [-415.293] (-414.574) (-415.643) (-418.578) -- 0:00:31

      Average standard deviation of split frequencies: 0.008025

      490500 -- (-415.822) [-418.058] (-417.606) (-416.889) * (-418.598) [-418.643] (-419.418) (-415.973) -- 0:00:31
      491000 -- (-417.895) (-414.953) (-415.968) [-414.816] * (-415.564) (-420.080) [-419.213] (-415.806) -- 0:00:31
      491500 -- (-423.107) (-417.540) (-414.644) [-416.177] * (-417.835) (-418.260) [-416.488] (-418.895) -- 0:00:31
      492000 -- (-416.374) (-414.679) [-414.648] (-415.348) * (-416.553) (-416.348) [-415.390] (-417.245) -- 0:00:30
      492500 -- (-417.713) [-414.527] (-416.068) (-417.410) * (-418.175) (-414.712) [-417.699] (-421.001) -- 0:00:30
      493000 -- (-415.388) [-414.713] (-415.736) (-416.800) * [-416.624] (-416.974) (-420.853) (-416.714) -- 0:00:30
      493500 -- (-415.740) (-416.141) [-416.117] (-418.959) * [-416.760] (-415.237) (-416.501) (-415.702) -- 0:00:30
      494000 -- (-415.417) (-417.098) [-415.194] (-421.140) * (-416.007) [-416.724] (-416.417) (-417.352) -- 0:00:30
      494500 -- (-416.033) (-422.656) (-415.548) [-417.133] * (-417.309) (-415.435) (-416.814) [-419.825] -- 0:00:30
      495000 -- (-425.588) (-421.360) [-418.569] (-415.694) * (-415.950) [-415.076] (-415.421) (-420.065) -- 0:00:30

      Average standard deviation of split frequencies: 0.008079

      495500 -- (-415.445) (-415.729) [-415.922] (-416.628) * (-416.533) (-415.178) (-415.401) [-415.355] -- 0:00:30
      496000 -- (-418.451) (-418.219) (-416.618) [-415.053] * [-416.609] (-418.189) (-415.851) (-415.696) -- 0:00:30
      496500 -- (-417.985) [-418.217] (-417.675) (-415.236) * (-421.365) [-416.298] (-418.428) (-415.129) -- 0:00:30
      497000 -- [-416.979] (-418.845) (-418.457) (-418.084) * (-420.802) (-417.221) (-419.777) [-420.519] -- 0:00:30
      497500 -- (-415.296) [-417.962] (-419.512) (-419.281) * [-418.198] (-415.546) (-415.863) (-418.725) -- 0:00:30
      498000 -- (-415.032) [-419.001] (-419.232) (-415.964) * (-417.675) [-418.081] (-420.607) (-415.789) -- 0:00:30
      498500 -- [-415.435] (-416.049) (-416.262) (-414.713) * (-415.883) (-417.935) [-415.127] (-416.264) -- 0:00:30
      499000 -- (-415.195) (-427.684) (-417.129) [-415.333] * [-416.282] (-414.763) (-415.007) (-418.935) -- 0:00:30
      499500 -- (-415.492) [-419.455] (-417.330) (-418.993) * (-415.037) (-424.859) [-417.968] (-415.509) -- 0:00:30
      500000 -- (-415.589) (-416.414) [-416.660] (-417.868) * [-414.696] (-415.490) (-416.162) (-415.934) -- 0:00:30

      Average standard deviation of split frequencies: 0.007784

      500500 -- [-414.928] (-415.608) (-417.692) (-418.546) * [-416.645] (-416.809) (-417.915) (-418.016) -- 0:00:29
      501000 -- (-414.648) (-416.219) [-417.242] (-419.067) * [-415.701] (-417.298) (-420.966) (-417.417) -- 0:00:29
      501500 -- (-416.857) [-419.060] (-417.778) (-418.412) * (-415.547) (-417.734) [-415.366] (-418.296) -- 0:00:29
      502000 -- (-415.700) (-414.501) (-420.732) [-416.020] * (-416.410) [-419.368] (-419.586) (-415.406) -- 0:00:29
      502500 -- [-419.493] (-418.517) (-418.010) (-416.216) * (-415.093) (-419.675) [-415.582] (-417.454) -- 0:00:29
      503000 -- [-418.342] (-418.199) (-423.027) (-418.580) * (-414.588) (-417.774) (-416.839) [-417.341] -- 0:00:30
      503500 -- (-415.801) [-415.472] (-414.704) (-417.234) * (-414.889) (-415.897) (-418.003) [-417.305] -- 0:00:30
      504000 -- [-417.935] (-414.973) (-416.892) (-418.546) * (-416.155) (-418.219) (-415.797) [-417.265] -- 0:00:30
      504500 -- [-417.037] (-418.252) (-418.398) (-416.394) * (-415.813) (-415.971) [-421.024] (-417.444) -- 0:00:30
      505000 -- [-417.912] (-418.844) (-416.309) (-417.922) * [-415.873] (-415.805) (-418.250) (-415.974) -- 0:00:30

      Average standard deviation of split frequencies: 0.007826

      505500 -- (-415.735) (-414.979) (-417.841) [-421.074] * (-417.482) (-415.178) (-415.399) [-415.917] -- 0:00:30
      506000 -- (-416.228) (-419.461) (-419.280) [-417.689] * (-418.975) (-417.000) [-417.655] (-416.838) -- 0:00:30
      506500 -- [-415.140] (-415.573) (-418.852) (-416.476) * (-417.252) [-416.706] (-416.908) (-416.594) -- 0:00:30
      507000 -- (-416.356) (-415.748) [-417.550] (-418.377) * (-419.415) (-417.724) [-416.109] (-418.301) -- 0:00:30
      507500 -- (-414.702) (-415.770) [-415.566] (-417.418) * (-415.759) [-417.607] (-417.218) (-415.462) -- 0:00:30
      508000 -- (-415.694) [-414.708] (-416.055) (-418.032) * (-415.399) (-416.976) [-416.280] (-416.629) -- 0:00:30
      508500 -- (-419.676) (-414.793) [-417.390] (-419.843) * (-415.189) (-421.003) (-415.992) [-417.121] -- 0:00:29
      509000 -- (-426.230) [-415.708] (-417.125) (-417.763) * [-414.962] (-415.822) (-419.318) (-417.957) -- 0:00:29
      509500 -- (-421.072) (-416.210) (-417.260) [-419.071] * [-414.923] (-416.060) (-423.906) (-418.144) -- 0:00:29
      510000 -- [-419.908] (-415.177) (-415.732) (-422.612) * (-417.365) (-415.636) (-415.204) [-416.711] -- 0:00:29

      Average standard deviation of split frequencies: 0.006954

      510500 -- (-416.690) (-417.075) [-415.805] (-417.857) * [-416.663] (-415.857) (-415.961) (-417.770) -- 0:00:29
      511000 -- [-415.187] (-417.880) (-416.313) (-415.272) * (-415.893) [-416.498] (-417.174) (-416.593) -- 0:00:29
      511500 -- [-419.450] (-416.484) (-416.169) (-415.964) * (-415.912) [-417.464] (-417.579) (-414.870) -- 0:00:29
      512000 -- (-418.751) (-418.145) (-416.809) [-416.833] * [-416.226] (-418.312) (-417.117) (-415.905) -- 0:00:29
      512500 -- (-417.193) (-416.284) (-418.499) [-416.006] * (-416.310) (-416.131) (-414.707) [-415.428] -- 0:00:29
      513000 -- [-415.718] (-415.990) (-416.033) (-420.975) * (-419.762) [-417.542] (-417.745) (-419.473) -- 0:00:29
      513500 -- (-418.259) (-418.624) [-415.322] (-416.125) * [-416.724] (-419.637) (-421.189) (-416.059) -- 0:00:29
      514000 -- (-418.833) (-421.309) [-421.208] (-415.896) * (-416.910) (-420.209) (-422.470) [-418.031] -- 0:00:29
      514500 -- (-417.593) (-420.075) (-418.329) [-414.877] * (-416.130) (-417.810) (-415.266) [-416.432] -- 0:00:29
      515000 -- (-416.544) (-420.839) (-415.633) [-416.997] * (-416.242) (-418.429) (-415.684) [-415.841] -- 0:00:29

      Average standard deviation of split frequencies: 0.006273

      515500 -- (-415.432) [-418.369] (-416.337) (-417.158) * (-421.580) (-415.999) [-414.877] (-418.152) -- 0:00:29
      516000 -- (-416.113) (-419.241) (-415.225) [-416.282] * (-415.098) (-416.325) [-415.974] (-417.465) -- 0:00:29
      516500 -- (-414.962) [-418.727] (-419.835) (-415.966) * [-415.185] (-415.477) (-417.315) (-416.087) -- 0:00:29
      517000 -- (-419.417) (-415.027) [-414.856] (-422.879) * (-415.780) (-419.669) [-418.022] (-424.613) -- 0:00:28
      517500 -- [-415.923] (-415.281) (-420.690) (-417.767) * (-417.870) (-417.114) (-418.080) [-416.497] -- 0:00:28
      518000 -- (-414.963) [-419.106] (-416.366) (-415.910) * (-416.097) (-416.877) (-417.166) [-419.780] -- 0:00:28
      518500 -- (-421.152) [-416.259] (-415.896) (-419.912) * [-414.842] (-416.556) (-416.879) (-417.192) -- 0:00:28
      519000 -- (-419.641) (-415.286) [-415.220] (-416.493) * (-416.440) (-422.143) (-418.057) [-417.783] -- 0:00:28
      519500 -- (-419.399) [-415.986] (-415.875) (-417.590) * (-415.185) (-418.109) (-418.964) [-416.967] -- 0:00:29
      520000 -- [-418.693] (-416.128) (-419.430) (-419.458) * (-415.801) (-416.302) (-417.645) [-420.642] -- 0:00:29

      Average standard deviation of split frequencies: 0.005855

      520500 -- [-419.560] (-416.293) (-416.990) (-414.781) * [-418.016] (-416.855) (-414.992) (-422.356) -- 0:00:29
      521000 -- (-419.184) (-420.820) (-419.341) [-414.568] * (-419.470) [-416.423] (-415.439) (-417.720) -- 0:00:29
      521500 -- [-417.501] (-419.073) (-416.998) (-417.387) * [-417.139] (-415.669) (-415.920) (-414.940) -- 0:00:29
      522000 -- (-420.678) (-418.023) (-419.575) [-420.079] * (-415.648) (-415.847) (-416.822) [-415.156] -- 0:00:29
      522500 -- (-416.914) [-418.795] (-414.764) (-424.027) * [-414.950] (-420.054) (-417.719) (-416.498) -- 0:00:29
      523000 -- (-414.882) [-414.795] (-415.460) (-416.820) * (-417.152) (-417.921) [-417.474] (-416.578) -- 0:00:29
      523500 -- [-415.376] (-415.003) (-415.295) (-417.662) * (-417.711) (-416.425) (-416.263) [-414.805] -- 0:00:29
      524000 -- [-417.685] (-415.848) (-415.462) (-419.553) * (-415.164) (-415.886) [-415.385] (-416.266) -- 0:00:29
      524500 -- (-416.783) (-417.595) (-416.586) [-414.796] * [-416.877] (-415.402) (-415.390) (-415.732) -- 0:00:29
      525000 -- (-416.678) (-415.463) (-417.066) [-418.331] * (-416.395) [-417.269] (-414.975) (-419.095) -- 0:00:28

      Average standard deviation of split frequencies: 0.006554

      525500 -- (-419.064) [-418.556] (-421.233) (-416.823) * (-418.486) (-420.156) (-416.653) [-417.578] -- 0:00:28
      526000 -- (-418.243) [-416.914] (-417.149) (-418.310) * [-415.316] (-422.701) (-415.545) (-415.975) -- 0:00:28
      526500 -- [-415.736] (-420.422) (-415.492) (-417.768) * (-415.450) [-422.661] (-415.485) (-417.226) -- 0:00:28
      527000 -- (-415.466) [-423.242] (-414.864) (-419.165) * [-416.640] (-415.613) (-416.631) (-418.527) -- 0:00:28
      527500 -- (-416.752) [-417.171] (-414.995) (-417.250) * [-416.984] (-417.707) (-416.658) (-418.034) -- 0:00:28
      528000 -- (-416.605) (-415.645) [-415.333] (-416.649) * (-418.946) (-418.743) [-416.025] (-417.035) -- 0:00:28
      528500 -- [-416.234] (-416.147) (-415.338) (-414.892) * (-420.406) [-417.020] (-415.141) (-416.577) -- 0:00:28
      529000 -- (-415.743) (-418.283) (-417.523) [-415.783] * (-417.611) (-415.080) [-417.994] (-416.088) -- 0:00:28
      529500 -- [-418.294] (-419.171) (-415.061) (-415.722) * [-417.393] (-415.525) (-416.161) (-422.064) -- 0:00:28
      530000 -- [-418.711] (-417.724) (-416.263) (-418.204) * [-416.518] (-418.043) (-415.456) (-415.254) -- 0:00:28

      Average standard deviation of split frequencies: 0.005567

      530500 -- (-419.702) (-418.153) [-417.336] (-420.202) * (-422.812) (-417.728) (-419.797) [-416.688] -- 0:00:28
      531000 -- (-416.723) [-415.161] (-415.980) (-417.807) * (-416.795) (-418.586) (-417.141) [-417.991] -- 0:00:28
      531500 -- [-417.460] (-415.137) (-416.292) (-416.527) * (-416.353) (-419.033) [-416.163] (-417.101) -- 0:00:28
      532000 -- (-416.557) [-416.098] (-421.068) (-421.003) * [-418.582] (-417.765) (-417.013) (-416.704) -- 0:00:28
      532500 -- (-417.275) (-419.076) [-415.801] (-420.437) * (-418.091) (-421.374) (-416.772) [-415.243] -- 0:00:28
      533000 -- (-417.218) (-416.498) (-416.348) [-415.671] * (-421.118) (-415.712) (-417.940) [-416.022] -- 0:00:28
      533500 -- (-416.692) (-418.108) (-420.206) [-417.094] * [-415.433] (-415.390) (-419.608) (-416.145) -- 0:00:27
      534000 -- [-416.374] (-418.179) (-418.115) (-418.310) * (-415.538) (-417.105) [-420.633] (-415.948) -- 0:00:27
      534500 -- [-416.169] (-418.008) (-418.756) (-417.087) * (-417.563) [-416.602] (-420.361) (-418.091) -- 0:00:27
      535000 -- (-419.159) [-415.725] (-420.479) (-417.869) * (-416.078) [-415.634] (-416.475) (-419.248) -- 0:00:27

      Average standard deviation of split frequencies: 0.005336

      535500 -- [-416.390] (-419.071) (-415.451) (-416.526) * [-415.127] (-415.878) (-416.734) (-425.765) -- 0:00:27
      536000 -- (-417.411) [-417.622] (-416.111) (-415.328) * (-415.265) (-416.759) [-419.054] (-421.747) -- 0:00:27
      536500 -- (-414.569) (-420.290) (-415.350) [-416.290] * (-416.045) (-415.474) (-417.217) [-416.137] -- 0:00:28
      537000 -- (-419.237) (-415.922) [-417.703] (-416.903) * [-417.036] (-416.558) (-416.139) (-417.991) -- 0:00:28
      537500 -- (-416.222) [-414.838] (-415.029) (-417.187) * (-416.297) [-421.092] (-415.334) (-424.168) -- 0:00:28
      538000 -- (-417.393) [-415.868] (-417.045) (-416.927) * [-419.954] (-418.393) (-415.320) (-415.781) -- 0:00:28
      538500 -- [-417.389] (-415.772) (-415.854) (-417.142) * (-415.514) (-417.641) (-415.339) [-415.674] -- 0:00:28
      539000 -- (-415.226) [-416.123] (-416.833) (-417.857) * (-416.298) (-415.157) (-422.007) [-416.906] -- 0:00:28
      539500 -- (-415.512) [-418.615] (-415.261) (-415.999) * [-415.302] (-415.235) (-416.154) (-415.243) -- 0:00:28
      540000 -- (-416.588) (-418.299) [-415.148] (-416.148) * (-415.103) [-416.864] (-417.784) (-417.043) -- 0:00:28

      Average standard deviation of split frequencies: 0.004999

      540500 -- [-419.353] (-417.620) (-416.955) (-415.793) * [-416.243] (-421.726) (-417.871) (-416.099) -- 0:00:28
      541000 -- (-417.861) (-418.463) (-423.187) [-419.521] * (-415.425) (-417.398) (-415.821) [-417.015] -- 0:00:27
      541500 -- (-416.006) (-418.629) (-417.323) [-417.969] * (-416.205) (-415.562) [-415.720] (-415.089) -- 0:00:27
      542000 -- (-417.319) (-418.916) [-415.662] (-417.050) * (-414.560) [-418.395] (-419.893) (-421.218) -- 0:00:27
      542500 -- (-415.558) (-420.953) [-415.969] (-417.067) * [-416.710] (-415.992) (-416.801) (-415.164) -- 0:00:27
      543000 -- (-414.766) (-417.081) [-417.699] (-420.019) * [-415.069] (-418.558) (-415.666) (-416.538) -- 0:00:27
      543500 -- (-423.654) (-419.853) [-416.431] (-415.930) * (-416.060) (-418.350) [-415.635] (-418.854) -- 0:00:27
      544000 -- (-420.828) [-415.471] (-415.496) (-414.991) * (-415.651) [-417.709] (-415.686) (-417.794) -- 0:00:27
      544500 -- (-415.746) (-417.222) [-417.010] (-417.496) * [-416.291] (-418.148) (-416.917) (-414.582) -- 0:00:27
      545000 -- (-418.024) (-416.902) [-414.940] (-418.495) * (-415.732) (-415.882) (-416.824) [-415.242] -- 0:00:27

      Average standard deviation of split frequencies: 0.005583

      545500 -- (-415.419) (-418.596) [-417.905] (-415.652) * (-415.727) [-414.592] (-419.608) (-416.023) -- 0:00:27
      546000 -- (-421.559) (-416.196) (-418.054) [-417.041] * [-415.123] (-420.843) (-417.100) (-416.972) -- 0:00:27
      546500 -- (-417.069) [-416.502] (-415.883) (-418.397) * [-414.706] (-415.301) (-418.404) (-417.611) -- 0:00:27
      547000 -- (-416.870) [-416.311] (-417.786) (-417.776) * (-421.851) (-416.857) (-417.126) [-422.091] -- 0:00:27
      547500 -- (-415.215) (-414.818) [-417.369] (-415.632) * [-417.374] (-416.660) (-423.776) (-417.752) -- 0:00:27
      548000 -- [-415.532] (-415.354) (-415.825) (-415.313) * (-415.962) [-419.065] (-417.235) (-415.358) -- 0:00:27
      548500 -- [-419.627] (-415.588) (-416.432) (-415.376) * (-419.340) [-415.408] (-417.245) (-415.458) -- 0:00:27
      549000 -- [-417.952] (-416.656) (-414.785) (-416.212) * (-418.799) (-415.173) [-415.343] (-417.095) -- 0:00:27
      549500 -- (-416.926) (-416.463) (-418.396) [-418.353] * (-416.061) (-414.870) (-420.973) [-415.964] -- 0:00:27
      550000 -- [-416.499] (-416.129) (-419.636) (-415.615) * (-417.634) (-415.576) (-416.907) [-414.675] -- 0:00:27

      Average standard deviation of split frequencies: 0.005422

      550500 -- (-416.841) [-415.152] (-418.333) (-415.671) * (-419.231) (-415.939) (-418.872) [-416.318] -- 0:00:26
      551000 -- (-416.541) (-417.218) (-417.384) [-416.359] * (-415.820) (-418.855) [-418.330] (-419.102) -- 0:00:26
      551500 -- (-417.763) [-420.136] (-417.926) (-416.517) * (-415.200) (-416.947) [-416.422] (-416.564) -- 0:00:26
      552000 -- (-416.369) [-415.317] (-417.225) (-415.196) * (-414.973) (-415.861) (-417.318) [-418.097] -- 0:00:26
      552500 -- [-416.068] (-416.982) (-419.836) (-417.549) * (-416.068) (-418.471) (-419.762) [-416.095] -- 0:00:26
      553000 -- (-417.497) (-416.910) [-417.737] (-420.400) * (-416.448) (-414.986) (-416.107) [-416.132] -- 0:00:26
      553500 -- (-417.439) [-416.498] (-417.962) (-418.052) * (-415.077) (-419.615) (-417.009) [-415.843] -- 0:00:27
      554000 -- (-415.262) (-421.710) [-416.692] (-415.049) * (-416.402) (-417.488) [-416.760] (-420.135) -- 0:00:27
      554500 -- (-415.917) [-415.389] (-420.605) (-415.361) * (-418.528) (-419.574) (-417.776) [-415.067] -- 0:00:27
      555000 -- [-415.984] (-417.173) (-420.919) (-415.910) * (-415.880) (-417.877) (-415.654) [-418.744] -- 0:00:27

      Average standard deviation of split frequencies: 0.005539

      555500 -- (-427.707) (-416.884) (-417.935) [-416.852] * (-415.111) (-415.852) [-415.098] (-416.872) -- 0:00:27
      556000 -- (-418.885) (-417.204) [-418.943] (-420.337) * (-419.500) [-416.139] (-416.837) (-418.356) -- 0:00:27
      556500 -- [-415.279] (-415.453) (-415.814) (-418.162) * (-417.612) (-417.037) [-419.284] (-419.267) -- 0:00:27
      557000 -- (-415.525) [-416.825] (-417.134) (-420.158) * (-418.654) [-416.202] (-415.289) (-415.044) -- 0:00:27
      557500 -- (-422.443) (-416.251) [-415.805] (-417.285) * [-418.613] (-415.111) (-417.491) (-420.416) -- 0:00:26
      558000 -- (-415.486) [-415.524] (-416.479) (-416.716) * [-416.883] (-423.737) (-419.454) (-418.975) -- 0:00:26
      558500 -- (-416.282) (-415.793) [-416.485] (-417.760) * (-415.455) (-418.097) [-415.891] (-415.157) -- 0:00:26
      559000 -- (-416.493) [-419.784] (-415.917) (-416.609) * (-416.431) [-416.211] (-417.341) (-419.220) -- 0:00:26
      559500 -- (-418.150) [-417.675] (-423.269) (-420.851) * (-419.546) [-416.199] (-415.873) (-416.945) -- 0:00:26
      560000 -- (-417.019) (-415.551) (-417.866) [-415.720] * (-417.532) [-416.637] (-415.469) (-415.286) -- 0:00:26

      Average standard deviation of split frequencies: 0.004877

      560500 -- (-418.801) (-419.413) (-415.639) [-415.853] * (-416.415) (-417.614) (-415.422) [-417.631] -- 0:00:26
      561000 -- (-416.983) (-420.419) [-417.593] (-415.070) * [-417.749] (-418.105) (-417.054) (-420.006) -- 0:00:26
      561500 -- (-414.913) (-418.217) (-416.273) [-417.863] * (-416.533) (-418.946) [-417.572] (-416.777) -- 0:00:26
      562000 -- [-416.730] (-417.397) (-419.974) (-417.010) * (-417.925) (-418.345) (-417.100) [-417.405] -- 0:00:26
      562500 -- (-417.199) [-415.299] (-418.644) (-416.676) * [-414.927] (-415.895) (-415.924) (-417.788) -- 0:00:26
      563000 -- [-418.939] (-414.770) (-420.925) (-418.487) * [-415.740] (-415.173) (-417.025) (-420.830) -- 0:00:26
      563500 -- [-415.814] (-417.151) (-416.415) (-417.280) * (-417.468) [-417.511] (-415.454) (-415.159) -- 0:00:26
      564000 -- (-416.663) (-418.419) (-414.764) [-416.044] * (-416.507) [-416.001] (-415.359) (-415.942) -- 0:00:26
      564500 -- [-419.273] (-417.739) (-416.768) (-414.929) * (-415.687) [-415.863] (-419.519) (-418.010) -- 0:00:26
      565000 -- (-415.350) (-415.820) [-419.500] (-415.745) * [-415.648] (-418.682) (-417.642) (-421.413) -- 0:00:26

      Average standard deviation of split frequencies: 0.005108

      565500 -- [-416.035] (-414.902) (-422.576) (-418.394) * [-417.626] (-415.611) (-415.904) (-419.043) -- 0:00:26
      566000 -- (-415.095) (-414.848) (-419.130) [-415.350] * [-417.958] (-416.016) (-423.131) (-419.583) -- 0:00:26
      566500 -- (-417.112) (-415.035) [-414.748] (-415.596) * (-416.797) [-415.954] (-417.276) (-418.316) -- 0:00:26
      567000 -- (-418.808) (-416.524) (-416.890) [-415.017] * [-416.300] (-418.004) (-417.305) (-417.141) -- 0:00:25
      567500 -- [-420.590] (-416.655) (-420.393) (-418.115) * (-418.429) [-416.099] (-416.653) (-416.505) -- 0:00:25
      568000 -- (-419.008) [-416.757] (-416.917) (-417.495) * (-416.102) [-417.164] (-416.280) (-415.312) -- 0:00:25
      568500 -- (-418.397) [-419.197] (-417.039) (-419.207) * [-415.835] (-416.417) (-417.213) (-418.189) -- 0:00:25
      569000 -- [-414.997] (-417.789) (-415.071) (-416.164) * [-415.234] (-417.644) (-416.988) (-415.595) -- 0:00:25
      569500 -- (-415.321) [-418.036] (-415.851) (-417.228) * (-416.830) (-415.893) [-415.640] (-415.993) -- 0:00:25
      570000 -- (-420.138) (-419.838) [-418.156] (-417.000) * (-415.024) (-416.717) (-415.368) [-416.462] -- 0:00:25

      Average standard deviation of split frequencies: 0.005287

      570500 -- (-416.379) (-416.569) [-415.437] (-418.205) * (-415.901) [-417.070] (-414.807) (-416.288) -- 0:00:26
      571000 -- (-416.997) [-415.340] (-416.475) (-416.275) * (-416.984) (-414.627) (-416.691) [-415.584] -- 0:00:26
      571500 -- (-414.751) (-417.657) (-418.404) [-414.815] * [-418.782] (-415.033) (-415.759) (-416.887) -- 0:00:26
      572000 -- (-414.626) (-415.183) (-416.181) [-415.750] * (-417.069) [-415.955] (-419.016) (-415.451) -- 0:00:26
      572500 -- [-416.454] (-416.083) (-418.908) (-417.803) * (-415.707) [-415.349] (-415.254) (-416.250) -- 0:00:26
      573000 -- [-416.169] (-415.661) (-421.566) (-419.140) * [-417.026] (-415.244) (-416.316) (-415.513) -- 0:00:26
      573500 -- (-414.947) (-416.507) [-415.294] (-418.321) * (-415.953) (-416.272) [-416.140] (-415.749) -- 0:00:26
      574000 -- [-416.458] (-415.363) (-420.079) (-415.827) * [-417.126] (-417.184) (-417.551) (-414.424) -- 0:00:25
      574500 -- (-416.063) (-416.538) [-418.684] (-416.984) * [-417.683] (-421.517) (-417.229) (-415.332) -- 0:00:25
      575000 -- [-415.533] (-415.092) (-416.403) (-415.668) * (-415.300) (-418.200) [-415.914] (-415.426) -- 0:00:25

      Average standard deviation of split frequencies: 0.004801

      575500 -- [-416.420] (-418.076) (-420.890) (-418.555) * [-415.897] (-420.848) (-416.811) (-415.170) -- 0:00:25
      576000 -- (-417.123) [-416.710] (-415.593) (-417.589) * (-418.219) (-414.459) (-416.754) [-419.275] -- 0:00:25
      576500 -- (-417.016) (-419.086) [-414.857] (-418.156) * (-416.507) (-417.075) [-415.506] (-419.957) -- 0:00:25
      577000 -- [-416.548] (-416.486) (-415.390) (-415.374) * [-414.694] (-416.259) (-416.681) (-416.142) -- 0:00:25
      577500 -- (-418.447) (-416.192) (-417.211) [-418.325] * (-418.906) (-415.527) (-416.149) [-418.091] -- 0:00:25
      578000 -- (-415.976) [-421.296] (-419.346) (-415.543) * (-415.120) (-416.158) [-419.752] (-418.705) -- 0:00:25
      578500 -- (-417.231) [-418.830] (-415.709) (-414.935) * (-415.160) (-415.356) [-420.293] (-416.552) -- 0:00:25
      579000 -- (-416.187) [-416.872] (-416.184) (-414.593) * (-416.042) (-415.681) [-417.429] (-415.774) -- 0:00:25
      579500 -- (-418.414) [-415.423] (-417.577) (-415.662) * (-415.249) [-421.185] (-416.689) (-419.723) -- 0:00:25
      580000 -- (-418.355) (-417.300) (-419.335) [-415.636] * (-417.310) (-415.710) [-415.535] (-415.755) -- 0:00:25

      Average standard deviation of split frequencies: 0.004546

      580500 -- [-415.938] (-417.971) (-420.007) (-415.238) * (-415.870) (-417.341) (-416.068) [-415.660] -- 0:00:25
      581000 -- (-415.328) [-417.704] (-416.624) (-416.598) * (-415.559) [-416.530] (-419.767) (-418.429) -- 0:00:25
      581500 -- (-416.818) (-418.733) (-415.462) [-417.627] * (-415.489) (-415.506) [-416.378] (-415.288) -- 0:00:25
      582000 -- [-415.437] (-417.267) (-416.270) (-417.420) * (-419.562) (-416.846) [-417.951] (-416.778) -- 0:00:25
      582500 -- (-416.071) (-417.824) (-417.748) [-415.233] * (-419.944) [-415.328] (-416.292) (-414.965) -- 0:00:25
      583000 -- (-417.353) (-414.829) [-418.171] (-416.991) * (-415.476) [-414.872] (-419.154) (-420.297) -- 0:00:25
      583500 -- (-419.604) (-414.848) (-417.893) [-418.382] * (-415.358) (-416.231) [-417.139] (-419.839) -- 0:00:24
      584000 -- (-415.267) [-415.147] (-414.804) (-416.341) * (-416.929) (-416.281) [-415.917] (-423.614) -- 0:00:24
      584500 -- (-418.276) (-417.392) (-415.920) [-415.114] * [-415.264] (-417.858) (-421.099) (-421.425) -- 0:00:24
      585000 -- (-415.589) (-419.909) [-415.016] (-416.250) * [-419.636] (-415.657) (-415.240) (-417.639) -- 0:00:24

      Average standard deviation of split frequencies: 0.004237

      585500 -- (-417.246) (-420.195) (-420.638) [-417.163] * [-415.293] (-416.690) (-415.595) (-421.356) -- 0:00:24
      586000 -- (-417.391) (-424.194) [-416.202] (-418.017) * (-415.617) [-414.468] (-417.084) (-418.668) -- 0:00:24
      586500 -- (-416.907) [-415.995] (-415.937) (-415.207) * (-418.706) (-416.214) [-416.447] (-417.747) -- 0:00:24
      587000 -- (-417.510) (-415.685) [-415.758] (-414.901) * [-416.665] (-416.141) (-419.358) (-422.201) -- 0:00:25
      587500 -- (-415.530) [-415.065] (-414.815) (-416.050) * (-416.962) (-416.505) (-415.737) [-418.830] -- 0:00:25
      588000 -- (-417.601) (-419.671) (-416.582) [-417.617] * (-416.908) (-415.310) [-415.182] (-418.327) -- 0:00:25
      588500 -- (-415.157) (-416.113) (-416.319) [-417.244] * (-416.701) (-418.280) (-415.587) [-418.625] -- 0:00:25
      589000 -- (-415.074) (-415.713) (-416.167) [-417.786] * (-419.189) (-415.824) (-415.784) [-418.405] -- 0:00:25
      589500 -- (-416.368) [-415.467] (-424.575) (-420.849) * (-416.071) (-421.735) [-418.916] (-417.711) -- 0:00:25
      590000 -- (-418.495) (-419.729) (-416.376) [-417.095] * (-416.183) (-418.997) [-415.031] (-419.249) -- 0:00:25

      Average standard deviation of split frequencies: 0.004576

      590500 -- (-419.881) (-415.527) [-417.105] (-415.736) * [-416.710] (-418.654) (-417.777) (-419.995) -- 0:00:24
      591000 -- (-416.763) (-415.049) [-416.730] (-417.804) * (-416.517) (-417.533) (-415.654) [-414.916] -- 0:00:24
      591500 -- (-415.195) (-417.501) (-417.762) [-421.539] * (-416.973) (-418.887) (-416.560) [-417.341] -- 0:00:24
      592000 -- [-416.620] (-414.609) (-416.042) (-416.730) * (-419.614) [-415.028] (-414.902) (-421.450) -- 0:00:24
      592500 -- (-415.431) (-415.559) (-417.528) [-415.728] * [-415.544] (-414.949) (-414.795) (-415.351) -- 0:00:24
      593000 -- (-415.342) [-414.669] (-418.728) (-419.700) * (-416.084) (-415.430) [-417.248] (-416.272) -- 0:00:24
      593500 -- (-416.686) (-417.188) (-416.840) [-416.180] * (-414.638) (-414.909) (-416.160) [-414.567] -- 0:00:24
      594000 -- (-417.828) (-416.284) (-415.659) [-419.630] * (-418.721) (-420.313) (-415.365) [-415.670] -- 0:00:24
      594500 -- (-416.901) (-414.978) (-417.444) [-418.662] * (-414.716) (-418.046) (-421.159) [-414.951] -- 0:00:24
      595000 -- (-415.809) (-415.537) (-415.145) [-417.525] * [-415.376] (-416.045) (-417.435) (-415.228) -- 0:00:24

      Average standard deviation of split frequencies: 0.004798

      595500 -- [-414.795] (-415.747) (-414.951) (-416.743) * [-415.047] (-416.819) (-415.476) (-415.218) -- 0:00:24
      596000 -- (-415.800) (-418.010) (-414.805) [-416.122] * (-415.569) (-417.294) (-415.818) [-414.954] -- 0:00:24
      596500 -- [-418.252] (-416.939) (-415.221) (-419.967) * (-416.592) [-416.414] (-416.931) (-415.229) -- 0:00:24
      597000 -- (-415.273) (-416.329) (-418.055) [-418.808] * (-416.833) [-418.217] (-420.066) (-415.713) -- 0:00:24
      597500 -- (-415.299) (-417.940) [-417.617] (-417.255) * (-421.303) (-417.886) (-418.322) [-417.039] -- 0:00:24
      598000 -- (-417.267) [-415.815] (-417.286) (-416.333) * (-417.703) (-416.790) [-416.471] (-416.045) -- 0:00:24
      598500 -- [-416.219] (-414.599) (-415.920) (-416.453) * (-416.138) [-417.589] (-416.838) (-415.732) -- 0:00:24
      599000 -- (-416.681) [-417.303] (-417.061) (-417.016) * [-415.647] (-417.354) (-419.813) (-417.563) -- 0:00:24
      599500 -- (-418.898) (-415.172) (-416.997) [-414.592] * (-417.381) [-415.857] (-415.273) (-415.092) -- 0:00:24
      600000 -- (-419.101) (-418.288) (-416.290) [-418.167] * (-416.434) (-416.488) [-416.731] (-418.262) -- 0:00:24

      Average standard deviation of split frequencies: 0.005284

      600500 -- [-416.968] (-418.791) (-416.260) (-414.797) * [-415.785] (-419.029) (-417.200) (-417.550) -- 0:00:23
      601000 -- (-416.079) (-417.647) [-416.249] (-415.558) * (-416.086) [-416.996] (-420.221) (-416.171) -- 0:00:23
      601500 -- (-415.876) (-417.726) (-415.813) [-416.293] * (-415.949) (-417.647) [-416.111] (-417.771) -- 0:00:23
      602000 -- (-414.927) (-414.544) [-415.983] (-417.966) * [-415.887] (-418.595) (-418.309) (-418.194) -- 0:00:23
      602500 -- (-415.568) (-415.192) (-416.322) [-416.010] * (-419.328) (-418.827) (-418.508) [-417.750] -- 0:00:23
      603000 -- [-418.976] (-417.708) (-417.748) (-416.079) * (-419.913) (-417.085) (-415.502) [-422.596] -- 0:00:23
      603500 -- (-416.957) (-418.907) (-419.644) [-416.750] * (-425.065) (-422.647) [-419.331] (-417.173) -- 0:00:23
      604000 -- (-415.851) [-416.774] (-419.636) (-419.258) * (-422.541) (-418.548) [-418.928] (-417.901) -- 0:00:24
      604500 -- (-416.424) [-415.183] (-417.521) (-416.871) * (-417.774) (-417.891) (-418.643) [-415.484] -- 0:00:24
      605000 -- [-417.260] (-417.311) (-420.981) (-419.830) * (-416.425) (-417.818) [-417.284] (-418.281) -- 0:00:24

      Average standard deviation of split frequencies: 0.005549

      605500 -- (-417.320) (-415.637) (-416.126) [-414.826] * [-415.791] (-416.130) (-418.060) (-415.957) -- 0:00:24
      606000 -- (-417.139) [-419.116] (-415.721) (-417.385) * (-415.168) [-416.326] (-418.831) (-417.703) -- 0:00:24
      606500 -- (-416.210) [-419.595] (-415.668) (-416.712) * [-414.952] (-417.419) (-416.620) (-416.187) -- 0:00:24
      607000 -- (-421.334) [-415.501] (-415.585) (-417.571) * (-415.377) (-416.785) [-416.299] (-414.988) -- 0:00:23
      607500 -- (-417.975) (-415.226) (-416.958) [-418.638] * (-417.831) (-415.582) [-415.452] (-420.228) -- 0:00:23
      608000 -- (-415.672) (-419.326) [-418.763] (-417.015) * (-418.920) (-418.762) [-416.420] (-416.321) -- 0:00:23
      608500 -- (-415.812) [-419.041] (-417.867) (-419.191) * [-417.075] (-417.230) (-416.981) (-416.002) -- 0:00:23
      609000 -- [-416.094] (-419.872) (-416.824) (-418.704) * (-416.135) (-416.101) [-416.977] (-416.680) -- 0:00:23
      609500 -- (-418.771) [-415.211] (-416.521) (-420.031) * (-419.912) [-416.565] (-416.500) (-415.346) -- 0:00:23
      610000 -- (-418.493) (-416.618) [-418.969] (-417.630) * (-417.195) (-419.211) (-420.379) [-415.469] -- 0:00:23

      Average standard deviation of split frequencies: 0.005764

      610500 -- (-419.241) [-415.886] (-418.474) (-416.845) * (-416.682) [-419.680] (-417.647) (-420.425) -- 0:00:23
      611000 -- (-417.232) (-416.340) [-415.291] (-416.245) * [-415.951] (-417.236) (-416.277) (-416.796) -- 0:00:23
      611500 -- (-422.014) [-415.587] (-417.046) (-416.258) * (-417.330) (-416.551) [-420.255] (-421.337) -- 0:00:23
      612000 -- [-418.386] (-417.569) (-415.952) (-416.628) * (-416.208) (-416.557) [-417.477] (-418.064) -- 0:00:23
      612500 -- [-415.107] (-417.005) (-417.558) (-417.317) * (-415.417) [-415.902] (-415.720) (-418.183) -- 0:00:23
      613000 -- [-415.136] (-415.963) (-416.217) (-416.154) * [-415.658] (-415.465) (-416.457) (-415.220) -- 0:00:23
      613500 -- (-415.829) [-415.183] (-416.249) (-419.061) * (-417.133) [-415.636] (-416.583) (-415.995) -- 0:00:23
      614000 -- (-415.005) (-419.455) (-416.037) [-414.592] * [-416.580] (-417.292) (-418.255) (-416.377) -- 0:00:23
      614500 -- (-418.046) [-419.424] (-419.576) (-420.460) * (-416.769) (-419.991) [-416.205] (-415.145) -- 0:00:23
      615000 -- (-415.616) [-418.942] (-422.277) (-425.212) * (-416.533) (-418.757) [-416.707] (-414.699) -- 0:00:23

      Average standard deviation of split frequencies: 0.005816

      615500 -- (-415.513) (-418.993) [-416.286] (-417.255) * (-416.107) (-417.475) (-420.869) [-416.769] -- 0:00:23
      616000 -- (-415.344) (-416.276) [-420.299] (-416.004) * (-415.659) [-419.906] (-416.870) (-415.410) -- 0:00:23
      616500 -- (-415.517) [-415.825] (-421.175) (-415.054) * (-420.528) (-415.063) (-421.574) [-417.576] -- 0:00:23
      617000 -- [-418.523] (-421.062) (-415.812) (-418.947) * (-418.525) (-415.439) [-416.053] (-418.652) -- 0:00:22
      617500 -- [-419.443] (-419.714) (-420.694) (-415.147) * (-416.980) (-416.574) (-418.111) [-420.335] -- 0:00:22
      618000 -- [-417.225] (-420.562) (-418.421) (-415.816) * [-415.973] (-419.500) (-416.160) (-415.844) -- 0:00:22
      618500 -- (-416.868) [-417.746] (-418.035) (-415.564) * (-418.328) (-417.517) [-415.913] (-415.300) -- 0:00:22
      619000 -- (-416.678) (-416.978) (-415.388) [-417.735] * (-416.958) (-416.981) [-415.382] (-416.089) -- 0:00:22
      619500 -- (-416.401) (-417.858) [-415.202] (-418.033) * (-415.753) (-419.260) [-415.095] (-416.849) -- 0:00:22
      620000 -- (-416.649) [-415.323] (-416.209) (-415.940) * (-417.642) (-421.296) [-416.306] (-416.923) -- 0:00:22

      Average standard deviation of split frequencies: 0.006228

      620500 -- (-421.095) (-415.825) [-415.458] (-416.622) * (-417.785) [-415.188] (-416.491) (-417.043) -- 0:00:23
      621000 -- (-417.075) (-415.621) [-417.188] (-422.683) * [-414.978] (-417.086) (-415.963) (-415.748) -- 0:00:23
      621500 -- [-416.131] (-419.621) (-416.718) (-416.722) * (-415.355) [-415.988] (-422.654) (-416.747) -- 0:00:23
      622000 -- (-417.112) [-422.121] (-416.288) (-418.766) * [-417.306] (-418.330) (-416.244) (-417.408) -- 0:00:23
      622500 -- (-416.764) [-416.992] (-416.074) (-416.575) * [-416.430] (-416.616) (-415.030) (-416.886) -- 0:00:23
      623000 -- [-418.815] (-416.296) (-421.346) (-416.008) * (-418.160) (-416.545) (-415.791) [-417.380] -- 0:00:22
      623500 -- (-417.981) (-415.439) [-415.422] (-415.000) * (-419.322) [-418.185] (-417.410) (-417.063) -- 0:00:22
      624000 -- (-415.667) (-415.534) [-419.897] (-415.574) * (-416.256) [-416.839] (-419.234) (-417.495) -- 0:00:22
      624500 -- (-415.317) (-415.720) (-419.463) [-416.179] * (-416.520) [-415.556] (-416.068) (-417.426) -- 0:00:22
      625000 -- (-414.979) (-415.353) (-417.302) [-417.125] * [-419.492] (-416.393) (-416.602) (-417.366) -- 0:00:22

      Average standard deviation of split frequencies: 0.006526

      625500 -- (-417.127) (-416.836) [-415.245] (-417.498) * (-417.184) (-419.657) (-416.504) [-417.396] -- 0:00:22
      626000 -- (-415.660) [-416.944] (-414.934) (-415.047) * (-419.720) (-417.145) (-418.979) [-415.717] -- 0:00:22
      626500 -- [-415.850] (-417.025) (-417.340) (-418.469) * (-417.945) (-416.031) [-415.215] (-418.791) -- 0:00:22
      627000 -- (-417.215) (-417.475) (-418.585) [-416.861] * [-416.837] (-417.303) (-415.529) (-417.653) -- 0:00:22
      627500 -- [-423.663] (-415.277) (-417.903) (-417.347) * (-415.262) [-416.585] (-417.136) (-414.661) -- 0:00:22
      628000 -- (-417.871) (-416.924) [-415.621] (-417.438) * (-415.578) (-418.133) [-416.175] (-415.007) -- 0:00:22
      628500 -- [-418.479] (-418.204) (-419.707) (-415.253) * (-421.270) (-419.748) [-416.611] (-416.018) -- 0:00:22
      629000 -- [-417.804] (-420.827) (-415.477) (-414.920) * (-417.936) [-417.809] (-418.471) (-417.891) -- 0:00:22
      629500 -- (-415.383) (-416.763) (-417.190) [-415.668] * [-414.679] (-417.925) (-421.698) (-415.041) -- 0:00:22
      630000 -- [-414.884] (-416.691) (-417.585) (-415.331) * (-416.968) (-418.519) [-416.569] (-416.935) -- 0:00:22

      Average standard deviation of split frequencies: 0.006428

      630500 -- (-415.455) (-415.981) (-415.904) [-420.052] * (-416.503) [-415.877] (-416.523) (-418.234) -- 0:00:22
      631000 -- (-415.056) (-415.807) [-417.316] (-416.950) * [-417.655] (-417.799) (-417.130) (-419.015) -- 0:00:22
      631500 -- (-419.670) (-419.306) [-418.941] (-416.374) * [-415.095] (-415.109) (-418.762) (-416.219) -- 0:00:22
      632000 -- (-421.224) (-418.341) [-418.519] (-415.869) * (-417.108) [-415.711] (-416.210) (-416.193) -- 0:00:22
      632500 -- (-416.084) (-418.947) (-423.473) [-416.343] * (-417.031) (-425.784) [-416.801] (-418.057) -- 0:00:22
      633000 -- (-418.809) (-420.611) (-417.284) [-421.459] * (-416.465) [-414.994] (-416.772) (-415.393) -- 0:00:22
      633500 -- (-420.801) [-417.080] (-416.838) (-416.291) * [-418.123] (-418.800) (-420.221) (-414.642) -- 0:00:21
      634000 -- [-416.260] (-417.903) (-415.573) (-415.879) * (-416.886) (-416.808) (-417.398) [-414.973] -- 0:00:21
      634500 -- (-414.935) (-417.766) (-415.857) [-414.679] * (-417.598) [-421.271] (-418.070) (-416.628) -- 0:00:21
      635000 -- [-416.044] (-417.359) (-417.213) (-416.645) * [-416.390] (-415.664) (-416.020) (-416.674) -- 0:00:21

      Average standard deviation of split frequencies: 0.006770

      635500 -- (-417.013) [-414.747] (-421.776) (-420.363) * (-416.871) [-415.522] (-417.787) (-416.714) -- 0:00:21
      636000 -- [-416.879] (-420.039) (-416.357) (-415.564) * (-416.277) [-415.967] (-416.149) (-417.719) -- 0:00:21
      636500 -- (-419.539) (-418.217) [-418.208] (-416.146) * (-417.653) (-416.640) (-417.990) [-415.655] -- 0:00:21
      637000 -- (-417.871) (-418.232) [-416.516] (-416.014) * (-416.467) [-416.414] (-418.140) (-415.802) -- 0:00:21
      637500 -- [-417.262] (-416.369) (-416.076) (-416.379) * (-416.090) [-415.952] (-415.329) (-414.699) -- 0:00:22
      638000 -- [-414.884] (-418.021) (-416.874) (-416.554) * (-415.959) (-417.238) (-414.597) [-414.577] -- 0:00:22
      638500 -- (-415.564) (-417.453) [-415.189] (-414.776) * (-415.980) (-417.002) [-415.682] (-416.898) -- 0:00:22
      639000 -- (-417.474) (-416.100) [-416.230] (-418.633) * [-415.231] (-418.604) (-414.473) (-416.793) -- 0:00:22
      639500 -- (-414.524) (-415.765) (-415.256) [-415.907] * [-417.533] (-416.238) (-418.742) (-416.854) -- 0:00:21
      640000 -- (-417.619) [-418.072] (-416.536) (-415.929) * (-416.192) (-418.479) [-416.677] (-415.603) -- 0:00:21

      Average standard deviation of split frequencies: 0.006867

      640500 -- (-419.789) [-416.416] (-417.664) (-418.610) * (-417.909) (-417.893) (-417.538) [-415.091] -- 0:00:21
      641000 -- (-422.878) [-415.379] (-417.515) (-415.586) * (-416.749) [-417.192] (-420.411) (-415.764) -- 0:00:21
      641500 -- (-419.843) (-417.958) (-419.324) [-414.869] * (-415.739) (-420.560) (-420.671) [-416.844] -- 0:00:21
      642000 -- (-417.298) (-414.703) (-415.896) [-416.897] * (-417.942) [-414.949] (-416.644) (-416.997) -- 0:00:21
      642500 -- [-418.017] (-418.781) (-419.213) (-417.696) * [-416.202] (-416.402) (-417.198) (-418.015) -- 0:00:21
      643000 -- (-418.104) [-416.384] (-415.044) (-415.584) * [-414.965] (-418.219) (-420.383) (-417.582) -- 0:00:21
      643500 -- (-422.967) [-415.170] (-414.948) (-416.641) * (-417.107) (-417.227) [-417.468] (-420.257) -- 0:00:21
      644000 -- (-418.390) (-415.514) [-416.173] (-420.875) * (-423.881) [-421.375] (-416.409) (-417.790) -- 0:00:21
      644500 -- (-417.356) [-415.091] (-415.240) (-415.106) * (-415.832) (-417.401) (-416.379) [-416.813] -- 0:00:21
      645000 -- [-417.354] (-415.767) (-417.143) (-417.757) * [-420.042] (-416.786) (-415.140) (-416.894) -- 0:00:21

      Average standard deviation of split frequencies: 0.007103

      645500 -- [-415.202] (-415.935) (-416.320) (-416.057) * (-417.899) [-419.661] (-419.837) (-416.876) -- 0:00:21
      646000 -- (-415.984) (-417.956) (-416.787) [-416.828] * (-416.256) (-416.308) [-415.359] (-416.929) -- 0:00:21
      646500 -- (-417.058) [-415.541] (-417.021) (-416.325) * (-415.885) (-418.468) (-416.097) [-415.359] -- 0:00:21
      647000 -- (-416.669) (-415.407) [-417.452] (-419.007) * [-417.804] (-415.281) (-420.891) (-417.656) -- 0:00:21
      647500 -- (-416.282) (-421.264) [-417.198] (-420.871) * (-415.248) (-415.245) (-420.652) [-416.905] -- 0:00:21
      648000 -- (-416.506) [-418.319] (-422.403) (-414.895) * (-418.163) (-417.147) (-417.471) [-420.145] -- 0:00:21
      648500 -- (-414.858) [-416.388] (-415.270) (-416.023) * (-418.573) (-416.228) [-416.053] (-417.447) -- 0:00:21
      649000 -- (-416.104) (-418.023) (-415.500) [-415.013] * [-415.800] (-415.861) (-416.756) (-419.252) -- 0:00:21
      649500 -- (-415.041) (-417.603) (-416.030) [-417.741] * (-414.654) (-418.093) (-417.132) [-419.932] -- 0:00:21
      650000 -- [-415.687] (-416.518) (-417.546) (-419.266) * [-415.587] (-423.198) (-418.701) (-417.504) -- 0:00:21

      Average standard deviation of split frequencies: 0.006810

      650500 -- (-416.485) [-418.781] (-417.122) (-417.125) * (-415.966) [-418.080] (-416.947) (-418.398) -- 0:00:20
      651000 -- [-417.929] (-417.538) (-419.486) (-418.095) * (-416.378) [-417.911] (-416.750) (-416.286) -- 0:00:20
      651500 -- (-417.126) [-416.864] (-417.241) (-415.304) * [-415.774] (-418.757) (-416.968) (-418.603) -- 0:00:20
      652000 -- [-416.918] (-415.913) (-415.246) (-416.768) * (-416.077) [-419.017] (-421.793) (-415.185) -- 0:00:20
      652500 -- (-426.036) (-416.767) (-415.077) [-417.914] * (-416.929) (-415.345) (-415.933) [-415.764] -- 0:00:20
      653000 -- (-417.954) (-416.358) (-415.492) [-418.287] * [-419.394] (-416.021) (-417.994) (-416.310) -- 0:00:20
      653500 -- (-415.593) (-416.114) [-416.115] (-417.020) * (-416.415) [-416.884] (-418.189) (-415.416) -- 0:00:20
      654000 -- (-415.973) (-417.033) (-417.075) [-416.939] * [-416.355] (-417.225) (-418.134) (-415.037) -- 0:00:21
      654500 -- (-414.906) (-417.567) [-417.323] (-418.452) * (-417.438) (-415.741) (-416.176) [-415.672] -- 0:00:21
      655000 -- (-414.601) (-416.017) [-417.699] (-418.190) * (-419.452) (-415.762) (-415.111) [-417.570] -- 0:00:21

      Average standard deviation of split frequencies: 0.006803

      655500 -- (-414.591) (-418.106) (-415.244) [-416.719] * (-416.922) (-418.747) [-414.774] (-416.782) -- 0:00:21
      656000 -- (-416.560) (-418.286) (-415.018) [-414.689] * (-417.069) (-418.609) (-418.806) [-417.640] -- 0:00:20
      656500 -- (-418.306) (-420.106) (-416.335) [-416.909] * (-416.682) [-416.335] (-415.212) (-415.291) -- 0:00:20
      657000 -- (-421.599) [-422.030] (-417.238) (-416.636) * [-418.337] (-418.465) (-417.735) (-418.859) -- 0:00:20
      657500 -- (-417.117) (-419.316) [-415.199] (-416.514) * (-419.213) (-419.339) (-415.848) [-417.652] -- 0:00:20
      658000 -- (-419.552) [-416.087] (-414.501) (-419.369) * [-416.031] (-421.413) (-415.487) (-417.267) -- 0:00:20
      658500 -- (-417.376) [-418.561] (-417.734) (-419.988) * (-419.388) [-418.070] (-417.312) (-415.008) -- 0:00:20
      659000 -- (-418.213) [-416.133] (-417.468) (-417.687) * (-416.756) (-418.600) [-415.308] (-414.862) -- 0:00:20
      659500 -- (-420.877) [-416.508] (-418.019) (-418.915) * (-416.150) [-414.947] (-420.011) (-414.746) -- 0:00:20
      660000 -- (-417.244) (-415.475) (-416.057) [-417.686] * [-415.788] (-415.058) (-418.965) (-416.061) -- 0:00:20

      Average standard deviation of split frequencies: 0.006517

      660500 -- (-416.362) [-415.530] (-417.116) (-419.014) * [-414.478] (-420.100) (-415.435) (-417.578) -- 0:00:20
      661000 -- (-415.221) (-417.762) (-415.821) [-415.325] * (-419.186) (-414.919) (-416.906) [-420.416] -- 0:00:20
      661500 -- (-414.656) [-417.299] (-421.998) (-421.820) * (-415.862) [-415.405] (-420.183) (-418.537) -- 0:00:20
      662000 -- (-415.602) (-420.452) [-416.787] (-419.606) * (-416.045) (-418.549) [-415.888] (-423.353) -- 0:00:20
      662500 -- (-415.026) (-416.636) [-414.491] (-418.346) * (-416.536) (-416.871) [-417.060] (-417.763) -- 0:00:20
      663000 -- [-415.860] (-414.557) (-414.590) (-415.985) * [-415.848] (-415.911) (-421.598) (-416.341) -- 0:00:20
      663500 -- (-416.833) (-415.960) (-415.829) [-415.433] * (-414.957) [-414.602] (-419.555) (-416.352) -- 0:00:20
      664000 -- [-415.669] (-416.915) (-423.897) (-415.680) * (-417.871) (-417.581) (-419.059) [-415.666] -- 0:00:20
      664500 -- (-416.074) (-419.946) (-424.514) [-417.627] * (-415.989) (-421.075) [-416.427] (-415.705) -- 0:00:20
      665000 -- [-415.065] (-418.089) (-417.911) (-416.130) * (-420.471) (-421.583) [-415.317] (-417.115) -- 0:00:20

      Average standard deviation of split frequencies: 0.006937

      665500 -- [-415.097] (-420.005) (-420.208) (-420.621) * [-415.325] (-417.957) (-415.934) (-418.163) -- 0:00:20
      666000 -- (-415.362) [-418.992] (-418.185) (-419.992) * [-415.017] (-415.859) (-417.245) (-417.014) -- 0:00:20
      666500 -- (-415.285) [-417.719] (-417.158) (-418.177) * [-416.309] (-415.270) (-418.792) (-416.753) -- 0:00:20
      667000 -- (-416.733) (-416.174) [-416.353] (-418.405) * [-416.462] (-415.395) (-414.821) (-417.032) -- 0:00:19
      667500 -- (-417.387) (-417.652) (-415.150) [-414.864] * (-415.510) [-417.230] (-421.579) (-415.778) -- 0:00:19
      668000 -- [-415.880] (-417.180) (-416.776) (-417.555) * (-414.674) (-418.013) (-415.861) [-415.061] -- 0:00:19
      668500 -- [-418.143] (-416.984) (-416.542) (-419.357) * (-414.614) [-418.894] (-417.231) (-416.291) -- 0:00:19
      669000 -- (-418.120) (-415.855) (-417.480) [-422.100] * (-417.527) (-417.948) [-419.764] (-417.367) -- 0:00:19
      669500 -- [-417.074] (-417.605) (-416.732) (-422.466) * (-417.261) [-419.791] (-415.174) (-414.961) -- 0:00:20
      670000 -- (-418.707) (-416.138) [-417.727] (-415.729) * (-417.020) [-419.293] (-416.044) (-420.677) -- 0:00:20

      Average standard deviation of split frequencies: 0.006607

      670500 -- (-418.895) [-417.940] (-421.445) (-416.987) * (-416.224) (-415.737) [-417.386] (-416.872) -- 0:00:20
      671000 -- (-420.411) (-419.719) [-415.462] (-415.163) * (-420.501) (-416.732) (-415.878) [-417.545] -- 0:00:20
      671500 -- (-415.051) (-416.374) (-420.267) [-415.815] * (-417.017) [-416.154] (-415.983) (-414.888) -- 0:00:20
      672000 -- (-415.196) (-417.357) (-416.718) [-417.901] * [-418.907] (-415.614) (-417.400) (-418.579) -- 0:00:20
      672500 -- (-417.258) (-415.860) (-420.149) [-418.338] * (-416.028) [-414.760] (-419.683) (-421.290) -- 0:00:19
      673000 -- [-417.359] (-414.873) (-420.025) (-416.482) * (-418.691) [-415.481] (-417.696) (-417.143) -- 0:00:19
      673500 -- [-416.372] (-415.600) (-418.097) (-415.483) * [-415.898] (-419.853) (-415.717) (-416.722) -- 0:00:19
      674000 -- (-419.763) (-416.215) (-415.257) [-417.639] * (-415.549) [-422.185] (-416.705) (-422.828) -- 0:00:19
      674500 -- [-415.550] (-416.099) (-416.887) (-415.483) * (-420.994) (-418.465) [-415.193] (-415.191) -- 0:00:19
      675000 -- (-417.617) [-418.573] (-417.173) (-417.814) * (-415.969) [-416.156] (-419.729) (-421.847) -- 0:00:19

      Average standard deviation of split frequencies: 0.006323

      675500 -- [-415.867] (-419.578) (-415.680) (-417.209) * [-416.329] (-416.667) (-418.445) (-415.633) -- 0:00:19
      676000 -- (-416.374) (-418.878) [-416.044] (-421.706) * (-422.885) (-422.853) [-416.927] (-414.944) -- 0:00:19
      676500 -- (-418.275) (-417.241) [-418.184] (-424.181) * [-416.444] (-418.231) (-419.637) (-415.486) -- 0:00:19
      677000 -- (-416.297) (-418.017) (-417.354) [-417.478] * (-417.824) (-417.733) [-416.515] (-415.471) -- 0:00:19
      677500 -- (-418.326) [-419.096] (-416.469) (-417.645) * (-419.277) (-416.058) [-415.488] (-419.133) -- 0:00:19
      678000 -- (-416.586) (-417.156) [-417.748] (-416.262) * [-415.821] (-414.857) (-415.383) (-421.212) -- 0:00:19
      678500 -- [-416.669] (-416.954) (-417.458) (-416.382) * (-417.218) (-417.244) (-415.260) [-416.341] -- 0:00:19
      679000 -- (-415.700) [-420.119] (-416.492) (-417.601) * [-417.971] (-416.226) (-415.627) (-417.021) -- 0:00:19
      679500 -- (-418.181) (-419.382) [-416.923] (-420.931) * [-416.223] (-415.812) (-415.869) (-416.442) -- 0:00:19
      680000 -- (-417.726) [-419.965] (-415.125) (-415.462) * (-418.643) (-417.199) (-415.287) [-415.790] -- 0:00:19

      Average standard deviation of split frequencies: 0.006418

      680500 -- (-417.508) (-417.019) [-417.178] (-415.139) * (-416.898) [-418.506] (-416.662) (-418.766) -- 0:00:19
      681000 -- (-417.982) [-416.152] (-415.919) (-415.822) * (-419.148) (-420.733) [-416.700] (-415.291) -- 0:00:19
      681500 -- (-416.749) (-416.141) [-417.332] (-416.507) * (-415.794) (-416.695) (-416.279) [-415.517] -- 0:00:19
      682000 -- [-416.896] (-416.848) (-417.176) (-421.179) * [-416.126] (-416.971) (-419.902) (-417.623) -- 0:00:19
      682500 -- (-416.793) [-418.098] (-418.622) (-415.495) * (-416.526) [-418.691] (-415.752) (-420.541) -- 0:00:19
      683000 -- (-415.758) (-418.168) [-414.713] (-416.331) * (-420.347) (-418.976) (-415.873) [-415.937] -- 0:00:19
      683500 -- (-416.542) [-414.842] (-414.947) (-416.399) * (-418.108) (-418.973) [-418.261] (-417.315) -- 0:00:18
      684000 -- [-420.758] (-415.671) (-416.256) (-418.407) * [-416.681] (-418.170) (-418.158) (-418.541) -- 0:00:18
      684500 -- (-417.341) (-416.145) (-414.759) [-416.003] * (-419.558) [-417.633] (-421.633) (-418.639) -- 0:00:19
      685000 -- [-415.951] (-416.116) (-419.174) (-415.826) * (-414.764) (-416.233) [-417.429] (-415.772) -- 0:00:19

      Average standard deviation of split frequencies: 0.006826

      685500 -- (-418.949) (-416.187) (-422.300) [-417.861] * (-415.873) (-416.893) [-415.049] (-420.227) -- 0:00:19
      686000 -- (-416.425) [-416.879] (-415.492) (-416.604) * (-416.642) (-415.362) (-414.796) [-416.630] -- 0:00:19
      686500 -- [-417.181] (-415.851) (-415.833) (-417.085) * (-415.320) [-416.332] (-415.720) (-415.797) -- 0:00:19
      687000 -- (-421.601) (-417.384) [-414.925] (-417.893) * (-414.928) [-416.195] (-415.945) (-415.729) -- 0:00:19
      687500 -- (-415.015) (-420.536) [-415.429] (-417.506) * (-417.258) [-416.744] (-415.491) (-420.139) -- 0:00:19
      688000 -- (-416.196) [-415.817] (-417.952) (-418.578) * (-415.961) (-420.884) (-417.646) [-423.026] -- 0:00:19
      688500 -- (-416.817) (-414.847) (-419.472) [-414.966] * (-421.987) [-415.151] (-418.275) (-420.829) -- 0:00:19
      689000 -- (-417.525) (-415.198) (-415.833) [-415.488] * [-418.047] (-414.826) (-417.255) (-420.894) -- 0:00:18
      689500 -- (-417.152) (-418.622) [-417.325] (-416.038) * [-415.143] (-419.517) (-415.466) (-416.975) -- 0:00:18
      690000 -- (-420.343) [-416.114] (-417.713) (-417.136) * (-415.019) [-417.924] (-415.328) (-416.236) -- 0:00:18

      Average standard deviation of split frequencies: 0.007371

      690500 -- (-415.953) (-415.466) (-418.519) [-416.968] * (-416.160) (-418.160) (-414.968) [-419.895] -- 0:00:18
      691000 -- (-423.277) (-415.546) (-415.190) [-418.036] * [-418.090] (-415.623) (-416.534) (-415.134) -- 0:00:18
      691500 -- (-424.458) (-425.908) [-416.160] (-415.393) * (-416.662) (-415.677) [-414.982] (-417.117) -- 0:00:18
      692000 -- (-417.517) [-415.574] (-418.941) (-416.489) * (-415.057) (-416.313) (-416.517) [-416.237] -- 0:00:18
      692500 -- (-417.696) [-416.229] (-420.491) (-416.819) * [-415.781] (-421.252) (-417.861) (-421.420) -- 0:00:18
      693000 -- (-415.811) (-417.045) (-415.851) [-418.343] * (-415.329) (-418.603) (-417.487) [-419.873] -- 0:00:18
      693500 -- [-415.194] (-416.319) (-416.681) (-419.031) * [-416.084] (-417.980) (-415.419) (-418.182) -- 0:00:18
      694000 -- (-420.981) [-417.547] (-417.988) (-420.094) * (-422.780) [-416.763] (-416.678) (-415.503) -- 0:00:18
      694500 -- (-418.829) (-419.262) (-416.170) [-414.930] * [-415.658] (-416.508) (-418.111) (-416.501) -- 0:00:18
      695000 -- (-416.054) (-419.431) [-415.093] (-415.445) * (-415.276) (-422.183) [-415.443] (-417.472) -- 0:00:18

      Average standard deviation of split frequencies: 0.007496

      695500 -- (-424.640) [-418.256] (-416.418) (-417.966) * (-415.549) [-416.222] (-416.305) (-416.011) -- 0:00:18
      696000 -- (-416.666) (-419.322) [-418.724] (-421.193) * (-416.299) (-416.356) (-416.332) [-418.024] -- 0:00:18
      696500 -- (-416.410) (-419.323) (-415.430) [-414.699] * (-417.833) [-417.070] (-416.361) (-416.125) -- 0:00:18
      697000 -- [-418.067] (-418.736) (-415.221) (-421.185) * [-415.981] (-418.036) (-420.790) (-415.678) -- 0:00:18
      697500 -- (-415.823) [-417.763] (-414.566) (-417.307) * [-417.772] (-420.641) (-418.766) (-416.392) -- 0:00:18
      698000 -- (-416.429) (-417.494) [-421.856] (-417.742) * (-415.029) (-418.261) [-416.448] (-419.966) -- 0:00:18
      698500 -- (-416.662) (-416.327) [-416.210] (-416.263) * [-416.256] (-418.705) (-418.749) (-420.856) -- 0:00:18
      699000 -- [-417.768] (-419.495) (-415.046) (-416.589) * (-415.312) [-415.534] (-419.948) (-419.309) -- 0:00:18
      699500 -- (-420.535) [-415.383] (-414.897) (-418.541) * (-415.786) (-417.354) [-415.574] (-417.280) -- 0:00:18
      700000 -- (-416.425) (-416.769) [-418.672] (-421.271) * (-416.032) (-417.531) [-416.443] (-415.694) -- 0:00:18

      Average standard deviation of split frequencies: 0.008074

      700500 -- [-416.521] (-414.764) (-420.670) (-418.281) * [-418.869] (-419.718) (-417.073) (-417.730) -- 0:00:18
      701000 -- (-415.987) (-415.576) (-417.496) [-418.091] * (-418.978) (-422.021) (-420.798) [-417.036] -- 0:00:18
      701500 -- (-414.569) (-415.451) [-416.843] (-417.434) * [-416.707] (-421.699) (-415.268) (-419.940) -- 0:00:18
      702000 -- (-417.769) (-420.166) (-418.861) [-416.707] * [-417.964] (-416.518) (-417.417) (-415.850) -- 0:00:18
      702500 -- (-417.923) [-417.262] (-415.064) (-415.568) * (-418.165) [-417.584] (-415.946) (-418.483) -- 0:00:18
      703000 -- [-415.213] (-416.265) (-418.060) (-419.677) * (-414.914) (-418.708) [-416.628] (-417.422) -- 0:00:18
      703500 -- [-417.674] (-416.485) (-415.398) (-417.368) * [-415.737] (-421.349) (-417.225) (-416.415) -- 0:00:18
      704000 -- [-416.005] (-417.039) (-415.342) (-417.065) * (-415.520) (-417.790) [-417.901] (-419.359) -- 0:00:18
      704500 -- (-417.573) (-415.695) (-416.400) [-419.676] * [-418.342] (-415.615) (-415.794) (-420.203) -- 0:00:18
      705000 -- (-417.791) [-416.122] (-415.819) (-420.218) * [-418.306] (-418.170) (-416.593) (-417.073) -- 0:00:17

      Average standard deviation of split frequencies: 0.008858

      705500 -- [-415.228] (-418.236) (-416.448) (-416.840) * [-417.656] (-415.198) (-415.896) (-420.455) -- 0:00:17
      706000 -- (-416.341) (-418.226) (-419.570) [-416.678] * (-417.010) (-417.397) [-418.865] (-419.379) -- 0:00:17
      706500 -- [-418.220] (-419.355) (-415.209) (-416.320) * (-416.604) (-416.703) (-416.349) [-415.340] -- 0:00:17
      707000 -- (-420.481) (-415.721) [-418.812] (-415.777) * (-418.161) (-414.583) (-417.475) [-414.699] -- 0:00:17
      707500 -- [-421.186] (-415.057) (-415.827) (-416.896) * (-416.061) [-416.012] (-417.736) (-415.876) -- 0:00:17
      708000 -- (-415.480) [-415.198] (-420.326) (-417.427) * [-418.203] (-418.744) (-417.370) (-420.939) -- 0:00:17
      708500 -- (-415.583) (-415.550) [-415.050] (-420.085) * [-416.769] (-416.697) (-416.452) (-417.682) -- 0:00:17
      709000 -- (-415.981) [-417.010] (-416.962) (-419.807) * (-416.913) (-419.148) (-417.250) [-415.208] -- 0:00:17
      709500 -- (-416.572) (-418.941) (-416.042) [-418.748] * [-416.898] (-417.684) (-415.024) (-416.035) -- 0:00:17
      710000 -- (-419.257) [-419.011] (-415.324) (-421.504) * (-417.308) [-415.555] (-417.333) (-416.268) -- 0:00:17

      Average standard deviation of split frequencies: 0.008844

      710500 -- (-418.070) (-422.434) [-415.845] (-415.727) * (-416.611) (-420.685) (-415.756) [-414.903] -- 0:00:17
      711000 -- [-415.851] (-415.917) (-414.828) (-419.647) * [-418.343] (-418.511) (-416.466) (-416.833) -- 0:00:17
      711500 -- (-416.802) (-415.514) (-415.054) [-417.496] * (-419.719) (-418.721) (-416.186) [-416.762] -- 0:00:17
      712000 -- [-421.494] (-415.057) (-417.058) (-416.510) * [-416.233] (-416.766) (-419.500) (-417.783) -- 0:00:17
      712500 -- (-417.151) (-416.390) (-416.215) [-416.986] * (-416.807) (-417.082) (-419.250) [-416.170] -- 0:00:17
      713000 -- (-417.384) [-415.208] (-415.798) (-416.786) * (-417.332) (-417.107) [-416.029] (-416.813) -- 0:00:17
      713500 -- (-419.144) (-415.828) (-415.395) [-418.913] * (-416.949) (-416.652) [-415.321] (-416.392) -- 0:00:17
      714000 -- (-415.485) [-419.318] (-418.399) (-417.007) * (-416.212) [-417.258] (-418.124) (-417.764) -- 0:00:17
      714500 -- [-416.392] (-416.985) (-417.747) (-415.622) * [-415.888] (-418.209) (-414.940) (-418.147) -- 0:00:17
      715000 -- (-415.116) [-417.407] (-417.360) (-416.769) * [-415.309] (-415.701) (-415.790) (-416.717) -- 0:00:17

      Average standard deviation of split frequencies: 0.009130

      715500 -- (-420.514) (-417.594) (-418.628) [-415.832] * [-416.584] (-414.695) (-417.701) (-416.013) -- 0:00:17
      716000 -- (-415.854) (-417.103) [-415.754] (-419.387) * (-419.353) (-421.561) (-417.963) [-420.572] -- 0:00:17
      716500 -- (-416.062) (-418.280) (-415.098) [-417.572] * (-418.578) [-417.697] (-414.446) (-419.831) -- 0:00:17
      717000 -- (-416.077) (-415.392) (-418.121) [-416.455] * (-417.740) (-417.036) [-415.776] (-415.152) -- 0:00:17
      717500 -- [-416.311] (-416.021) (-417.485) (-415.491) * (-418.106) (-419.671) [-416.018] (-418.322) -- 0:00:17
      718000 -- (-416.908) [-417.337] (-416.880) (-416.141) * (-417.939) (-418.406) [-416.960] (-422.745) -- 0:00:17
      718500 -- (-417.039) [-417.512] (-417.620) (-415.749) * [-418.493] (-422.666) (-416.238) (-418.085) -- 0:00:17
      719000 -- (-417.468) [-418.097] (-414.840) (-415.338) * (-416.424) (-415.724) [-418.550] (-417.341) -- 0:00:17
      719500 -- (-417.235) [-422.334] (-415.988) (-417.128) * (-415.964) [-414.752] (-417.374) (-415.800) -- 0:00:17
      720000 -- (-417.486) (-417.490) [-414.871] (-415.540) * [-418.508] (-415.918) (-416.258) (-417.259) -- 0:00:17

      Average standard deviation of split frequencies: 0.008678

      720500 -- [-417.141] (-418.245) (-415.023) (-415.463) * (-416.507) (-420.394) (-417.114) [-415.285] -- 0:00:17
      721000 -- (-416.913) [-415.445] (-417.562) (-415.665) * (-416.586) (-420.633) (-418.081) [-414.795] -- 0:00:17
      721500 -- (-418.507) [-415.084] (-416.522) (-418.696) * (-418.963) [-420.634] (-415.981) (-414.989) -- 0:00:16
      722000 -- (-418.347) (-415.044) (-417.604) [-416.864] * [-426.430] (-419.827) (-420.851) (-418.120) -- 0:00:16
      722500 -- [-416.859] (-416.657) (-416.356) (-420.418) * [-423.262] (-415.304) (-416.264) (-415.655) -- 0:00:16
      723000 -- [-415.155] (-418.904) (-418.099) (-416.931) * (-419.805) [-415.262] (-420.719) (-418.072) -- 0:00:16
      723500 -- (-418.116) [-415.274] (-418.840) (-416.989) * [-416.604] (-416.826) (-418.147) (-416.687) -- 0:00:16
      724000 -- (-417.717) (-421.638) (-415.563) [-415.184] * (-418.363) (-416.142) (-416.508) [-414.663] -- 0:00:16
      724500 -- (-420.193) (-423.307) [-415.604] (-414.786) * (-417.644) (-415.256) [-415.795] (-415.428) -- 0:00:16
      725000 -- [-417.397] (-419.470) (-418.229) (-416.189) * (-416.616) [-415.841] (-418.747) (-417.910) -- 0:00:16

      Average standard deviation of split frequencies: 0.008268

      725500 -- (-419.010) (-419.272) [-418.822] (-415.298) * (-416.372) (-418.053) (-418.579) [-421.016] -- 0:00:16
      726000 -- (-419.910) (-414.525) [-418.245] (-415.656) * [-415.312] (-417.112) (-415.956) (-421.557) -- 0:00:16
      726500 -- (-417.419) [-416.679] (-415.032) (-418.660) * (-416.867) (-417.263) [-416.297] (-420.230) -- 0:00:16
      727000 -- (-416.295) (-415.103) (-415.999) [-415.542] * (-417.076) (-419.021) [-415.985] (-419.544) -- 0:00:16
      727500 -- [-416.904] (-415.795) (-420.520) (-414.823) * (-419.038) (-415.878) (-416.571) [-415.879] -- 0:00:16
      728000 -- (-419.353) (-420.091) (-417.474) [-415.272] * (-416.201) [-415.052] (-418.020) (-416.279) -- 0:00:16
      728500 -- (-418.224) (-420.217) [-418.046] (-418.094) * (-415.981) (-415.525) (-418.794) [-415.441] -- 0:00:16
      729000 -- (-417.661) [-418.079] (-416.029) (-417.685) * (-419.723) [-416.492] (-415.371) (-415.972) -- 0:00:16
      729500 -- (-418.642) (-415.616) [-416.685] (-419.872) * (-417.945) (-416.707) [-414.834] (-417.394) -- 0:00:16
      730000 -- (-417.885) (-416.742) [-415.687] (-415.001) * (-418.453) [-417.886] (-415.002) (-416.507) -- 0:00:16

      Average standard deviation of split frequencies: 0.008344

      730500 -- (-417.406) (-415.998) (-416.008) [-415.113] * (-416.123) (-420.725) [-415.947] (-416.305) -- 0:00:16
      731000 -- [-417.369] (-415.220) (-418.053) (-420.263) * [-417.834] (-417.298) (-422.803) (-417.084) -- 0:00:16
      731500 -- (-418.996) (-418.147) [-416.704] (-416.790) * (-415.158) [-414.933] (-415.783) (-415.018) -- 0:00:16
      732000 -- [-415.813] (-416.288) (-417.997) (-416.382) * (-415.285) [-416.426] (-414.964) (-417.432) -- 0:00:16
      732500 -- (-420.496) (-416.006) (-418.666) [-417.583] * (-416.236) [-417.770] (-415.992) (-415.299) -- 0:00:16
      733000 -- [-416.636] (-417.487) (-417.008) (-418.840) * (-414.787) [-417.632] (-416.524) (-416.253) -- 0:00:16
      733500 -- (-417.738) (-421.376) [-416.722] (-417.210) * [-418.240] (-417.536) (-416.378) (-416.363) -- 0:00:16
      734000 -- (-416.257) (-416.093) (-417.759) [-422.495] * [-415.098] (-421.484) (-416.542) (-416.860) -- 0:00:16
      734500 -- (-417.488) [-416.063] (-417.764) (-417.101) * (-417.357) [-418.040] (-414.540) (-415.970) -- 0:00:16
      735000 -- (-416.565) (-415.195) [-420.509] (-418.629) * (-415.323) (-418.700) [-415.039] (-415.383) -- 0:00:16

      Average standard deviation of split frequencies: 0.008070

      735500 -- (-414.804) (-419.048) [-416.182] (-416.275) * (-415.732) (-415.966) [-416.812] (-415.495) -- 0:00:16
      736000 -- (-415.548) (-418.367) (-416.058) [-416.929] * (-417.041) [-415.428] (-419.938) (-418.140) -- 0:00:16
      736500 -- [-416.624] (-417.811) (-416.960) (-418.885) * (-417.174) [-415.883] (-417.911) (-418.827) -- 0:00:16
      737000 -- (-423.622) [-419.232] (-414.867) (-417.571) * (-417.277) (-415.601) [-417.396] (-415.617) -- 0:00:16
      737500 -- (-420.118) (-417.213) (-414.827) [-415.883] * (-415.706) [-416.698] (-417.546) (-416.592) -- 0:00:16
      738000 -- (-416.255) (-415.136) [-416.905] (-415.991) * [-416.746] (-417.771) (-416.419) (-415.218) -- 0:00:15
      738500 -- (-421.147) (-415.625) [-417.884] (-420.098) * (-418.224) (-418.156) (-415.121) [-418.035] -- 0:00:15
      739000 -- (-417.352) [-414.919] (-414.981) (-415.605) * [-417.341] (-418.320) (-416.821) (-422.206) -- 0:00:15
      739500 -- [-416.516] (-416.057) (-420.245) (-416.562) * [-422.211] (-416.935) (-417.177) (-418.181) -- 0:00:15
      740000 -- (-417.822) (-416.452) [-416.262] (-415.560) * [-416.025] (-416.278) (-417.167) (-416.417) -- 0:00:15

      Average standard deviation of split frequencies: 0.008019

      740500 -- (-415.013) (-417.581) [-418.292] (-419.921) * (-416.465) (-420.502) [-415.518] (-416.234) -- 0:00:15
      741000 -- (-418.271) (-417.458) (-417.478) [-421.780] * (-415.342) (-421.073) [-415.920] (-417.867) -- 0:00:15
      741500 -- (-419.231) (-419.138) (-416.479) [-417.831] * [-417.026] (-415.766) (-415.421) (-416.299) -- 0:00:15
      742000 -- [-419.093] (-418.004) (-415.693) (-416.536) * [-415.123] (-414.943) (-415.176) (-415.437) -- 0:00:15
      742500 -- (-417.351) [-418.330] (-420.579) (-418.428) * (-419.309) (-415.844) (-419.416) [-415.183] -- 0:00:15
      743000 -- (-418.492) (-416.959) [-418.532] (-417.737) * (-418.550) (-416.540) [-417.555] (-419.267) -- 0:00:15
      743500 -- [-416.849] (-417.347) (-416.661) (-423.287) * (-420.531) [-415.438] (-416.129) (-418.963) -- 0:00:15
      744000 -- (-417.223) [-414.997] (-418.805) (-416.747) * (-419.594) [-416.983] (-415.337) (-416.280) -- 0:00:15
      744500 -- (-417.834) (-415.555) [-420.228] (-419.435) * (-416.260) (-416.229) (-415.950) [-416.735] -- 0:00:15
      745000 -- (-416.825) (-415.139) (-417.863) [-416.438] * (-415.495) (-416.209) [-417.788] (-414.963) -- 0:00:15

      Average standard deviation of split frequencies: 0.007667

      745500 -- (-416.451) (-415.380) (-422.135) [-416.784] * [-416.753] (-416.452) (-416.710) (-420.049) -- 0:00:15
      746000 -- (-418.125) [-420.119] (-418.692) (-419.876) * [-419.049] (-419.497) (-416.496) (-419.453) -- 0:00:15
      746500 -- (-416.954) (-417.216) [-417.923] (-419.990) * (-416.614) (-420.676) [-424.548] (-419.816) -- 0:00:15
      747000 -- (-418.910) [-417.344] (-417.122) (-423.223) * [-417.709] (-416.143) (-417.346) (-417.968) -- 0:00:15
      747500 -- [-418.123] (-419.029) (-416.601) (-417.483) * (-415.117) (-416.231) [-414.680] (-415.738) -- 0:00:15
      748000 -- (-417.879) (-415.636) (-419.426) [-414.788] * [-415.770] (-414.910) (-416.640) (-419.776) -- 0:00:15
      748500 -- (-415.395) [-417.132] (-417.871) (-416.628) * (-415.618) [-418.879] (-416.586) (-419.475) -- 0:00:15
      749000 -- (-418.842) [-417.420] (-416.000) (-414.596) * (-416.829) (-417.194) [-415.164] (-415.048) -- 0:00:15
      749500 -- (-416.907) (-417.007) (-417.826) [-415.348] * (-416.137) (-416.970) [-416.979] (-416.104) -- 0:00:15
      750000 -- [-416.573] (-420.365) (-417.000) (-415.271) * (-420.686) (-420.683) [-416.890] (-417.126) -- 0:00:15

      Average standard deviation of split frequencies: 0.007913

      750500 -- (-416.781) [-415.374] (-415.833) (-416.227) * [-416.695] (-417.502) (-418.302) (-417.338) -- 0:00:15
      751000 -- (-416.206) (-415.094) [-415.403] (-414.916) * (-416.633) (-416.537) (-422.003) [-416.166] -- 0:00:15
      751500 -- (-417.198) [-416.834] (-416.074) (-415.734) * (-414.918) [-415.960] (-416.350) (-417.497) -- 0:00:15
      752000 -- (-417.702) (-417.795) [-415.695] (-416.266) * (-416.373) (-418.311) [-414.716] (-421.178) -- 0:00:15
      752500 -- (-417.562) (-415.666) [-414.850] (-417.339) * [-416.667] (-417.356) (-421.779) (-419.650) -- 0:00:15
      753000 -- [-416.333] (-415.070) (-417.922) (-416.778) * (-415.728) [-419.025] (-415.377) (-416.402) -- 0:00:15
      753500 -- (-415.705) (-416.036) (-420.713) [-417.668] * [-416.494] (-417.612) (-417.799) (-414.826) -- 0:00:15
      754000 -- [-417.083] (-419.447) (-417.021) (-416.922) * [-416.776] (-415.860) (-417.095) (-415.211) -- 0:00:15
      754500 -- [-417.139] (-418.343) (-416.838) (-420.258) * (-416.421) [-415.580] (-420.382) (-415.342) -- 0:00:14
      755000 -- (-420.168) (-418.664) (-420.256) [-415.724] * [-419.562] (-422.091) (-417.950) (-417.757) -- 0:00:14

      Average standard deviation of split frequencies: 0.007649

      755500 -- [-421.842] (-419.790) (-415.352) (-415.190) * (-421.003) [-420.288] (-415.145) (-415.907) -- 0:00:14
      756000 -- (-418.055) (-419.719) (-417.086) [-417.844] * (-420.040) (-414.704) [-416.826] (-416.587) -- 0:00:14
      756500 -- (-417.988) (-417.638) [-415.714] (-415.935) * [-415.955] (-417.641) (-416.678) (-418.084) -- 0:00:14
      757000 -- (-419.300) [-417.632] (-416.423) (-418.397) * (-417.466) (-416.744) (-416.355) [-415.544] -- 0:00:14
      757500 -- (-417.087) (-416.294) [-417.507] (-419.003) * (-415.732) (-419.849) (-415.674) [-416.511] -- 0:00:14
      758000 -- [-416.364] (-418.855) (-417.933) (-417.936) * (-417.143) (-418.113) (-416.621) [-415.942] -- 0:00:14
      758500 -- (-416.709) (-420.149) (-417.379) [-416.653] * (-418.290) [-416.362] (-416.818) (-415.379) -- 0:00:14
      759000 -- (-416.882) [-414.731] (-417.718) (-416.705) * (-415.983) [-418.377] (-417.391) (-419.579) -- 0:00:14
      759500 -- [-415.769] (-417.224) (-416.237) (-420.029) * (-418.073) (-417.033) [-415.474] (-414.449) -- 0:00:14
      760000 -- (-416.964) (-414.672) (-421.019) [-416.394] * (-417.509) (-416.362) (-416.958) [-415.790] -- 0:00:14

      Average standard deviation of split frequencies: 0.007850

      760500 -- (-416.083) [-415.833] (-419.106) (-420.159) * (-416.288) (-417.136) (-419.009) [-416.970] -- 0:00:14
      761000 -- [-417.402] (-415.315) (-415.490) (-416.028) * (-420.646) [-416.816] (-415.485) (-418.220) -- 0:00:14
      761500 -- (-418.077) (-416.772) [-417.178] (-423.095) * (-419.674) [-415.169] (-418.744) (-420.505) -- 0:00:14
      762000 -- (-418.473) (-417.041) [-416.569] (-416.509) * (-415.717) [-414.779] (-419.945) (-418.144) -- 0:00:14
      762500 -- (-419.547) (-420.304) [-415.676] (-417.459) * (-414.908) (-415.377) [-417.201] (-417.138) -- 0:00:14
      763000 -- (-415.505) (-420.755) [-417.950] (-414.476) * (-419.127) [-415.137] (-416.203) (-416.728) -- 0:00:14
      763500 -- [-420.412] (-420.880) (-415.510) (-419.547) * (-416.820) [-415.565] (-416.053) (-414.855) -- 0:00:14
      764000 -- (-416.939) (-417.199) (-418.432) [-417.686] * [-415.209] (-415.483) (-415.488) (-414.825) -- 0:00:14
      764500 -- (-415.589) (-419.965) (-416.563) [-416.016] * (-417.061) (-419.917) (-417.843) [-415.661] -- 0:00:14
      765000 -- [-416.362] (-415.264) (-415.812) (-417.738) * (-416.655) (-416.520) (-416.679) [-417.729] -- 0:00:14

      Average standard deviation of split frequencies: 0.008116

      765500 -- [-415.693] (-415.383) (-417.113) (-416.612) * (-416.415) (-416.214) (-416.192) [-418.157] -- 0:00:14
      766000 -- (-415.770) (-417.399) [-415.987] (-418.074) * (-416.851) [-419.906] (-417.046) (-420.648) -- 0:00:14
      766500 -- (-419.426) (-415.924) [-415.685] (-418.060) * (-416.738) (-418.060) (-424.303) [-417.711] -- 0:00:14
      767000 -- [-419.603] (-415.738) (-416.799) (-415.754) * (-414.590) (-415.248) [-416.059] (-416.048) -- 0:00:14
      767500 -- (-418.627) (-418.093) (-421.931) [-415.260] * (-415.203) (-416.062) [-414.888] (-419.131) -- 0:00:14
      768000 -- (-418.321) (-418.045) (-420.344) [-417.234] * [-414.994] (-416.347) (-415.089) (-418.354) -- 0:00:14
      768500 -- (-415.788) (-419.013) (-421.156) [-415.576] * (-416.604) [-416.449] (-415.324) (-418.796) -- 0:00:14
      769000 -- (-415.361) (-421.567) (-426.568) [-417.786] * (-417.969) [-419.676] (-416.518) (-419.646) -- 0:00:14
      769500 -- (-418.723) (-418.643) (-416.765) [-415.022] * [-419.041] (-415.527) (-419.812) (-416.428) -- 0:00:14
      770000 -- (-417.023) (-416.998) (-418.260) [-416.009] * [-414.813] (-420.557) (-415.100) (-419.609) -- 0:00:14

      Average standard deviation of split frequencies: 0.007952

      770500 -- (-417.330) (-415.506) (-416.380) [-415.429] * [-414.620] (-416.305) (-419.216) (-418.383) -- 0:00:13
      771000 -- (-415.944) [-417.030] (-420.109) (-417.027) * (-416.053) [-416.797] (-414.996) (-417.436) -- 0:00:13
      771500 -- [-416.864] (-416.777) (-416.848) (-419.430) * [-417.096] (-416.868) (-416.048) (-415.592) -- 0:00:13
      772000 -- (-416.272) [-416.502] (-417.140) (-417.946) * (-416.514) (-418.783) [-417.167] (-417.750) -- 0:00:13
      772500 -- [-416.905] (-419.602) (-416.689) (-428.280) * (-416.168) [-417.652] (-415.899) (-417.972) -- 0:00:13
      773000 -- (-415.715) (-416.941) [-418.051] (-417.813) * (-418.891) (-417.418) (-418.098) [-417.311] -- 0:00:13
      773500 -- (-416.332) (-418.710) (-417.228) [-416.976] * [-417.247] (-417.461) (-420.220) (-419.629) -- 0:00:13
      774000 -- (-416.298) (-419.698) [-418.526] (-419.102) * (-421.407) (-415.038) [-417.978] (-416.416) -- 0:00:13
      774500 -- (-417.204) [-418.083] (-415.209) (-418.423) * (-423.497) [-419.423] (-418.710) (-417.772) -- 0:00:13
      775000 -- (-417.631) (-418.771) [-415.156] (-415.980) * [-420.201] (-415.924) (-415.828) (-417.283) -- 0:00:13

      Average standard deviation of split frequencies: 0.008059

      775500 -- (-417.632) (-418.804) (-417.185) [-414.932] * [-421.319] (-415.597) (-417.903) (-421.268) -- 0:00:13
      776000 -- [-417.344] (-419.836) (-416.509) (-418.129) * (-417.519) (-416.404) (-417.953) [-416.847] -- 0:00:13
      776500 -- (-417.274) (-416.915) (-416.293) [-420.518] * (-415.116) [-416.577] (-416.075) (-418.018) -- 0:00:13
      777000 -- [-420.468] (-416.317) (-420.503) (-417.330) * (-416.534) [-421.592] (-416.667) (-415.471) -- 0:00:13
      777500 -- (-417.394) (-417.450) [-420.627] (-416.628) * (-416.903) (-418.598) [-418.884] (-416.133) -- 0:00:13
      778000 -- (-417.445) (-414.921) (-417.000) [-416.589] * (-415.531) [-418.583] (-416.513) (-418.867) -- 0:00:13
      778500 -- (-416.795) (-415.918) [-414.797] (-416.283) * [-416.921] (-419.919) (-415.207) (-415.953) -- 0:00:13
      779000 -- (-417.373) (-418.695) (-417.073) [-419.718] * (-419.187) (-424.681) (-418.582) [-416.836] -- 0:00:13
      779500 -- (-416.519) (-416.356) [-418.291] (-416.259) * (-420.484) [-416.275] (-416.096) (-416.851) -- 0:00:13
      780000 -- [-417.886] (-418.031) (-417.676) (-417.054) * (-417.482) [-415.173] (-416.032) (-417.666) -- 0:00:13

      Average standard deviation of split frequencies: 0.008341

      780500 -- (-418.314) (-414.689) (-416.138) [-415.556] * (-418.745) (-415.178) [-415.754] (-420.308) -- 0:00:13
      781000 -- (-417.669) (-414.628) (-421.217) [-417.687] * (-415.941) (-415.140) [-417.183] (-414.811) -- 0:00:13
      781500 -- (-417.075) [-415.360] (-416.013) (-418.258) * [-415.354] (-417.851) (-417.784) (-417.041) -- 0:00:13
      782000 -- [-416.865] (-417.460) (-416.391) (-417.226) * [-414.787] (-420.358) (-420.060) (-417.898) -- 0:00:13
      782500 -- (-417.390) [-416.206] (-415.570) (-417.377) * [-416.036] (-420.951) (-421.389) (-417.682) -- 0:00:13
      783000 -- [-416.875] (-415.681) (-415.596) (-419.199) * (-414.639) [-419.841] (-415.753) (-419.497) -- 0:00:13
      783500 -- [-415.906] (-415.118) (-415.996) (-417.300) * (-416.648) (-417.682) (-415.448) [-415.044] -- 0:00:13
      784000 -- (-415.620) (-416.602) (-414.825) [-416.346] * (-416.744) (-415.616) (-415.475) [-418.169] -- 0:00:13
      784500 -- (-417.778) (-415.201) (-417.069) [-418.394] * [-417.298] (-420.677) (-417.114) (-416.105) -- 0:00:13
      785000 -- (-415.120) [-415.499] (-416.907) (-422.313) * (-422.379) (-417.650) (-417.347) [-418.525] -- 0:00:13

      Average standard deviation of split frequencies: 0.008172

      785500 -- [-416.747] (-415.984) (-415.797) (-420.400) * (-415.772) [-415.587] (-414.846) (-418.292) -- 0:00:13
      786000 -- [-415.122] (-420.227) (-418.385) (-416.778) * [-415.784] (-417.461) (-415.974) (-419.293) -- 0:00:13
      786500 -- (-415.409) (-417.976) [-416.910] (-414.925) * (-417.033) (-415.912) [-426.560] (-417.027) -- 0:00:13
      787000 -- (-420.664) (-419.081) [-415.160] (-417.046) * [-418.067] (-416.623) (-419.268) (-416.387) -- 0:00:12
      787500 -- (-419.335) [-416.859] (-419.282) (-420.572) * (-416.971) (-415.359) [-416.281] (-415.229) -- 0:00:12
      788000 -- [-417.213] (-415.073) (-421.051) (-420.082) * (-415.982) (-417.207) (-422.867) [-414.761] -- 0:00:12
      788500 -- (-417.760) (-421.528) [-415.073] (-418.741) * (-417.839) [-416.426] (-416.009) (-415.609) -- 0:00:12
      789000 -- (-417.874) (-424.785) [-414.943] (-417.392) * (-414.781) [-414.840] (-416.440) (-415.581) -- 0:00:12
      789500 -- (-418.514) (-416.410) [-416.805] (-415.618) * [-415.220] (-416.638) (-419.862) (-421.584) -- 0:00:12
      790000 -- (-417.595) (-418.566) [-414.985] (-415.483) * (-418.215) [-415.490] (-417.154) (-416.790) -- 0:00:12

      Average standard deviation of split frequencies: 0.008161

      790500 -- (-417.565) [-415.758] (-416.534) (-417.347) * (-417.055) [-416.585] (-416.355) (-415.970) -- 0:00:12
      791000 -- (-417.201) [-416.648] (-419.070) (-418.067) * (-415.645) (-415.970) [-416.907] (-416.322) -- 0:00:12
      791500 -- (-416.554) (-419.106) [-417.694] (-414.979) * (-419.052) (-417.709) (-416.558) [-419.173] -- 0:00:12
      792000 -- (-415.062) (-417.378) (-416.883) [-415.061] * (-416.473) (-416.349) [-415.775] (-418.228) -- 0:00:12
      792500 -- (-416.084) [-415.963] (-417.057) (-416.920) * (-417.229) [-416.566] (-416.403) (-416.758) -- 0:00:12
      793000 -- (-416.755) (-417.268) (-416.139) [-419.679] * (-418.282) (-415.746) [-415.792] (-417.925) -- 0:00:12
      793500 -- (-420.190) [-415.513] (-417.579) (-419.245) * [-417.998] (-416.291) (-415.956) (-417.265) -- 0:00:12
      794000 -- [-420.505] (-416.266) (-415.329) (-415.198) * [-419.804] (-416.989) (-415.441) (-418.729) -- 0:00:12
      794500 -- (-417.792) (-418.638) (-415.638) [-414.941] * (-419.404) (-417.239) [-414.869] (-417.629) -- 0:00:12
      795000 -- [-415.340] (-418.899) (-416.214) (-415.876) * (-415.999) (-421.830) (-418.852) [-415.980] -- 0:00:12

      Average standard deviation of split frequencies: 0.008180

      795500 -- (-415.559) (-418.884) (-415.528) [-415.608] * (-416.747) (-419.128) [-416.864] (-415.259) -- 0:00:12
      796000 -- (-416.528) (-417.410) (-419.058) [-414.572] * (-417.316) (-417.277) [-418.970] (-415.530) -- 0:00:12
      796500 -- (-417.670) (-417.416) (-415.222) [-418.826] * (-416.228) (-414.997) [-421.407] (-418.766) -- 0:00:12
      797000 -- (-416.168) (-415.455) [-417.162] (-415.269) * [-420.910] (-419.446) (-422.037) (-416.466) -- 0:00:12
      797500 -- (-416.922) (-420.379) [-418.318] (-415.314) * (-422.553) (-417.255) (-420.238) [-419.266] -- 0:00:12
      798000 -- (-417.450) (-420.901) [-415.711] (-417.398) * (-419.849) [-414.854] (-415.370) (-425.173) -- 0:00:12
      798500 -- (-414.877) (-416.028) [-414.965] (-417.509) * (-417.781) [-414.646] (-420.127) (-421.968) -- 0:00:12
      799000 -- (-417.623) [-415.729] (-417.073) (-419.422) * (-419.442) (-415.377) (-417.590) [-416.657] -- 0:00:12
      799500 -- (-416.935) (-415.888) (-419.528) [-415.644] * (-417.035) (-419.554) (-416.567) [-414.816] -- 0:00:12
      800000 -- (-416.290) [-417.451] (-418.626) (-420.752) * (-419.652) [-417.574] (-415.381) (-416.075) -- 0:00:12

      Average standard d