--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:24:24 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsK/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -561.79 -564.55
2 -561.80 -564.48
--------------------------------------
TOTAL -561.80 -564.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900469 0.091642 0.362885 1.505313 0.868586 1434.54 1467.77 1.000
r(A<->C){all} 0.154247 0.018992 0.000118 0.428590 0.115728 246.48 269.45 1.000
r(A<->G){all} 0.178361 0.022977 0.000142 0.475231 0.135672 108.38 141.92 1.001
r(A<->T){all} 0.163592 0.020634 0.000134 0.456268 0.122881 218.13 231.15 1.003
r(C<->G){all} 0.167818 0.020801 0.000026 0.463538 0.130353 164.87 170.11 1.000
r(C<->T){all} 0.160733 0.018906 0.000221 0.427914 0.123726 160.45 191.29 1.004
r(G<->T){all} 0.175249 0.021536 0.000010 0.467898 0.140266 220.50 243.88 1.001
pi(A){all} 0.234346 0.000410 0.196540 0.274301 0.234201 1059.22 1210.90 1.000
pi(C){all} 0.294037 0.000488 0.251645 0.338325 0.293779 1238.45 1246.98 1.000
pi(G){all} 0.315775 0.000488 0.272321 0.358050 0.315682 1278.26 1311.27 1.000
pi(T){all} 0.155842 0.000296 0.123502 0.190084 0.154929 1095.94 1239.19 1.000
alpha{1,2} 0.415954 0.225889 0.000114 1.396293 0.246486 1289.80 1297.84 1.000
alpha{3} 0.466469 0.246086 0.000302 1.437182 0.299127 1501.00 1501.00 1.000
pinvar{all} 0.996166 0.000022 0.987780 0.999999 0.997608 1062.92 1144.66 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -541.834372
Model 2: PositiveSelection -541.834344
Model 0: one-ratio -541.83437
Model 7: beta -541.83445
Model 8: beta&w>1 -541.834338
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 5.600000008598727E-5
Model 8 vs 7 2.2399999988920172E-4
>C1
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C2
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C3
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C4
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C5
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C6
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=138
C1 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C2 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C3 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C4 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C5 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C6 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
**************************************************
C1 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C2 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C3 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C4 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C5 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C6 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
**************************************************
C1 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C2 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C3 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C4 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C5 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C6 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
**************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4140]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4140]--->[4140]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.464 Mb, Max= 30.670 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C2 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C3 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C4 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C5 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C6 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
**************************************************
C1 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C2 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C3 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C4 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C5 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C6 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
**************************************************
C1 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C2 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C3 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C4 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C5 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C6 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
**************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
C2 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
C3 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
C4 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
C5 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
C6 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
**************************************************
C1 CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
C2 CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
C3 CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
C4 CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
C5 CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
C6 CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
**************************************************
C1 GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
C2 GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
C3 GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
C4 GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
C5 GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
C6 GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
**************************************************
C1 ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
C2 ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
C3 ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
C4 ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
C5 ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
C6 ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
**************************************************
C1 GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
C2 GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
C3 GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
C4 GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
C5 GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
C6 GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
**************************************************
C1 AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
C2 AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
C3 AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
C4 AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
C5 AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
C6 AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
**************************************************
C1 GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
C2 GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
C3 GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
C4 GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
C5 GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
C6 GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
**************************************************
C1 CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
C2 CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
C3 CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
C4 CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
C5 CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
C6 CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
**************************************************
C1 AGCGCAGAAGAGTC
C2 AGCGCAGAAGAGTC
C3 AGCGCAGAAGAGTC
C4 AGCGCAGAAGAGTC
C5 AGCGCAGAAGAGTC
C6 AGCGCAGAAGAGTC
**************
>C1
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C2
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C3
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C4
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C5
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C6
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C1
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C2
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C3
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C4
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C5
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C6
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 414 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792986
Setting output file names to "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 621566746
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0114877130
Seed = 2034274178
Swapseed = 1579792986
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -926.551850 -- -24.965149
Chain 2 -- -926.551797 -- -24.965149
Chain 3 -- -926.551850 -- -24.965149
Chain 4 -- -926.551850 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -926.551850 -- -24.965149
Chain 2 -- -926.551850 -- -24.965149
Chain 3 -- -926.551797 -- -24.965149
Chain 4 -- -926.551850 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-926.552] (-926.552) (-926.552) (-926.552) * [-926.552] (-926.552) (-926.552) (-926.552)
500 -- [-574.538] (-573.644) (-582.016) (-577.976) * (-571.878) (-571.066) [-566.307] (-571.189) -- 0:00:00
1000 -- (-578.151) (-567.192) (-568.767) [-572.563] * (-574.784) [-582.127] (-574.341) (-576.657) -- 0:00:00
1500 -- (-572.036) [-571.653] (-566.849) (-572.694) * (-565.256) (-570.331) (-582.216) [-569.354] -- 0:00:00
2000 -- (-568.206) (-570.697) (-572.441) [-571.469] * (-569.479) (-582.308) [-571.403] (-573.441) -- 0:00:00
2500 -- (-572.693) (-567.070) (-571.556) [-569.291] * (-570.782) (-569.978) [-572.454] (-575.265) -- 0:00:00
3000 -- (-575.558) (-570.922) [-575.586] (-571.800) * (-576.089) (-569.299) [-569.079] (-566.504) -- 0:00:00
3500 -- (-573.775) (-571.069) [-577.926] (-572.387) * (-578.573) (-577.817) [-571.860] (-569.434) -- 0:00:00
4000 -- (-574.503) (-583.182) [-574.795] (-573.776) * [-568.319] (-579.225) (-580.614) (-568.730) -- 0:00:00
4500 -- (-575.684) (-574.389) (-569.752) [-570.129] * (-572.923) (-573.281) [-576.817] (-577.173) -- 0:00:00
5000 -- (-575.281) [-569.217] (-577.262) (-570.922) * (-575.282) (-571.695) (-577.084) [-580.873] -- 0:00:00
Average standard deviation of split frequencies: 0.119722
5500 -- (-579.747) [-566.181] (-572.109) (-573.547) * (-567.551) (-577.852) (-571.219) [-571.892] -- 0:00:00
6000 -- (-579.754) [-571.771] (-568.845) (-573.976) * [-563.496] (-573.983) (-566.899) (-572.291) -- 0:02:45
6500 -- (-574.768) (-567.433) (-583.453) [-575.455] * [-568.189] (-578.003) (-578.990) (-569.885) -- 0:02:32
7000 -- (-579.170) (-570.715) [-572.769] (-569.664) * [-568.091] (-573.608) (-572.418) (-579.906) -- 0:02:21
7500 -- [-567.519] (-570.547) (-572.602) (-571.607) * (-581.036) (-569.075) (-576.636) [-573.624] -- 0:02:12
8000 -- [-565.867] (-579.741) (-569.638) (-575.698) * (-570.310) (-570.556) [-573.221] (-575.097) -- 0:02:04
8500 -- (-567.160) [-571.494] (-575.109) (-573.622) * [-570.117] (-575.883) (-578.540) (-579.737) -- 0:01:56
9000 -- (-581.211) [-580.693] (-569.309) (-575.544) * [-566.570] (-568.394) (-571.680) (-573.853) -- 0:01:50
9500 -- (-570.859) [-573.000] (-568.360) (-580.821) * (-570.523) [-572.151] (-574.604) (-574.478) -- 0:01:44
10000 -- (-575.208) (-569.786) [-571.756] (-588.355) * (-568.439) (-573.803) [-571.928] (-574.777) -- 0:01:39
Average standard deviation of split frequencies: 0.061872
10500 -- [-569.307] (-570.747) (-572.208) (-564.294) * (-574.424) (-571.373) (-572.485) [-563.884] -- 0:01:34
11000 -- (-568.805) (-568.973) [-573.513] (-568.068) * (-572.797) (-570.174) (-573.278) [-562.724] -- 0:01:29
11500 -- [-567.419] (-571.228) (-571.441) (-563.302) * (-571.434) (-567.697) (-578.025) [-562.205] -- 0:01:25
12000 -- (-566.364) (-575.534) [-571.068] (-561.543) * [-575.925] (-570.496) (-572.974) (-560.785) -- 0:01:22
12500 -- (-565.578) (-567.371) [-573.253] (-567.157) * [-569.041] (-571.270) (-575.112) (-560.754) -- 0:01:19
13000 -- (-563.508) [-572.917] (-565.793) (-568.983) * (-569.977) (-571.930) [-570.379] (-560.617) -- 0:01:15
13500 -- (-563.252) (-574.938) (-577.771) [-561.405] * (-570.143) (-570.635) [-569.104] (-564.511) -- 0:01:13
14000 -- (-562.807) (-576.135) [-571.638] (-561.489) * [-572.160] (-571.909) (-572.788) (-563.917) -- 0:01:10
14500 -- (-561.081) (-572.116) (-568.865) [-562.740] * (-575.880) (-575.266) [-567.238] (-562.614) -- 0:01:07
15000 -- (-564.862) [-573.756] (-565.324) (-561.709) * [-572.390] (-577.023) (-563.613) (-562.094) -- 0:01:05
Average standard deviation of split frequencies: 0.057375
15500 -- (-564.366) (-582.213) [-574.034] (-565.360) * (-577.005) [-577.290] (-563.193) (-561.847) -- 0:01:03
16000 -- (-562.382) [-569.744] (-573.540) (-567.327) * (-575.466) (-576.941) (-561.779) [-564.138] -- 0:01:01
16500 -- (-562.207) [-569.666] (-571.546) (-562.243) * (-574.815) [-571.784] (-562.463) (-563.859) -- 0:00:59
17000 -- (-562.009) (-570.887) [-571.822] (-561.172) * [-568.837] (-572.752) (-562.806) (-561.452) -- 0:00:57
17500 -- (-563.812) [-576.697] (-573.837) (-563.106) * (-571.036) (-575.642) [-565.150] (-562.222) -- 0:00:56
18000 -- (-566.104) (-585.096) [-569.898] (-565.632) * [-572.606] (-572.893) (-565.200) (-562.360) -- 0:01:49
18500 -- (-570.159) (-577.533) (-573.428) [-560.782] * (-564.536) (-565.029) [-561.845] (-562.145) -- 0:01:46
19000 -- (-564.835) (-573.831) [-574.279] (-561.242) * (-578.746) (-563.297) (-561.488) [-561.473] -- 0:01:43
19500 -- (-563.709) (-571.322) (-575.463) [-560.891] * [-567.087] (-561.934) (-561.724) (-562.426) -- 0:01:40
20000 -- (-568.325) (-579.423) (-570.383) [-563.641] * (-574.570) (-563.919) (-561.883) [-562.500] -- 0:01:38
Average standard deviation of split frequencies: 0.056424
20500 -- (-563.429) (-582.792) [-575.769] (-562.072) * (-568.250) (-562.767) (-561.875) [-561.915] -- 0:01:35
21000 -- (-569.582) (-569.830) [-575.209] (-564.450) * (-577.390) (-565.107) (-561.441) [-562.055] -- 0:01:33
21500 -- (-565.124) (-579.802) (-574.044) [-563.768] * [-570.718] (-566.722) (-560.718) (-560.466) -- 0:01:31
22000 -- (-564.246) (-577.459) (-571.557) [-563.526] * (-574.949) (-561.422) [-563.460] (-562.667) -- 0:01:28
22500 -- (-562.142) [-572.970] (-577.144) (-560.734) * (-566.174) (-563.235) [-560.807] (-572.491) -- 0:01:26
23000 -- [-561.317] (-575.549) (-573.560) (-563.481) * [-565.826] (-566.209) (-560.515) (-571.209) -- 0:01:24
23500 -- [-561.466] (-561.770) (-573.989) (-561.738) * [-581.522] (-562.521) (-561.132) (-562.105) -- 0:01:23
24000 -- (-565.848) (-564.072) (-568.434) [-561.685] * (-572.453) (-562.238) (-561.935) [-562.570] -- 0:01:21
24500 -- (-562.795) (-564.347) [-562.454] (-562.389) * (-570.809) [-563.048] (-562.591) (-560.972) -- 0:01:19
25000 -- (-565.490) (-562.754) (-562.171) [-560.861] * (-571.618) (-563.793) (-564.310) [-563.365] -- 0:01:18
Average standard deviation of split frequencies: 0.049663
25500 -- (-562.844) [-564.618] (-564.984) (-564.271) * [-569.410] (-566.110) (-561.698) (-562.976) -- 0:01:16
26000 -- (-562.563) (-570.613) [-561.614] (-560.719) * (-579.179) (-565.922) (-561.957) [-563.360] -- 0:01:14
26500 -- [-561.711] (-565.453) (-563.433) (-562.872) * (-575.968) [-564.864] (-561.720) (-562.106) -- 0:01:13
27000 -- (-564.457) [-564.458] (-561.985) (-563.895) * (-583.651) [-562.590] (-562.059) (-562.346) -- 0:01:12
27500 -- (-571.690) (-563.863) (-566.099) [-563.086] * (-582.110) (-562.483) [-560.627] (-564.588) -- 0:01:10
28000 -- [-564.397] (-563.870) (-566.547) (-563.231) * (-581.295) [-561.105] (-560.594) (-562.943) -- 0:01:09
28500 -- (-565.643) (-561.816) [-562.012] (-563.678) * (-577.146) (-564.514) [-560.515] (-566.206) -- 0:01:08
29000 -- (-565.509) [-562.585] (-563.843) (-563.157) * (-560.926) [-563.679] (-563.936) (-562.403) -- 0:01:06
29500 -- (-562.731) (-561.821) [-561.923] (-563.722) * (-561.871) (-563.959) [-561.013] (-563.775) -- 0:01:05
30000 -- [-561.266] (-562.757) (-562.093) (-561.034) * (-561.634) (-564.999) [-561.472] (-562.396) -- 0:01:04
Average standard deviation of split frequencies: 0.045307
30500 -- (-561.418) (-563.382) [-563.456] (-562.150) * (-561.363) (-564.149) (-566.672) [-561.872] -- 0:01:03
31000 -- (-563.773) [-562.994] (-561.369) (-564.937) * (-562.746) (-564.961) (-563.587) [-562.154] -- 0:01:02
31500 -- (-563.457) [-560.732] (-560.762) (-561.759) * (-563.584) (-563.192) (-561.671) [-561.890] -- 0:01:32
32000 -- (-561.220) (-562.362) (-564.063) [-562.929] * (-565.960) [-565.163] (-563.858) (-562.072) -- 0:01:30
32500 -- (-562.691) [-562.999] (-563.537) (-561.142) * (-566.600) [-560.909] (-566.073) (-561.978) -- 0:01:29
33000 -- (-565.870) (-561.937) (-562.667) [-561.858] * (-562.959) (-561.887) (-563.541) [-561.388] -- 0:01:27
33500 -- (-561.043) [-561.950] (-563.452) (-560.981) * [-562.595] (-564.135) (-562.492) (-561.506) -- 0:01:26
34000 -- [-560.535] (-564.240) (-561.485) (-565.331) * [-565.209] (-562.135) (-564.389) (-566.734) -- 0:01:25
34500 -- [-561.664] (-566.488) (-563.128) (-564.194) * (-562.499) [-562.717] (-563.976) (-560.560) -- 0:01:23
35000 -- (-563.226) (-561.949) (-562.861) [-561.729] * (-562.004) (-562.866) [-561.937] (-562.207) -- 0:01:22
Average standard deviation of split frequencies: 0.033391
35500 -- (-565.157) (-565.695) [-564.956] (-561.064) * (-564.269) (-565.948) (-563.319) [-562.054] -- 0:01:21
36000 -- (-567.704) [-562.486] (-563.816) (-562.954) * (-564.070) (-564.650) [-563.052] (-561.438) -- 0:01:20
36500 -- (-566.011) [-563.587] (-564.927) (-561.155) * (-562.884) [-564.819] (-560.901) (-560.579) -- 0:01:19
37000 -- [-562.320] (-561.620) (-563.164) (-561.111) * (-562.876) (-563.970) [-561.828] (-560.657) -- 0:01:18
37500 -- [-563.995] (-560.656) (-568.026) (-561.234) * (-563.469) (-562.382) (-561.772) [-562.475] -- 0:01:17
38000 -- [-563.909] (-564.978) (-565.850) (-560.959) * (-562.958) (-562.378) (-560.739) [-562.972] -- 0:01:15
38500 -- [-563.835] (-561.489) (-561.535) (-562.779) * (-562.953) (-560.800) [-561.830] (-560.561) -- 0:01:14
39000 -- (-560.559) (-561.769) [-563.489] (-563.739) * [-566.778] (-562.998) (-564.258) (-561.602) -- 0:01:13
39500 -- (-564.994) [-562.563] (-561.420) (-562.737) * (-565.053) [-562.384] (-563.663) (-563.001) -- 0:01:12
40000 -- (-562.481) (-561.386) [-561.182] (-565.128) * (-564.333) (-561.090) [-561.287] (-562.288) -- 0:01:12
Average standard deviation of split frequencies: 0.036606
40500 -- (-563.364) [-561.761] (-566.320) (-563.873) * [-563.268] (-562.046) (-560.977) (-560.249) -- 0:01:11
41000 -- [-564.841] (-563.235) (-563.022) (-562.023) * [-561.360] (-562.224) (-564.181) (-561.374) -- 0:01:10
41500 -- (-560.828) (-564.374) (-561.820) [-562.027] * (-560.732) (-562.057) [-566.541] (-560.977) -- 0:01:09
42000 -- (-560.264) (-562.902) [-563.085] (-562.003) * (-561.255) [-562.831] (-561.973) (-560.198) -- 0:01:08
42500 -- (-560.770) [-562.953] (-564.290) (-562.559) * (-566.170) (-563.991) [-561.376] (-562.324) -- 0:01:07
43000 -- [-560.415] (-561.712) (-560.901) (-563.438) * (-562.921) (-564.425) (-563.184) [-562.870] -- 0:01:06
43500 -- [-560.582] (-560.863) (-561.651) (-561.802) * [-561.555] (-562.796) (-561.621) (-561.868) -- 0:01:05
44000 -- (-560.445) (-560.386) [-561.946] (-561.952) * (-564.964) (-561.502) (-561.724) [-562.974] -- 0:01:05
44500 -- (-561.823) (-563.934) [-562.553] (-563.136) * (-562.193) (-562.215) [-564.467] (-561.709) -- 0:01:04
45000 -- (-562.321) (-564.062) [-562.014] (-565.780) * (-562.428) [-563.158] (-567.485) (-561.502) -- 0:01:03
Average standard deviation of split frequencies: 0.036677
45500 -- [-562.583] (-563.298) (-561.931) (-560.186) * (-565.550) (-561.174) (-563.746) [-560.380] -- 0:01:02
46000 -- (-561.478) (-568.053) [-562.192] (-561.807) * (-563.643) (-566.344) [-564.490] (-561.758) -- 0:01:02
46500 -- (-564.474) (-564.288) (-562.325) [-561.808] * (-562.387) (-560.545) [-564.264] (-562.141) -- 0:01:01
47000 -- (-565.624) (-563.560) (-562.221) [-562.439] * (-563.375) [-560.736] (-564.127) (-563.187) -- 0:01:00
47500 -- (-570.378) [-563.416] (-562.655) (-560.642) * (-561.697) (-560.731) [-564.119] (-565.606) -- 0:01:00
48000 -- (-564.831) (-562.598) (-561.818) [-560.853] * (-563.024) [-563.684] (-565.304) (-566.239) -- 0:01:19
48500 -- (-562.465) (-563.923) [-560.330] (-563.489) * (-567.228) [-562.614] (-568.699) (-562.391) -- 0:01:18
49000 -- (-562.240) (-563.046) (-561.998) [-562.154] * (-562.146) (-561.126) (-562.341) [-560.469] -- 0:01:17
49500 -- (-565.440) (-562.487) [-565.823] (-561.670) * [-560.423] (-560.707) (-565.609) (-562.775) -- 0:01:16
50000 -- [-565.405] (-564.444) (-563.521) (-563.549) * (-560.642) (-561.153) (-565.613) [-564.685] -- 0:01:16
Average standard deviation of split frequencies: 0.030238
50500 -- (-561.910) (-562.910) [-563.058] (-561.834) * (-561.508) (-562.288) (-564.546) [-560.947] -- 0:01:15
51000 -- [-562.302] (-563.616) (-569.311) (-562.497) * (-562.062) [-565.782] (-567.704) (-560.662) -- 0:01:14
51500 -- (-564.521) [-562.610] (-564.528) (-563.965) * (-561.676) [-561.932] (-563.187) (-560.956) -- 0:01:13
52000 -- (-561.483) [-560.483] (-564.473) (-561.009) * [-562.639] (-563.010) (-561.550) (-562.209) -- 0:01:12
52500 -- (-561.419) [-564.285] (-562.224) (-562.238) * (-561.495) [-564.146] (-562.531) (-565.552) -- 0:01:12
53000 -- (-565.068) (-560.773) [-561.278] (-560.650) * (-563.485) [-563.159] (-562.157) (-563.165) -- 0:01:11
53500 -- (-564.713) [-561.140] (-561.306) (-560.349) * (-565.108) (-561.922) (-564.093) [-563.385] -- 0:01:10
54000 -- (-565.621) (-564.854) [-561.674] (-562.278) * (-561.073) [-560.831] (-562.310) (-561.636) -- 0:01:10
54500 -- [-562.299] (-562.372) (-562.634) (-562.026) * (-562.712) (-562.201) (-561.368) [-562.672] -- 0:01:09
55000 -- (-562.538) [-564.753] (-562.462) (-561.342) * [-561.428] (-564.776) (-561.917) (-562.208) -- 0:01:08
Average standard deviation of split frequencies: 0.031146
55500 -- (-563.379) (-560.943) [-562.047] (-562.325) * [-560.924] (-562.472) (-563.690) (-563.811) -- 0:01:08
56000 -- (-566.225) [-562.185] (-562.271) (-561.423) * [-562.305] (-560.443) (-561.683) (-570.731) -- 0:01:07
56500 -- (-563.766) [-561.665] (-563.159) (-560.699) * (-565.067) [-561.270] (-565.215) (-564.851) -- 0:01:06
57000 -- (-561.307) [-560.549] (-560.709) (-562.389) * (-564.842) (-563.680) (-564.704) [-566.734] -- 0:01:06
57500 -- (-560.985) (-562.056) [-562.872] (-560.856) * (-565.798) [-562.838] (-562.461) (-561.644) -- 0:01:05
58000 -- [-561.840] (-563.232) (-564.099) (-561.665) * (-560.891) [-562.784] (-560.760) (-561.493) -- 0:01:04
58500 -- [-561.950] (-560.965) (-566.399) (-561.611) * (-563.052) [-561.910] (-562.842) (-566.401) -- 0:01:04
59000 -- [-562.263] (-565.711) (-562.218) (-561.650) * [-562.955] (-561.229) (-561.458) (-561.957) -- 0:01:03
59500 -- [-562.175] (-564.990) (-561.118) (-560.996) * (-562.894) (-561.262) (-565.011) [-561.063] -- 0:01:03
60000 -- (-561.892) (-563.649) (-561.015) [-561.643] * (-564.876) (-560.748) [-561.346] (-562.524) -- 0:01:02
Average standard deviation of split frequencies: 0.030264
60500 -- (-561.564) (-562.357) [-560.800] (-560.939) * (-563.460) (-563.153) [-563.141] (-560.648) -- 0:01:02
61000 -- (-566.653) (-563.005) [-568.825] (-565.788) * (-563.457) (-562.346) [-562.396] (-565.620) -- 0:01:01
61500 -- [-566.389] (-563.413) (-564.646) (-562.933) * (-562.027) (-563.926) [-562.260] (-562.293) -- 0:01:01
62000 -- (-566.629) (-567.001) (-562.664) [-561.371] * (-562.727) [-562.446] (-562.363) (-564.738) -- 0:01:00
62500 -- (-564.235) (-562.008) [-561.486] (-561.483) * [-562.391] (-562.302) (-562.047) (-562.896) -- 0:01:00
63000 -- [-562.946] (-561.879) (-565.384) (-562.138) * [-561.958] (-566.023) (-561.208) (-561.244) -- 0:00:59
63500 -- [-561.585] (-564.354) (-560.717) (-562.464) * (-565.609) (-561.551) [-564.121] (-564.255) -- 0:00:58
64000 -- [-561.734] (-563.055) (-562.209) (-562.748) * (-562.264) (-560.942) (-563.048) [-564.170] -- 0:00:58
64500 -- (-561.681) (-562.368) (-565.001) [-564.720] * (-561.962) (-561.986) [-561.387] (-563.685) -- 0:01:12
65000 -- (-561.254) (-562.137) (-562.138) [-564.157] * (-560.702) (-563.888) [-565.538] (-563.847) -- 0:01:11
Average standard deviation of split frequencies: 0.032311
65500 -- (-560.826) (-561.538) (-562.491) [-564.211] * (-560.390) (-566.096) (-568.096) [-563.638] -- 0:01:11
66000 -- (-560.952) (-563.265) [-561.105] (-563.039) * (-560.932) [-561.741] (-561.491) (-565.354) -- 0:01:10
66500 -- (-561.627) (-562.189) (-564.112) [-562.323] * (-566.247) (-562.550) [-560.897] (-563.353) -- 0:01:10
67000 -- [-563.593] (-569.352) (-564.187) (-560.977) * (-561.917) [-560.294] (-561.284) (-560.434) -- 0:01:09
67500 -- [-562.179] (-566.933) (-562.964) (-561.629) * (-561.479) (-565.309) [-562.046] (-561.477) -- 0:01:09
68000 -- (-561.464) (-564.185) (-562.672) [-561.506] * (-562.562) (-564.216) (-560.598) [-562.700] -- 0:01:08
68500 -- (-563.695) (-561.045) [-563.679] (-562.287) * [-562.625] (-566.645) (-561.874) (-562.229) -- 0:01:07
69000 -- [-561.328] (-560.918) (-565.178) (-561.107) * (-561.700) (-566.616) [-560.506] (-562.475) -- 0:01:07
69500 -- (-560.871) (-562.660) [-561.911] (-563.248) * (-563.344) (-560.671) [-561.117] (-562.301) -- 0:01:06
70000 -- [-562.397] (-563.774) (-561.376) (-562.159) * (-564.754) (-561.794) [-560.822] (-565.310) -- 0:01:06
Average standard deviation of split frequencies: 0.030813
70500 -- [-563.201] (-564.002) (-561.389) (-562.381) * [-561.835] (-567.895) (-563.734) (-565.128) -- 0:01:05
71000 -- (-562.398) (-562.719) (-560.546) [-563.938] * [-561.587] (-564.460) (-561.943) (-562.380) -- 0:01:05
71500 -- [-562.804] (-561.557) (-560.760) (-563.443) * (-566.965) [-562.859] (-560.746) (-562.763) -- 0:01:04
72000 -- (-561.283) [-560.245] (-561.945) (-562.645) * (-563.577) (-562.130) (-561.186) [-564.361] -- 0:01:04
72500 -- [-563.552] (-562.651) (-562.495) (-563.561) * (-566.239) (-562.685) [-565.004] (-562.874) -- 0:01:03
73000 -- (-563.368) (-560.854) (-562.154) [-561.807] * [-562.405] (-568.484) (-560.574) (-561.076) -- 0:01:03
73500 -- (-563.363) [-562.405] (-565.343) (-563.627) * [-560.696] (-565.944) (-560.575) (-564.554) -- 0:01:03
74000 -- (-563.619) (-561.660) (-562.294) [-562.579] * [-562.774] (-566.990) (-563.351) (-568.482) -- 0:01:02
74500 -- (-566.174) [-570.424] (-567.730) (-563.412) * [-563.884] (-565.720) (-564.351) (-561.799) -- 0:01:02
75000 -- (-563.833) (-562.640) [-564.783] (-565.599) * [-560.594] (-572.769) (-567.903) (-560.584) -- 0:01:01
Average standard deviation of split frequencies: 0.031324
75500 -- [-563.826] (-561.973) (-560.725) (-560.678) * [-561.367] (-563.342) (-561.700) (-562.994) -- 0:01:01
76000 -- (-565.143) (-562.102) [-561.779] (-562.210) * (-562.677) (-562.986) (-562.399) [-561.986] -- 0:01:00
76500 -- [-564.870] (-564.108) (-562.032) (-561.093) * (-562.399) (-563.492) [-560.889] (-566.237) -- 0:01:00
77000 -- (-562.123) (-563.624) [-561.386] (-562.420) * (-562.504) [-563.127] (-566.715) (-562.122) -- 0:00:59
77500 -- (-564.883) (-561.916) [-561.817] (-564.225) * (-561.365) (-562.241) (-566.118) [-560.735] -- 0:00:59
78000 -- [-563.416] (-560.907) (-566.816) (-563.729) * (-565.258) (-564.445) [-563.407] (-560.481) -- 0:00:59
78500 -- (-560.753) (-560.538) [-561.650] (-564.830) * (-566.564) (-564.659) (-563.010) [-561.047] -- 0:00:58
79000 -- [-562.624] (-565.252) (-562.823) (-565.193) * (-565.323) [-560.923] (-564.940) (-561.019) -- 0:00:58
79500 -- (-563.304) (-562.669) [-563.470] (-561.572) * [-565.076] (-561.823) (-561.791) (-562.395) -- 0:00:57
80000 -- (-563.348) (-562.597) (-563.423) [-561.671] * (-561.734) [-562.608] (-564.361) (-562.354) -- 0:00:57
Average standard deviation of split frequencies: 0.026297
80500 -- (-566.204) (-562.073) (-562.713) [-560.717] * (-561.114) [-560.484] (-562.154) (-562.969) -- 0:00:57
81000 -- (-562.622) (-561.328) (-563.845) [-560.925] * (-562.468) [-561.272] (-561.644) (-561.832) -- 0:01:08
81500 -- (-561.744) (-566.103) [-561.828] (-562.753) * (-561.613) (-561.874) [-562.377] (-562.293) -- 0:01:07
82000 -- (-561.206) (-567.849) [-561.317] (-563.118) * [-560.235] (-561.548) (-560.937) (-563.418) -- 0:01:07
82500 -- (-562.253) (-564.066) (-560.873) [-561.860] * [-560.769] (-561.130) (-561.961) (-561.699) -- 0:01:06
83000 -- (-566.999) [-562.263] (-561.072) (-561.877) * (-560.777) (-562.948) [-561.414] (-561.176) -- 0:01:06
83500 -- (-564.258) (-563.231) (-569.444) [-563.158] * (-560.556) [-564.663] (-561.284) (-561.042) -- 0:01:05
84000 -- [-562.136] (-564.783) (-562.376) (-561.578) * (-563.034) [-562.985] (-562.362) (-562.264) -- 0:01:05
84500 -- [-563.050] (-562.292) (-560.796) (-562.062) * (-562.076) (-563.914) [-562.546] (-561.134) -- 0:01:05
85000 -- (-566.286) [-560.843] (-565.357) (-563.510) * (-562.126) (-564.494) (-564.389) [-564.096] -- 0:01:04
Average standard deviation of split frequencies: 0.024522
85500 -- (-562.438) [-567.831] (-567.381) (-564.918) * [-561.592] (-562.234) (-562.490) (-561.122) -- 0:01:04
86000 -- [-561.687] (-562.638) (-562.165) (-561.883) * (-561.523) (-562.363) [-564.750] (-563.780) -- 0:01:03
86500 -- (-560.921) (-562.718) (-562.220) [-562.392] * (-563.777) (-561.584) (-566.805) [-563.051] -- 0:01:03
87000 -- (-569.047) (-561.196) [-562.593] (-562.516) * [-562.081] (-564.445) (-567.143) (-561.762) -- 0:01:02
87500 -- (-565.099) [-564.100] (-562.495) (-564.215) * [-561.421] (-563.909) (-561.771) (-562.314) -- 0:01:02
88000 -- (-563.313) (-565.325) [-561.063] (-562.571) * (-561.600) (-561.141) (-561.111) [-564.734] -- 0:01:02
88500 -- (-564.163) [-562.636] (-561.238) (-562.420) * (-562.216) (-561.053) [-566.040] (-565.179) -- 0:01:01
89000 -- (-564.819) (-562.900) [-563.080] (-560.634) * (-563.351) [-560.460] (-561.693) (-570.535) -- 0:01:01
89500 -- [-560.277] (-563.430) (-567.676) (-561.373) * [-561.518] (-563.165) (-560.756) (-564.790) -- 0:01:01
90000 -- [-563.983] (-568.125) (-561.337) (-563.636) * [-562.551] (-560.868) (-563.439) (-562.551) -- 0:01:00
Average standard deviation of split frequencies: 0.023917
90500 -- (-561.238) (-567.746) [-561.438] (-566.474) * (-563.877) (-562.269) [-561.758] (-560.317) -- 0:01:00
91000 -- (-562.363) (-562.075) (-561.216) [-562.542] * [-563.252] (-564.304) (-561.032) (-560.803) -- 0:00:59
91500 -- [-566.304] (-568.240) (-563.033) (-560.748) * (-562.096) (-563.627) (-561.227) [-560.785] -- 0:00:59
92000 -- [-563.319] (-562.076) (-561.780) (-560.743) * (-563.473) (-562.189) [-564.740] (-563.537) -- 0:00:59
92500 -- (-565.589) (-568.694) [-561.601] (-565.618) * (-564.573) (-561.117) [-560.649] (-563.999) -- 0:00:58
93000 -- [-562.298] (-563.467) (-562.084) (-561.799) * (-562.795) [-561.376] (-560.539) (-564.616) -- 0:00:58
93500 -- [-562.241] (-565.380) (-564.330) (-565.050) * (-561.054) (-566.901) (-561.197) [-564.853] -- 0:00:58
94000 -- (-562.552) [-562.379] (-565.735) (-562.604) * (-564.248) [-561.720] (-561.686) (-565.634) -- 0:00:57
94500 -- (-561.733) (-561.332) (-563.760) [-563.470] * [-562.755] (-562.367) (-566.001) (-563.501) -- 0:00:57
95000 -- (-562.757) [-564.852] (-561.768) (-566.610) * (-561.012) (-562.733) (-566.372) [-562.020] -- 0:00:57
Average standard deviation of split frequencies: 0.023570
95500 -- (-561.260) (-563.039) (-569.186) [-563.946] * (-561.058) [-561.853] (-560.628) (-561.037) -- 0:00:56
96000 -- (-561.124) [-563.959] (-570.251) (-566.251) * [-561.931] (-562.729) (-561.916) (-560.896) -- 0:00:56
96500 -- (-562.100) [-565.331] (-564.969) (-566.328) * (-561.198) (-566.312) [-561.095] (-560.713) -- 0:00:56
97000 -- (-563.713) [-560.274] (-562.361) (-560.690) * (-561.403) (-564.035) [-565.369] (-563.631) -- 0:00:55
97500 -- (-561.161) (-568.149) (-562.889) [-561.727] * (-564.241) (-563.579) (-562.092) [-564.474] -- 0:00:55
98000 -- (-563.156) (-563.435) [-567.067] (-562.186) * (-563.320) [-560.968] (-563.317) (-563.093) -- 0:01:04
98500 -- [-562.850] (-564.936) (-564.795) (-565.178) * [-562.611] (-560.435) (-569.012) (-563.853) -- 0:01:04
99000 -- (-564.984) (-561.269) [-561.815] (-561.666) * [-562.127] (-568.695) (-561.756) (-565.444) -- 0:01:03
99500 -- (-565.145) [-561.516] (-560.391) (-561.368) * [-567.805] (-562.503) (-561.207) (-560.882) -- 0:01:03
100000 -- (-562.162) [-561.383] (-562.039) (-569.681) * (-561.861) [-564.159] (-561.528) (-560.998) -- 0:01:02
Average standard deviation of split frequencies: 0.026224
100500 -- (-564.678) [-561.747] (-562.838) (-563.308) * (-566.325) (-563.909) [-561.353] (-563.561) -- 0:01:02
101000 -- [-560.322] (-561.383) (-561.923) (-561.071) * (-567.894) [-565.467] (-561.489) (-561.432) -- 0:01:02
101500 -- (-560.379) [-561.083] (-561.133) (-561.296) * (-562.280) (-567.831) [-562.248] (-561.511) -- 0:01:01
102000 -- (-561.586) (-562.524) [-563.558] (-560.135) * [-562.887] (-561.712) (-561.940) (-560.994) -- 0:01:01
102500 -- (-561.113) [-562.413] (-563.020) (-561.582) * (-562.508) (-563.221) [-563.218] (-563.058) -- 0:01:01
103000 -- (-561.181) (-561.631) (-565.137) [-561.922] * (-563.059) [-565.011] (-562.774) (-561.174) -- 0:01:00
103500 -- (-561.285) (-563.379) [-563.205] (-561.077) * (-563.105) [-560.725] (-563.428) (-563.905) -- 0:01:00
104000 -- (-563.101) [-562.620] (-561.200) (-561.272) * (-563.337) (-563.252) (-563.233) [-563.620] -- 0:01:00
104500 -- [-565.481] (-561.237) (-560.998) (-562.055) * [-562.350] (-561.778) (-562.375) (-565.315) -- 0:00:59
105000 -- (-566.350) (-565.877) [-561.250] (-566.502) * [-561.620] (-562.674) (-563.782) (-566.548) -- 0:00:59
Average standard deviation of split frequencies: 0.025794
105500 -- (-564.229) [-566.949] (-563.408) (-562.128) * (-564.692) (-561.019) (-562.131) [-561.425] -- 0:00:59
106000 -- (-562.123) (-564.212) (-563.581) [-562.723] * (-562.813) (-561.093) [-563.581] (-562.367) -- 0:00:59
106500 -- (-562.794) [-561.508] (-564.263) (-563.924) * (-561.443) (-560.435) (-564.284) [-564.319] -- 0:00:58
107000 -- (-563.947) (-563.651) (-563.361) [-561.451] * (-563.022) (-561.567) [-562.449] (-562.434) -- 0:00:58
107500 -- [-561.717] (-562.543) (-565.613) (-560.532) * (-561.116) (-563.987) [-561.219] (-561.828) -- 0:00:58
108000 -- [-562.422] (-563.097) (-562.032) (-561.043) * (-562.047) (-560.731) (-560.990) [-560.295] -- 0:00:57
108500 -- (-562.171) (-564.673) (-563.506) [-563.098] * (-562.744) (-561.069) (-561.261) [-563.448] -- 0:00:57
109000 -- (-560.922) (-562.539) [-563.889] (-564.350) * (-561.305) [-560.376] (-564.770) (-565.016) -- 0:00:57
109500 -- (-561.430) [-561.797] (-561.184) (-562.440) * [-561.359] (-560.638) (-565.798) (-562.028) -- 0:00:56
110000 -- (-565.825) (-562.096) (-561.175) [-562.059] * (-562.880) (-560.891) (-562.475) [-564.691] -- 0:00:56
Average standard deviation of split frequencies: 0.025558
110500 -- (-566.940) (-563.997) [-563.859] (-560.704) * (-567.224) (-564.298) (-563.101) [-565.695] -- 0:00:56
111000 -- (-570.591) [-563.995] (-563.059) (-564.056) * [-565.821] (-563.217) (-561.586) (-560.887) -- 0:00:56
111500 -- [-562.669] (-561.547) (-562.238) (-560.718) * [-561.000] (-563.287) (-563.988) (-561.871) -- 0:00:55
112000 -- (-561.839) [-561.198] (-563.326) (-560.789) * (-560.990) (-561.929) (-564.787) [-560.991] -- 0:00:55
112500 -- (-562.381) [-561.370] (-561.955) (-562.857) * (-562.943) (-567.575) [-563.728] (-565.159) -- 0:00:55
113000 -- (-563.246) (-560.403) (-561.064) [-562.052] * (-563.940) (-566.129) (-563.193) [-561.704] -- 0:00:54
113500 -- (-564.746) [-560.489] (-562.756) (-564.085) * (-562.520) (-562.411) (-565.170) [-562.332] -- 0:00:54
114000 -- (-561.186) (-560.783) [-561.632] (-562.379) * (-564.453) [-561.953] (-560.672) (-563.348) -- 0:00:54
114500 -- (-561.338) (-561.618) [-562.245] (-563.077) * (-566.598) [-563.399] (-561.486) (-561.590) -- 0:01:01
115000 -- (-560.826) [-564.608] (-565.078) (-563.994) * (-561.043) (-564.274) (-562.390) [-560.521] -- 0:01:01
Average standard deviation of split frequencies: 0.024586
115500 -- (-560.884) (-562.046) [-564.311] (-564.478) * (-567.830) (-562.405) (-561.854) [-564.824] -- 0:01:01
116000 -- (-562.396) (-563.415) [-561.138] (-568.532) * (-564.856) (-561.808) (-566.282) [-562.717] -- 0:01:00
116500 -- (-563.992) [-564.532] (-565.442) (-565.115) * (-562.018) (-563.479) (-561.783) [-565.108] -- 0:01:00
117000 -- [-562.090] (-561.801) (-566.000) (-562.874) * (-563.389) (-563.502) [-562.341] (-565.047) -- 0:01:00
117500 -- [-562.408] (-562.104) (-565.443) (-561.587) * (-561.196) (-562.833) [-566.392] (-563.953) -- 0:01:00
118000 -- (-563.252) [-568.061] (-562.338) (-560.826) * (-560.430) (-563.443) [-564.631] (-560.282) -- 0:00:59
118500 -- (-561.829) (-564.179) [-563.202] (-565.067) * (-562.447) (-563.949) (-565.771) [-561.072] -- 0:00:59
119000 -- (-563.308) (-563.787) [-563.095] (-562.170) * [-562.098] (-560.909) (-562.632) (-562.621) -- 0:00:59
119500 -- (-561.844) (-564.663) (-562.336) [-561.808] * (-560.911) [-563.307] (-565.226) (-561.039) -- 0:00:58
120000 -- (-563.445) (-562.928) [-561.698] (-564.615) * [-561.544] (-566.395) (-569.337) (-564.145) -- 0:00:58
Average standard deviation of split frequencies: 0.024026
120500 -- (-561.237) (-564.354) [-565.214] (-567.458) * [-563.059] (-565.245) (-561.659) (-560.328) -- 0:00:58
121000 -- (-562.308) [-565.096] (-562.471) (-565.817) * [-560.766] (-560.884) (-561.488) (-561.290) -- 0:00:58
121500 -- (-561.233) [-563.637] (-563.885) (-563.139) * [-560.545] (-562.190) (-561.353) (-563.033) -- 0:00:57
122000 -- (-562.209) (-561.637) [-562.173] (-567.835) * (-565.796) (-562.694) [-562.856] (-565.146) -- 0:00:57
122500 -- (-564.578) [-562.026] (-560.452) (-564.596) * (-561.141) (-562.060) (-560.429) [-562.461] -- 0:00:57
123000 -- (-562.468) (-563.404) [-561.993] (-562.163) * (-564.002) (-561.969) [-561.871] (-561.923) -- 0:00:57
123500 -- (-564.426) (-562.082) [-560.552] (-560.806) * (-563.794) (-560.799) (-563.086) [-564.220] -- 0:00:56
124000 -- (-563.584) (-562.374) [-560.899] (-565.284) * (-561.112) (-561.328) (-566.536) [-562.198] -- 0:00:56
124500 -- (-560.290) [-561.998] (-567.709) (-562.703) * (-562.797) (-561.971) [-564.203] (-563.206) -- 0:00:56
125000 -- (-560.449) [-561.041] (-561.858) (-562.628) * [-561.496] (-562.201) (-562.510) (-564.732) -- 0:00:56
Average standard deviation of split frequencies: 0.023383
125500 -- [-561.681] (-564.020) (-562.096) (-561.218) * (-562.867) (-567.492) [-562.116] (-561.584) -- 0:00:55
126000 -- (-561.151) (-562.150) (-561.766) [-561.390] * [-564.681] (-565.144) (-563.279) (-562.141) -- 0:00:55
126500 -- (-561.467) [-561.841] (-560.640) (-562.294) * (-565.133) [-563.049] (-565.642) (-560.858) -- 0:00:55
127000 -- (-561.824) [-563.359] (-562.289) (-561.156) * (-562.665) (-562.939) [-565.826] (-567.481) -- 0:00:54
127500 -- (-562.427) [-563.623] (-564.375) (-560.368) * (-568.200) (-565.004) [-564.812] (-566.434) -- 0:00:54
128000 -- (-565.632) [-563.514] (-563.516) (-560.476) * (-564.043) (-560.310) (-562.922) [-562.864] -- 0:00:54
128500 -- (-562.236) (-561.696) [-561.328] (-563.060) * (-561.433) (-560.310) [-563.561] (-561.484) -- 0:00:54
129000 -- (-564.063) [-561.932] (-562.461) (-562.007) * (-564.487) (-560.598) (-562.082) [-563.970] -- 0:00:54
129500 -- (-565.691) [-561.644] (-563.721) (-560.774) * (-564.420) [-561.743] (-562.674) (-563.582) -- 0:00:53
130000 -- [-561.368] (-561.346) (-562.746) (-561.320) * (-562.463) (-562.808) [-562.041] (-561.257) -- 0:00:53
Average standard deviation of split frequencies: 0.023735
130500 -- (-561.960) (-561.415) (-562.538) [-561.418] * [-562.674] (-561.898) (-563.847) (-563.149) -- 0:00:59
131000 -- (-564.952) (-561.174) (-562.536) [-564.445] * (-561.146) (-561.941) [-566.058] (-564.212) -- 0:00:59
131500 -- (-564.676) [-562.999] (-560.859) (-562.251) * (-561.242) (-561.754) (-560.426) [-561.369] -- 0:00:59
132000 -- (-563.367) (-564.114) [-561.155] (-561.921) * (-563.210) (-562.575) [-560.310] (-561.328) -- 0:00:59
132500 -- [-566.062] (-564.896) (-561.402) (-562.441) * (-562.481) [-564.621] (-560.185) (-561.031) -- 0:00:58
133000 -- [-560.508] (-564.694) (-562.149) (-562.817) * (-561.246) [-561.288] (-561.739) (-563.842) -- 0:00:58
133500 -- (-562.272) [-563.321] (-561.858) (-564.702) * (-562.178) (-561.042) (-561.678) [-562.850] -- 0:00:58
134000 -- (-565.069) (-567.409) [-562.440] (-563.673) * (-562.048) [-562.755] (-575.798) (-561.191) -- 0:00:58
134500 -- (-564.701) [-564.887] (-563.565) (-561.717) * (-562.657) (-564.387) [-564.393] (-561.615) -- 0:00:57
135000 -- (-565.158) [-562.357] (-561.617) (-561.236) * (-561.682) [-561.562] (-565.424) (-562.236) -- 0:00:57
Average standard deviation of split frequencies: 0.022877
135500 -- (-562.395) [-562.294] (-563.412) (-565.281) * (-563.386) [-561.935] (-561.415) (-571.881) -- 0:00:57
136000 -- (-564.283) (-561.564) [-562.974] (-564.666) * (-563.346) (-561.375) (-564.865) [-564.105] -- 0:00:57
136500 -- (-564.422) (-562.646) [-562.990] (-562.477) * (-563.255) [-560.606] (-562.781) (-566.311) -- 0:00:56
137000 -- (-561.032) (-564.175) [-561.536] (-562.834) * (-561.477) [-562.076] (-561.750) (-562.083) -- 0:00:56
137500 -- (-562.757) [-561.690] (-567.713) (-563.205) * [-561.181] (-562.865) (-560.694) (-562.184) -- 0:00:56
138000 -- (-562.347) [-562.673] (-561.504) (-561.109) * (-561.540) (-561.407) (-562.152) [-562.222] -- 0:00:56
138500 -- (-565.262) (-562.148) (-564.854) [-563.107] * (-562.705) (-562.620) (-561.335) [-563.437] -- 0:00:55
139000 -- (-561.506) (-563.163) [-562.801] (-561.186) * (-564.922) [-560.702] (-563.974) (-563.124) -- 0:00:55
139500 -- (-563.882) (-561.272) (-562.074) [-563.768] * [-562.505] (-561.916) (-565.236) (-566.016) -- 0:00:55
140000 -- (-565.646) (-563.327) [-561.938] (-562.144) * [-561.506] (-560.977) (-560.434) (-568.834) -- 0:00:55
Average standard deviation of split frequencies: 0.023988
140500 -- (-561.727) [-561.159] (-563.685) (-562.347) * (-564.908) (-566.154) [-563.210] (-568.075) -- 0:00:55
141000 -- [-561.931] (-560.523) (-562.333) (-562.085) * (-563.860) (-566.782) [-561.348] (-562.238) -- 0:00:54
141500 -- [-561.974] (-562.934) (-560.883) (-564.958) * (-566.214) [-561.793] (-562.301) (-562.839) -- 0:00:54
142000 -- (-563.446) (-562.568) [-561.978] (-564.789) * [-561.845] (-562.931) (-560.999) (-560.741) -- 0:00:54
142500 -- (-560.964) (-565.027) (-560.652) [-562.568] * (-563.213) (-562.574) [-561.634] (-562.028) -- 0:00:54
143000 -- (-560.507) (-561.255) [-561.754] (-566.509) * (-561.616) [-561.874] (-562.586) (-562.368) -- 0:00:53
143500 -- (-568.456) [-560.595] (-563.401) (-565.831) * (-562.375) [-561.397] (-562.305) (-560.587) -- 0:00:53
144000 -- (-566.350) (-565.619) (-564.893) [-560.803] * (-561.957) [-562.247] (-562.261) (-562.937) -- 0:00:53
144500 -- (-565.346) (-560.644) [-561.219] (-563.634) * [-561.437] (-562.644) (-562.200) (-561.905) -- 0:00:53
145000 -- [-561.084] (-565.739) (-562.312) (-563.703) * (-561.162) (-563.408) (-561.802) [-562.712] -- 0:00:53
Average standard deviation of split frequencies: 0.023247
145500 -- (-563.754) (-564.927) (-561.520) [-565.533] * (-563.011) [-562.006] (-565.157) (-561.747) -- 0:00:52
146000 -- (-561.477) (-568.505) [-561.758] (-564.216) * (-562.460) (-561.525) (-562.229) [-562.632] -- 0:00:52
146500 -- (-561.438) (-563.148) [-564.695] (-561.223) * (-563.273) (-560.628) [-561.904] (-563.437) -- 0:00:52
147000 -- [-563.099] (-562.317) (-561.451) (-562.140) * (-563.031) (-561.047) [-561.568] (-565.957) -- 0:00:52
147500 -- (-562.354) [-561.494] (-562.305) (-562.562) * [-560.666] (-561.925) (-560.487) (-560.441) -- 0:00:57
148000 -- (-564.587) (-561.126) [-560.482] (-562.870) * (-561.443) (-564.487) [-561.017] (-561.371) -- 0:00:57
148500 -- (-561.161) [-561.293] (-563.952) (-560.734) * (-563.380) (-566.044) (-561.279) [-561.881] -- 0:00:57
149000 -- [-560.863] (-562.070) (-561.235) (-560.642) * [-562.635] (-560.355) (-561.128) (-563.732) -- 0:00:57
149500 -- (-561.921) [-562.683] (-563.308) (-563.618) * (-564.943) (-561.391) [-560.720] (-564.514) -- 0:00:56
150000 -- (-563.368) [-563.417] (-563.173) (-564.118) * [-564.120] (-562.783) (-561.054) (-561.932) -- 0:00:56
Average standard deviation of split frequencies: 0.025500
150500 -- (-561.117) (-563.832) [-565.577] (-565.123) * (-564.061) [-562.459] (-561.775) (-562.100) -- 0:00:56
151000 -- (-560.587) [-564.528] (-565.049) (-562.955) * [-565.218] (-563.127) (-562.115) (-562.795) -- 0:00:56
151500 -- (-565.493) (-563.621) (-564.144) [-561.701] * (-561.276) [-561.247] (-563.174) (-561.082) -- 0:00:56
152000 -- (-562.213) [-562.067] (-568.513) (-565.566) * (-560.624) (-565.231) [-561.496] (-560.832) -- 0:00:55
152500 -- (-561.504) [-560.842] (-565.598) (-565.782) * (-563.558) (-563.854) (-560.537) [-561.314] -- 0:00:55
153000 -- (-563.634) (-563.035) (-562.543) [-560.995] * [-563.050] (-565.779) (-563.218) (-563.055) -- 0:00:55
153500 -- (-562.541) (-562.329) (-564.308) [-562.537] * (-562.380) [-561.915] (-561.290) (-560.970) -- 0:00:55
154000 -- (-563.304) (-561.601) (-563.364) [-561.729] * (-560.984) [-563.807] (-561.482) (-564.424) -- 0:00:54
154500 -- (-568.862) [-562.773] (-565.447) (-562.606) * [-561.663] (-566.164) (-561.233) (-563.771) -- 0:00:54
155000 -- (-564.283) (-564.288) (-562.790) [-560.764] * [-563.032] (-562.731) (-564.208) (-562.007) -- 0:00:54
Average standard deviation of split frequencies: 0.025518
155500 -- (-564.881) [-565.244] (-561.872) (-563.131) * (-561.139) (-561.732) [-563.447] (-567.237) -- 0:00:54
156000 -- (-562.776) (-563.061) [-562.586] (-563.163) * (-562.409) (-561.975) [-560.873] (-566.710) -- 0:00:54
156500 -- (-563.646) (-561.770) (-564.557) [-563.330] * [-563.065] (-562.099) (-560.388) (-568.898) -- 0:00:53
157000 -- [-562.503] (-563.629) (-560.778) (-560.283) * (-567.801) (-562.262) [-561.312] (-561.670) -- 0:00:53
157500 -- (-561.019) (-565.377) (-562.545) [-561.581] * (-562.917) (-561.998) [-564.664] (-563.344) -- 0:00:53
158000 -- (-563.777) (-564.238) (-561.484) [-561.265] * [-561.210] (-562.265) (-563.148) (-563.736) -- 0:00:53
158500 -- [-561.324] (-560.809) (-562.899) (-566.455) * (-561.415) [-561.266] (-563.044) (-564.442) -- 0:00:53
159000 -- (-565.588) [-562.139] (-561.394) (-565.339) * [-562.061] (-567.915) (-560.387) (-561.128) -- 0:00:52
159500 -- (-562.774) (-562.936) [-561.815] (-568.443) * (-561.131) (-560.722) [-562.346] (-561.472) -- 0:00:52
160000 -- [-562.622] (-565.483) (-562.263) (-569.353) * [-561.990] (-560.838) (-560.921) (-562.266) -- 0:00:52
Average standard deviation of split frequencies: 0.022546
160500 -- (-564.649) [-561.829] (-563.750) (-563.173) * (-560.593) [-563.950] (-561.605) (-562.592) -- 0:00:52
161000 -- (-564.126) (-562.474) (-566.284) [-561.861] * (-563.706) [-561.495] (-562.665) (-563.961) -- 0:00:52
161500 -- (-563.044) [-561.227] (-562.997) (-561.863) * [-562.745] (-569.286) (-560.631) (-561.015) -- 0:00:51
162000 -- (-561.671) (-561.969) (-563.338) [-561.939] * (-562.540) [-562.224] (-562.682) (-561.806) -- 0:00:51
162500 -- (-560.438) (-562.938) (-561.304) [-562.284] * [-561.922] (-567.499) (-562.981) (-562.577) -- 0:00:51
163000 -- [-562.663] (-563.738) (-560.848) (-562.826) * (-562.449) (-564.319) [-561.608] (-563.074) -- 0:00:51
163500 -- (-562.143) [-563.017] (-561.170) (-562.633) * (-562.106) (-561.925) (-563.032) [-563.732] -- 0:00:51
164000 -- [-560.969] (-560.961) (-561.040) (-562.454) * (-565.675) (-560.992) [-566.198] (-562.483) -- 0:00:56
164500 -- (-564.376) [-561.293] (-563.099) (-562.891) * [-568.547] (-561.173) (-562.244) (-562.965) -- 0:00:55
165000 -- [-561.585] (-563.585) (-564.679) (-562.925) * (-566.220) [-561.489] (-568.102) (-563.394) -- 0:00:55
Average standard deviation of split frequencies: 0.022270
165500 -- [-560.525] (-563.194) (-562.760) (-565.846) * [-563.186] (-561.843) (-566.541) (-563.124) -- 0:00:55
166000 -- (-562.695) [-562.315] (-563.259) (-562.347) * (-562.091) (-564.110) (-561.247) [-564.111] -- 0:00:55
166500 -- (-564.189) (-570.184) [-561.871] (-561.589) * [-562.083] (-561.705) (-561.518) (-565.443) -- 0:00:55
167000 -- (-562.078) [-561.947] (-567.509) (-562.986) * (-561.504) (-563.680) [-560.925] (-562.875) -- 0:00:54
167500 -- (-564.188) (-562.482) (-561.537) [-563.107] * [-562.352] (-563.370) (-562.075) (-563.474) -- 0:00:54
168000 -- (-563.932) (-563.661) (-561.311) [-561.770] * (-562.291) (-562.164) (-561.489) [-562.995] -- 0:00:54
168500 -- (-562.551) [-562.851] (-562.024) (-561.196) * [-561.930] (-562.744) (-565.071) (-563.211) -- 0:00:54
169000 -- (-562.549) (-563.346) (-564.371) [-562.023] * [-561.560] (-561.134) (-563.030) (-565.959) -- 0:00:54
169500 -- [-560.684] (-563.018) (-565.014) (-562.579) * (-561.216) [-563.017] (-562.243) (-561.322) -- 0:00:53
170000 -- [-562.765] (-562.647) (-565.398) (-568.214) * (-560.538) (-562.976) [-561.196] (-568.322) -- 0:00:53
Average standard deviation of split frequencies: 0.022711
170500 -- (-560.780) (-563.663) [-562.879] (-563.621) * (-561.273) [-561.710] (-564.113) (-561.491) -- 0:00:53
171000 -- (-561.627) (-562.069) (-563.879) [-561.255] * (-561.370) [-561.564] (-564.908) (-564.252) -- 0:00:53
171500 -- [-562.361] (-566.602) (-563.321) (-563.210) * [-563.768] (-563.458) (-562.225) (-562.726) -- 0:00:53
172000 -- (-565.991) (-566.770) [-562.697] (-563.774) * [-562.471] (-563.138) (-560.922) (-561.241) -- 0:00:52
172500 -- (-565.601) [-562.138] (-565.802) (-565.171) * (-564.491) (-561.656) [-561.653] (-567.642) -- 0:00:52
173000 -- (-564.750) (-563.650) [-569.029] (-563.364) * (-566.643) [-561.151] (-562.249) (-564.068) -- 0:00:52
173500 -- (-562.924) [-561.487] (-562.234) (-561.072) * [-563.141] (-562.058) (-566.496) (-563.712) -- 0:00:52
174000 -- (-560.588) [-562.056] (-564.310) (-561.469) * (-566.180) (-562.754) [-565.639] (-564.468) -- 0:00:52
174500 -- [-560.426] (-561.049) (-561.527) (-560.807) * (-565.694) [-561.464] (-564.592) (-562.676) -- 0:00:52
175000 -- (-560.832) [-561.032] (-565.261) (-562.407) * (-561.313) [-563.110] (-565.279) (-561.810) -- 0:00:51
Average standard deviation of split frequencies: 0.022215
175500 -- [-562.074] (-563.274) (-565.198) (-567.172) * (-564.095) [-562.655] (-561.731) (-564.085) -- 0:00:51
176000 -- [-563.274] (-560.851) (-565.569) (-565.692) * (-562.210) [-562.202] (-561.424) (-562.452) -- 0:00:51
176500 -- (-561.482) (-562.249) (-562.637) [-565.033] * [-565.994] (-565.089) (-562.332) (-565.192) -- 0:00:51
177000 -- [-561.074] (-561.228) (-563.424) (-562.799) * [-569.348] (-561.275) (-560.940) (-561.197) -- 0:00:51
177500 -- (-561.173) (-563.836) (-563.133) [-564.766] * (-565.136) (-562.770) [-561.106] (-560.311) -- 0:00:50
178000 -- (-562.230) [-563.198] (-564.389) (-561.006) * (-561.758) (-563.782) [-560.612] (-560.573) -- 0:00:50
178500 -- (-567.228) (-561.031) (-563.025) [-562.048] * (-564.727) [-563.451] (-562.027) (-562.199) -- 0:00:50
179000 -- [-563.405] (-563.339) (-563.104) (-562.712) * (-564.131) [-561.755] (-562.559) (-562.075) -- 0:00:50
179500 -- (-564.453) (-563.333) [-561.104] (-561.865) * (-564.038) (-562.103) [-562.083] (-563.044) -- 0:00:50
180000 -- (-561.512) (-561.214) (-561.593) [-561.276] * (-561.928) (-561.538) [-563.530] (-562.690) -- 0:00:50
Average standard deviation of split frequencies: 0.022562
180500 -- (-563.433) [-561.794] (-561.175) (-561.676) * (-564.148) [-562.484] (-562.628) (-564.070) -- 0:00:54
181000 -- [-561.726] (-560.691) (-562.116) (-565.869) * (-563.177) (-560.589) [-560.981] (-566.378) -- 0:00:54
181500 -- (-563.253) (-562.244) (-560.985) [-562.998] * [-561.101] (-563.335) (-566.716) (-561.874) -- 0:00:54
182000 -- (-563.943) (-560.841) [-561.014] (-562.342) * (-561.280) (-562.032) (-560.583) [-561.333] -- 0:00:53
182500 -- (-563.693) (-562.045) (-565.095) [-562.609] * (-562.964) [-561.924] (-562.157) (-562.787) -- 0:00:53
183000 -- (-563.762) (-561.254) (-561.353) [-562.819] * (-563.361) [-563.916] (-561.964) (-568.870) -- 0:00:53
183500 -- (-561.136) (-562.388) (-562.201) [-560.844] * (-565.749) (-563.751) [-561.679] (-563.843) -- 0:00:53
184000 -- (-561.087) (-562.490) [-567.470] (-563.580) * (-564.682) (-560.448) (-561.056) [-562.044] -- 0:00:53
184500 -- (-563.990) (-563.326) (-565.521) [-562.625] * (-563.217) (-560.836) [-562.082] (-563.170) -- 0:00:53
185000 -- [-563.914] (-561.732) (-564.415) (-560.537) * (-562.655) [-564.832] (-561.927) (-563.987) -- 0:00:52
Average standard deviation of split frequencies: 0.023232
185500 -- (-564.546) (-562.645) [-565.699] (-561.723) * (-564.027) [-560.963] (-561.041) (-562.712) -- 0:00:52
186000 -- (-563.019) [-560.896] (-560.746) (-560.241) * [-563.489] (-563.490) (-560.930) (-561.455) -- 0:00:52
186500 -- [-562.083] (-562.196) (-562.032) (-564.149) * (-560.715) (-564.086) (-564.827) [-565.609] -- 0:00:52
187000 -- [-561.530] (-562.760) (-561.614) (-563.511) * [-563.217] (-560.999) (-563.574) (-564.951) -- 0:00:52
187500 -- [-561.659] (-568.517) (-562.843) (-562.480) * (-567.077) (-560.950) [-561.372] (-562.258) -- 0:00:52
188000 -- (-565.589) (-564.414) [-560.864] (-560.334) * (-566.656) (-561.247) [-561.112] (-562.372) -- 0:00:51
188500 -- (-563.529) (-563.620) (-563.042) [-563.185] * [-565.905] (-563.050) (-562.597) (-562.698) -- 0:00:51
189000 -- (-561.386) [-563.586] (-563.229) (-564.676) * (-562.115) (-566.045) (-562.462) [-565.935] -- 0:00:51
189500 -- (-561.295) [-561.851] (-562.087) (-565.013) * (-561.964) (-563.314) [-561.270] (-562.998) -- 0:00:51
190000 -- [-562.704] (-561.318) (-561.591) (-561.169) * (-567.416) (-562.596) [-560.627] (-562.709) -- 0:00:51
Average standard deviation of split frequencies: 0.022252
190500 -- [-562.224] (-562.894) (-561.229) (-564.029) * (-562.891) (-561.709) [-561.497] (-562.846) -- 0:00:50
191000 -- (-563.898) [-567.130] (-563.334) (-565.996) * (-561.676) (-562.148) (-561.201) [-565.183] -- 0:00:50
191500 -- [-560.284] (-561.372) (-560.734) (-563.128) * (-562.426) (-561.934) [-560.378] (-562.132) -- 0:00:50
192000 -- [-560.528] (-561.214) (-565.467) (-560.648) * [-563.116] (-561.984) (-563.942) (-563.623) -- 0:00:50
192500 -- (-562.834) (-561.165) [-562.988] (-562.162) * (-563.111) (-562.718) (-562.689) [-560.734] -- 0:00:50
193000 -- (-562.655) (-562.265) [-561.574] (-560.966) * (-560.957) [-562.534] (-561.678) (-563.981) -- 0:00:50
193500 -- (-561.328) [-561.780] (-562.974) (-564.318) * (-560.418) (-564.440) (-564.876) [-565.754] -- 0:00:54
194000 -- (-564.387) (-562.166) (-564.106) [-563.019] * [-562.387] (-565.225) (-564.534) (-563.857) -- 0:00:54
194500 -- [-561.465] (-567.045) (-563.114) (-563.579) * [-563.763] (-564.957) (-561.536) (-563.628) -- 0:00:53
195000 -- (-561.142) (-563.456) [-566.437] (-564.821) * (-564.501) (-561.130) (-561.549) [-563.103] -- 0:00:53
Average standard deviation of split frequencies: 0.022448
195500 -- (-561.821) (-563.147) [-561.432] (-567.042) * (-563.759) [-562.059] (-560.933) (-562.912) -- 0:00:53
196000 -- (-562.619) (-561.437) [-562.477] (-564.706) * [-564.563] (-566.675) (-561.350) (-565.114) -- 0:00:53
196500 -- (-560.266) (-565.406) (-562.424) [-564.813] * [-561.710] (-561.840) (-564.091) (-561.318) -- 0:00:53
197000 -- [-561.070] (-561.911) (-564.035) (-567.435) * [-562.105] (-563.149) (-562.256) (-563.664) -- 0:00:52
197500 -- (-560.291) (-562.068) [-566.674] (-561.693) * (-563.683) (-562.986) [-561.856] (-563.263) -- 0:00:52
198000 -- (-562.027) (-561.482) [-564.394] (-565.536) * [-562.365] (-561.182) (-563.410) (-563.939) -- 0:00:52
198500 -- (-564.256) (-564.592) [-566.077] (-562.223) * [-563.851] (-560.615) (-563.254) (-561.675) -- 0:00:52
199000 -- (-562.912) (-560.759) (-565.972) [-561.015] * (-563.396) [-561.793] (-566.136) (-561.775) -- 0:00:52
199500 -- [-560.917] (-561.685) (-562.287) (-561.206) * (-561.240) (-561.640) (-561.570) [-563.354] -- 0:00:52
200000 -- [-562.960] (-562.466) (-561.902) (-561.297) * (-562.829) (-561.870) (-561.767) [-562.862] -- 0:00:51
Average standard deviation of split frequencies: 0.022970
200500 -- (-562.047) (-563.483) (-568.462) [-560.779] * [-562.009] (-564.673) (-565.444) (-562.514) -- 0:00:51
201000 -- (-561.551) (-562.062) [-564.596] (-562.050) * (-560.485) [-562.614] (-566.811) (-565.949) -- 0:00:51
201500 -- (-561.041) [-563.773] (-563.231) (-561.932) * [-560.539] (-562.310) (-566.912) (-562.154) -- 0:00:51
202000 -- [-561.188] (-561.469) (-560.800) (-563.090) * (-563.005) [-560.699] (-563.078) (-563.689) -- 0:00:51
202500 -- (-561.251) (-568.284) [-564.687] (-564.034) * (-565.675) (-562.736) [-563.381] (-563.992) -- 0:00:51
203000 -- (-563.889) [-563.469] (-563.753) (-563.877) * (-564.222) (-563.801) [-561.405] (-561.408) -- 0:00:51
203500 -- [-561.452] (-565.767) (-564.095) (-566.214) * (-561.207) (-562.649) (-562.038) [-561.883] -- 0:00:50
204000 -- (-560.908) (-562.780) (-563.711) [-561.821] * (-561.273) (-563.938) (-564.424) [-560.759] -- 0:00:50
204500 -- (-561.327) [-564.879] (-563.578) (-562.512) * (-562.408) (-560.741) (-565.852) [-564.792] -- 0:00:50
205000 -- [-561.327] (-564.459) (-563.344) (-562.358) * [-561.724] (-562.087) (-564.253) (-563.712) -- 0:00:50
Average standard deviation of split frequencies: 0.023245
205500 -- [-562.929] (-564.002) (-565.853) (-560.366) * [-563.233] (-562.180) (-564.310) (-563.554) -- 0:00:50
206000 -- [-561.958] (-561.851) (-563.635) (-563.778) * (-562.092) (-563.565) (-560.673) [-567.234] -- 0:00:50
206500 -- (-562.700) (-563.055) (-563.459) [-563.471] * [-562.436] (-567.223) (-562.982) (-561.085) -- 0:00:49
207000 -- [-562.479] (-563.052) (-564.137) (-564.764) * (-564.553) (-563.248) (-562.677) [-560.508] -- 0:00:49
207500 -- (-563.449) (-561.109) [-562.923] (-563.025) * (-562.651) (-562.975) (-566.652) [-561.596] -- 0:00:49
208000 -- (-562.863) (-565.253) [-565.022] (-561.962) * [-561.154] (-569.959) (-562.745) (-560.494) -- 0:00:49
208500 -- (-563.664) (-560.943) [-562.932] (-561.885) * (-560.920) (-563.571) [-560.988] (-562.026) -- 0:00:49
209000 -- [-560.927] (-564.685) (-561.592) (-562.993) * (-561.874) (-563.327) [-563.585] (-560.746) -- 0:00:52
209500 -- (-562.113) [-565.092] (-561.699) (-565.500) * (-567.194) (-564.086) (-562.342) [-562.143] -- 0:00:52
210000 -- (-565.080) (-561.388) [-564.086] (-562.565) * [-560.903] (-561.379) (-563.815) (-562.172) -- 0:00:52
Average standard deviation of split frequencies: 0.022750
210500 -- (-563.000) [-562.672] (-564.242) (-566.316) * [-562.378] (-562.336) (-562.361) (-560.615) -- 0:00:52
211000 -- [-561.775] (-560.811) (-566.467) (-564.161) * (-561.477) [-561.806] (-561.798) (-562.534) -- 0:00:52
211500 -- (-561.429) (-560.909) (-562.354) [-560.886] * (-563.425) (-562.313) (-561.118) [-560.679] -- 0:00:52
212000 -- [-561.105] (-562.529) (-566.600) (-561.903) * (-563.502) (-563.351) [-562.335] (-560.963) -- 0:00:52
212500 -- (-563.019) [-563.421] (-562.614) (-563.749) * (-560.851) (-563.303) [-561.161] (-563.855) -- 0:00:51
213000 -- [-561.319] (-560.908) (-564.263) (-562.667) * (-563.783) [-560.785] (-562.173) (-563.422) -- 0:00:51
213500 -- (-561.662) (-561.337) [-562.116] (-562.948) * [-560.960] (-562.937) (-562.931) (-564.836) -- 0:00:51
214000 -- (-563.160) (-563.379) (-564.737) [-560.870] * (-563.518) (-567.576) (-563.573) [-563.149] -- 0:00:51
214500 -- (-562.019) (-561.559) [-561.258] (-562.033) * (-565.248) (-566.844) [-562.957] (-563.082) -- 0:00:51
215000 -- [-561.878] (-567.373) (-566.180) (-564.585) * (-561.823) [-564.602] (-561.434) (-561.490) -- 0:00:51
Average standard deviation of split frequencies: 0.020006
215500 -- (-562.336) (-564.230) [-562.954] (-562.562) * [-563.445] (-562.740) (-562.048) (-562.414) -- 0:00:50
216000 -- (-563.789) (-562.584) (-561.916) [-564.296] * [-560.655] (-565.145) (-564.345) (-566.037) -- 0:00:50
216500 -- (-564.064) (-563.473) (-562.412) [-563.609] * (-561.484) [-562.169] (-564.470) (-562.102) -- 0:00:50
217000 -- [-564.691] (-562.642) (-561.299) (-563.363) * (-563.382) (-562.448) (-563.130) [-561.601] -- 0:00:50
217500 -- (-564.842) [-563.647] (-562.161) (-563.035) * (-563.019) (-562.667) [-562.449] (-564.145) -- 0:00:50
218000 -- [-560.613] (-561.613) (-560.915) (-562.331) * [-565.408] (-564.783) (-564.536) (-563.772) -- 0:00:50
218500 -- (-565.753) (-560.457) (-560.286) [-562.259] * (-564.776) (-564.121) [-567.948] (-562.601) -- 0:00:50
219000 -- [-563.007] (-564.737) (-565.546) (-565.360) * (-560.657) (-562.711) (-564.654) [-562.302] -- 0:00:49
219500 -- (-567.202) [-564.009] (-563.678) (-564.491) * (-561.349) (-561.157) [-561.854] (-561.744) -- 0:00:49
220000 -- (-565.482) (-566.612) [-564.527] (-567.166) * (-560.309) (-566.326) (-561.903) [-560.602] -- 0:00:49
Average standard deviation of split frequencies: 0.020413
220500 -- (-562.629) (-564.884) (-562.744) [-562.668] * (-561.249) (-563.893) (-562.272) [-563.053] -- 0:00:49
221000 -- (-561.321) (-565.858) [-565.324] (-561.450) * [-561.467] (-563.664) (-562.367) (-561.871) -- 0:00:49
221500 -- (-560.902) (-565.294) [-563.059] (-563.853) * (-561.544) (-564.099) [-560.578] (-562.315) -- 0:00:49
222000 -- (-564.741) [-563.778] (-562.703) (-561.042) * [-560.728] (-561.441) (-562.618) (-561.080) -- 0:00:49
222500 -- [-562.947] (-565.119) (-565.746) (-566.122) * (-562.462) (-562.223) (-566.997) [-562.320] -- 0:00:48
223000 -- (-561.209) (-571.884) (-566.374) [-563.282] * (-563.474) (-562.372) (-561.924) [-564.314] -- 0:00:48
223500 -- (-561.216) (-564.806) [-563.145] (-561.234) * [-561.753] (-561.097) (-561.634) (-564.590) -- 0:00:48
224000 -- [-561.757] (-565.081) (-561.179) (-563.940) * (-562.044) [-564.148] (-562.487) (-566.996) -- 0:00:48
224500 -- [-560.695] (-560.485) (-561.192) (-561.278) * (-561.902) [-565.139] (-563.024) (-562.838) -- 0:00:48
225000 -- (-561.607) (-560.417) (-563.387) [-561.052] * (-562.511) (-563.350) (-567.621) [-563.191] -- 0:00:48
Average standard deviation of split frequencies: 0.019584
225500 -- (-562.963) (-562.855) [-562.026] (-560.888) * [-563.746] (-562.190) (-568.858) (-561.881) -- 0:00:51
226000 -- (-566.472) [-563.506] (-561.794) (-561.760) * (-566.543) (-561.260) (-565.455) [-562.248] -- 0:00:51
226500 -- (-561.512) (-564.387) (-561.088) [-561.876] * (-562.917) (-560.735) [-565.468] (-563.106) -- 0:00:51
227000 -- (-564.771) [-563.494] (-561.773) (-562.432) * (-562.234) [-562.288] (-564.763) (-562.587) -- 0:00:51
227500 -- [-565.601] (-563.472) (-563.783) (-562.432) * (-562.710) [-561.235] (-561.898) (-561.617) -- 0:00:50
228000 -- (-562.795) (-564.689) [-562.164] (-562.427) * [-562.967] (-562.241) (-562.283) (-561.723) -- 0:00:50
228500 -- (-568.216) (-563.598) [-563.719] (-562.895) * (-562.154) [-564.187] (-563.727) (-563.519) -- 0:00:50
229000 -- (-567.288) (-564.813) (-561.515) [-562.472] * (-563.403) [-561.729] (-560.716) (-561.228) -- 0:00:50
229500 -- (-563.730) (-563.967) (-565.019) [-561.528] * [-560.827] (-567.741) (-560.908) (-562.000) -- 0:00:50
230000 -- [-564.581] (-563.161) (-568.638) (-562.476) * (-566.196) [-560.981] (-561.558) (-563.044) -- 0:00:50
Average standard deviation of split frequencies: 0.020437
230500 -- (-561.614) (-561.759) (-567.679) [-564.908] * (-562.049) [-560.560] (-562.255) (-562.548) -- 0:00:50
231000 -- (-562.157) (-563.189) [-563.437] (-560.750) * (-562.682) (-561.651) [-562.816] (-561.268) -- 0:00:49
231500 -- (-561.350) [-562.304] (-567.776) (-562.015) * (-562.577) (-563.000) (-562.470) [-562.050] -- 0:00:49
232000 -- (-561.099) [-563.351] (-564.174) (-561.953) * (-565.059) (-560.882) (-566.479) [-564.831] -- 0:00:49
232500 -- (-560.875) (-560.793) [-563.366] (-561.107) * (-561.857) (-561.745) (-562.600) [-563.980] -- 0:00:49
233000 -- [-562.632] (-561.386) (-562.213) (-561.107) * (-562.620) (-561.907) [-565.108] (-561.432) -- 0:00:49
233500 -- (-561.735) [-562.855] (-562.040) (-565.582) * (-563.346) (-565.605) [-561.685] (-562.423) -- 0:00:49
234000 -- (-561.500) (-562.435) [-561.808] (-565.848) * (-562.549) (-561.344) (-564.572) [-561.578] -- 0:00:49
234500 -- (-562.904) (-564.058) (-561.585) [-562.551] * (-561.560) [-561.982] (-561.923) (-561.915) -- 0:00:48
235000 -- (-562.523) (-562.151) (-563.263) [-565.944] * (-562.794) (-565.699) (-566.650) [-561.882] -- 0:00:48
Average standard deviation of split frequencies: 0.020530
235500 -- (-562.785) [-562.969] (-561.891) (-563.675) * (-563.221) (-564.096) [-561.531] (-563.054) -- 0:00:48
236000 -- (-563.276) (-562.601) [-561.618] (-567.568) * [-563.960] (-564.589) (-560.798) (-564.691) -- 0:00:48
236500 -- (-566.630) (-561.538) [-561.788] (-561.742) * (-562.918) (-562.961) (-565.660) [-560.624] -- 0:00:48
237000 -- (-565.104) [-561.359] (-561.551) (-563.043) * (-562.174) (-562.474) [-563.864] (-563.591) -- 0:00:48
237500 -- (-567.398) (-564.951) (-563.478) [-561.495] * (-562.582) (-563.119) [-561.023] (-564.535) -- 0:00:48
238000 -- (-561.886) (-561.110) [-563.863] (-560.901) * (-563.396) (-563.452) (-560.807) [-560.685] -- 0:00:48
238500 -- (-561.923) (-563.483) (-565.241) [-561.056] * [-562.791] (-564.781) (-560.570) (-562.292) -- 0:00:47
239000 -- (-561.875) (-562.843) [-561.301] (-562.175) * [-561.758] (-560.913) (-563.704) (-561.754) -- 0:00:47
239500 -- (-561.410) [-561.757] (-562.024) (-563.070) * (-563.189) (-560.726) (-564.629) [-562.899] -- 0:00:47
240000 -- (-562.101) (-562.506) [-562.725] (-563.055) * (-562.346) (-561.639) (-563.223) [-563.707] -- 0:00:47
Average standard deviation of split frequencies: 0.021111
240500 -- [-561.824] (-562.763) (-561.272) (-562.616) * [-563.214] (-561.791) (-562.485) (-573.193) -- 0:00:47
241000 -- (-564.367) (-562.058) [-565.072] (-561.755) * (-562.861) (-562.110) (-561.923) [-563.166] -- 0:00:47
241500 -- (-562.362) [-565.622] (-562.962) (-561.406) * (-562.864) (-564.729) [-563.546] (-562.450) -- 0:00:47
242000 -- (-569.925) (-562.752) (-565.770) [-562.766] * (-563.023) [-560.816] (-562.467) (-561.811) -- 0:00:46
242500 -- (-565.621) (-562.103) [-560.803] (-563.094) * [-562.903] (-563.674) (-563.824) (-561.001) -- 0:00:49
243000 -- [-563.545] (-562.874) (-560.918) (-566.269) * [-565.458] (-560.462) (-560.926) (-563.313) -- 0:00:49
243500 -- (-562.037) (-561.757) (-561.078) [-565.591] * (-563.427) [-562.566] (-563.956) (-563.507) -- 0:00:49
244000 -- (-561.836) [-561.506] (-564.285) (-564.513) * (-565.523) [-561.276] (-563.185) (-561.613) -- 0:00:49
244500 -- (-563.864) (-561.833) [-561.352] (-563.481) * (-563.612) (-561.095) [-563.663] (-562.083) -- 0:00:49
245000 -- (-562.559) (-561.572) [-560.829] (-563.915) * (-561.080) [-560.879] (-562.482) (-560.916) -- 0:00:49
Average standard deviation of split frequencies: 0.019566
245500 -- (-562.308) [-564.173] (-562.711) (-563.978) * (-561.891) [-561.134] (-568.411) (-563.684) -- 0:00:49
246000 -- (-562.242) (-563.048) (-561.842) [-563.379] * (-564.470) [-561.241] (-565.535) (-566.413) -- 0:00:49
246500 -- (-560.802) [-560.328] (-564.114) (-562.761) * (-562.819) (-562.748) (-562.359) [-561.666] -- 0:00:48
247000 -- (-562.944) [-562.451] (-560.423) (-564.269) * (-563.086) (-567.116) (-567.533) [-562.019] -- 0:00:48
247500 -- (-560.490) (-561.735) (-565.338) [-561.102] * (-562.045) (-565.835) [-563.362] (-561.685) -- 0:00:48
248000 -- (-561.028) (-568.137) [-565.142] (-562.866) * (-565.569) (-563.033) [-561.845] (-562.376) -- 0:00:48
248500 -- (-564.333) (-566.723) (-561.607) [-563.023] * (-562.899) (-561.235) [-561.351] (-562.793) -- 0:00:48
249000 -- (-563.533) (-560.887) [-565.317] (-561.553) * [-560.703] (-562.635) (-561.990) (-563.917) -- 0:00:48
249500 -- (-560.792) (-562.019) (-564.982) [-566.389] * (-562.877) (-561.431) (-563.981) [-560.809] -- 0:00:48
250000 -- (-564.184) [-562.386] (-561.402) (-565.471) * (-561.250) [-563.506] (-562.288) (-563.722) -- 0:00:48
Average standard deviation of split frequencies: 0.020060
250500 -- (-560.862) (-562.173) (-563.147) [-561.637] * (-560.772) [-563.878] (-563.498) (-570.083) -- 0:00:47
251000 -- [-560.792] (-561.781) (-560.578) (-564.524) * (-566.977) [-561.517] (-563.327) (-566.100) -- 0:00:47
251500 -- [-561.719] (-562.941) (-561.156) (-565.685) * (-564.433) (-562.955) (-561.486) [-563.760] -- 0:00:47
252000 -- (-562.438) [-562.843] (-564.414) (-564.269) * (-561.303) [-561.751] (-565.186) (-562.887) -- 0:00:47
252500 -- [-562.924] (-563.048) (-562.526) (-562.643) * (-561.416) [-562.096] (-565.259) (-568.723) -- 0:00:47
253000 -- [-560.771] (-562.546) (-564.274) (-563.850) * [-562.199] (-563.144) (-562.648) (-561.768) -- 0:00:47
253500 -- (-561.813) (-563.026) (-561.818) [-561.033] * (-561.073) (-561.370) [-564.002] (-561.188) -- 0:00:47
254000 -- (-561.698) (-561.276) (-562.220) [-562.993] * [-561.450] (-562.878) (-563.414) (-561.612) -- 0:00:46
254500 -- (-563.275) [-563.584] (-563.014) (-561.629) * [-564.992] (-563.813) (-560.852) (-560.804) -- 0:00:46
255000 -- (-563.401) (-565.161) (-562.554) [-561.796] * (-562.999) (-567.550) [-561.964] (-565.219) -- 0:00:46
Average standard deviation of split frequencies: 0.019642
255500 -- [-561.518] (-561.152) (-565.943) (-562.959) * (-564.876) (-564.521) [-562.327] (-560.521) -- 0:00:46
256000 -- (-562.062) (-561.089) (-564.486) [-560.827] * [-562.999] (-562.548) (-560.786) (-563.671) -- 0:00:46
256500 -- (-562.563) (-563.908) (-563.676) [-562.244] * (-561.748) [-560.922] (-560.786) (-565.452) -- 0:00:46
257000 -- (-561.962) (-562.268) (-561.682) [-562.261] * (-561.567) (-560.342) [-561.769] (-563.361) -- 0:00:46
257500 -- (-565.165) (-563.006) (-562.031) [-562.275] * (-561.367) (-562.405) [-560.871] (-563.757) -- 0:00:46
258000 -- (-565.177) [-568.239] (-563.074) (-563.176) * (-563.574) (-561.033) (-565.309) [-562.790] -- 0:00:46
258500 -- (-565.173) (-560.402) [-560.751] (-564.629) * (-560.708) (-561.770) (-563.351) [-562.028] -- 0:00:48
259000 -- (-562.353) [-563.353] (-563.494) (-562.633) * [-563.733] (-560.844) (-561.417) (-562.478) -- 0:00:48
259500 -- (-563.027) [-563.406] (-564.049) (-561.086) * (-563.632) (-561.874) [-565.158] (-561.808) -- 0:00:48
260000 -- (-561.119) (-561.228) [-564.054] (-562.644) * [-561.264] (-560.266) (-562.349) (-560.798) -- 0:00:48
Average standard deviation of split frequencies: 0.019391
260500 -- (-566.336) (-561.146) (-565.827) [-562.705] * [-561.956] (-561.135) (-563.834) (-566.397) -- 0:00:48
261000 -- [-562.077] (-560.784) (-561.390) (-562.155) * [-563.221] (-563.267) (-563.368) (-562.484) -- 0:00:48
261500 -- (-562.652) (-563.554) [-561.337] (-564.340) * [-561.614] (-561.584) (-562.227) (-561.223) -- 0:00:48
262000 -- (-560.893) (-561.525) (-562.099) [-566.465] * [-564.245] (-563.946) (-562.533) (-564.326) -- 0:00:47
262500 -- (-560.507) (-561.244) (-561.685) [-563.035] * [-562.718] (-566.131) (-566.148) (-564.044) -- 0:00:47
263000 -- (-561.801) [-562.224] (-562.638) (-563.731) * (-565.849) [-566.360] (-562.465) (-562.589) -- 0:00:47
263500 -- (-563.662) [-563.594] (-562.973) (-562.136) * (-561.801) [-562.469] (-562.271) (-566.219) -- 0:00:47
264000 -- (-561.232) [-567.553] (-566.440) (-562.107) * (-564.721) (-560.884) [-561.608] (-562.066) -- 0:00:47
264500 -- (-562.098) (-563.538) [-561.944] (-561.762) * (-561.378) [-563.613] (-561.119) (-563.758) -- 0:00:47
265000 -- (-561.367) [-562.242] (-560.686) (-563.552) * (-563.765) (-560.935) [-561.819] (-561.132) -- 0:00:47
Average standard deviation of split frequencies: 0.019691
265500 -- (-561.426) [-563.732] (-565.164) (-563.561) * [-566.939] (-562.026) (-561.167) (-564.481) -- 0:00:47
266000 -- (-560.495) (-562.391) [-563.640] (-565.342) * (-568.544) (-561.024) [-561.410] (-565.251) -- 0:00:46
266500 -- (-560.185) [-561.677] (-562.739) (-563.148) * (-560.894) [-563.195] (-562.005) (-562.000) -- 0:00:46
267000 -- (-564.329) (-563.399) (-563.899) [-563.137] * (-562.264) [-561.748] (-560.744) (-560.686) -- 0:00:46
267500 -- (-565.307) [-562.537] (-564.066) (-563.418) * (-560.738) [-563.151] (-562.915) (-560.266) -- 0:00:46
268000 -- (-562.288) [-564.551] (-560.963) (-562.795) * (-560.943) (-563.676) (-562.685) [-561.309] -- 0:00:46
268500 -- (-562.952) (-562.257) [-568.553] (-562.590) * (-566.803) (-562.103) (-563.701) [-561.479] -- 0:00:46
269000 -- [-561.536] (-562.167) (-568.068) (-563.181) * (-563.464) (-563.273) [-562.915] (-561.539) -- 0:00:46
269500 -- (-561.252) (-561.977) [-564.443] (-560.465) * (-563.533) (-562.653) [-562.549] (-561.201) -- 0:00:46
270000 -- (-561.066) [-561.651] (-561.113) (-564.188) * (-562.757) (-563.631) (-565.734) [-561.252] -- 0:00:45
Average standard deviation of split frequencies: 0.019352
270500 -- (-560.584) [-561.453] (-561.240) (-563.892) * [-563.960] (-562.435) (-563.056) (-564.052) -- 0:00:45
271000 -- (-560.525) (-561.572) (-562.626) [-562.190] * (-564.213) (-563.590) (-560.712) [-563.621] -- 0:00:45
271500 -- [-566.138] (-562.672) (-562.900) (-564.795) * (-563.991) [-562.762] (-564.216) (-566.794) -- 0:00:45
272000 -- (-562.783) (-564.123) (-561.635) [-562.378] * (-562.605) [-563.586] (-564.524) (-564.079) -- 0:00:45
272500 -- (-562.278) (-560.489) (-565.654) [-560.680] * (-564.644) (-567.502) (-564.091) [-564.412] -- 0:00:45
273000 -- (-563.872) [-564.396] (-567.833) (-561.622) * [-561.191] (-561.058) (-562.321) (-564.465) -- 0:00:45
273500 -- [-562.285] (-566.414) (-564.788) (-565.629) * (-560.880) (-565.282) (-562.972) [-560.773] -- 0:00:47
274000 -- (-560.901) (-563.880) [-564.165] (-561.898) * (-564.209) (-563.007) (-562.718) [-562.148] -- 0:00:47
274500 -- [-562.854] (-571.693) (-564.440) (-561.982) * [-560.713] (-564.760) (-561.668) (-561.734) -- 0:00:47
275000 -- [-564.471] (-561.437) (-563.219) (-562.206) * (-560.659) (-560.985) (-560.670) [-562.630] -- 0:00:47
Average standard deviation of split frequencies: 0.018598
275500 -- (-561.039) (-561.903) [-563.541] (-567.012) * [-561.049] (-562.217) (-561.225) (-563.675) -- 0:00:47
276000 -- [-560.625] (-562.092) (-564.125) (-561.365) * (-565.266) (-563.407) [-561.710] (-563.191) -- 0:00:47
276500 -- (-563.530) (-562.586) (-562.232) [-562.589] * [-563.516] (-563.304) (-561.174) (-565.813) -- 0:00:47
277000 -- [-563.197] (-563.764) (-562.183) (-563.001) * (-561.594) (-568.996) (-563.730) [-566.395] -- 0:00:46
277500 -- [-561.830] (-565.825) (-561.906) (-563.488) * (-561.724) [-561.252] (-562.544) (-563.254) -- 0:00:46
278000 -- (-561.296) (-561.858) [-561.358] (-560.304) * (-563.836) (-562.029) [-563.886] (-563.282) -- 0:00:46
278500 -- [-561.074] (-560.950) (-562.268) (-563.472) * [-560.525] (-564.426) (-560.685) (-562.960) -- 0:00:46
279000 -- (-562.567) [-561.149] (-560.471) (-561.766) * [-567.168] (-562.530) (-564.952) (-561.997) -- 0:00:46
279500 -- [-561.258] (-562.721) (-560.336) (-562.126) * [-561.964] (-561.495) (-562.365) (-562.291) -- 0:00:46
280000 -- (-561.960) (-562.766) (-564.314) [-562.753] * (-563.504) (-562.023) (-562.664) [-561.595] -- 0:00:46
Average standard deviation of split frequencies: 0.017822
280500 -- (-567.085) [-565.296] (-563.034) (-563.381) * (-562.680) [-563.746] (-562.643) (-561.817) -- 0:00:46
281000 -- (-564.855) [-562.676] (-563.750) (-562.631) * (-567.309) (-562.475) (-561.338) [-562.162] -- 0:00:46
281500 -- (-563.028) (-563.980) [-561.479] (-564.122) * (-563.860) [-561.812] (-563.679) (-563.917) -- 0:00:45
282000 -- (-563.131) (-562.166) [-560.838] (-562.114) * (-561.258) [-562.528] (-562.093) (-561.816) -- 0:00:45
282500 -- (-563.203) (-562.886) (-564.932) [-563.021] * (-561.113) (-563.391) (-562.221) [-562.021] -- 0:00:45
283000 -- (-563.457) (-561.457) (-561.815) [-561.283] * (-561.714) (-565.511) [-562.360] (-562.671) -- 0:00:45
283500 -- (-564.906) (-563.872) (-563.125) [-562.415] * (-564.742) [-561.410] (-562.121) (-561.645) -- 0:00:45
284000 -- (-563.906) (-562.543) [-562.530] (-561.155) * (-565.749) (-564.390) [-566.712] (-561.598) -- 0:00:45
284500 -- (-562.225) (-563.137) [-565.227] (-561.570) * (-562.699) (-561.017) [-563.264] (-562.627) -- 0:00:45
285000 -- [-561.048] (-563.408) (-566.243) (-563.401) * (-562.227) (-561.988) (-562.580) [-563.477] -- 0:00:45
Average standard deviation of split frequencies: 0.017948
285500 -- (-566.426) (-563.105) [-560.674] (-560.854) * (-562.963) (-562.155) [-566.292] (-569.472) -- 0:00:45
286000 -- (-566.111) (-567.599) (-564.054) [-560.900] * (-566.416) (-564.608) (-565.939) [-562.831] -- 0:00:44
286500 -- (-561.682) (-562.710) [-560.476] (-561.899) * [-564.401] (-560.926) (-565.079) (-560.432) -- 0:00:44
287000 -- (-565.413) (-561.579) [-562.870] (-562.306) * [-565.567] (-562.429) (-563.605) (-560.650) -- 0:00:44
287500 -- [-562.289] (-564.135) (-560.764) (-563.283) * (-562.335) [-561.693] (-564.154) (-561.792) -- 0:00:44
288000 -- (-561.955) [-561.578] (-562.213) (-562.688) * [-562.228] (-565.753) (-563.971) (-563.934) -- 0:00:44
288500 -- (-565.320) [-561.767] (-564.374) (-562.781) * [-560.787] (-573.523) (-562.246) (-562.479) -- 0:00:44
289000 -- [-562.267] (-567.020) (-561.428) (-562.136) * (-561.613) [-561.980] (-561.211) (-565.722) -- 0:00:44
289500 -- (-563.828) (-565.900) (-561.091) [-561.074] * (-562.336) (-560.494) (-565.763) [-562.892] -- 0:00:44
290000 -- (-562.356) [-561.535] (-562.130) (-561.818) * (-562.876) [-561.401] (-563.503) (-566.057) -- 0:00:46
Average standard deviation of split frequencies: 0.017299
290500 -- (-563.128) (-563.858) [-562.459] (-563.129) * (-561.497) (-565.305) [-563.044] (-561.208) -- 0:00:46
291000 -- [-563.611] (-561.118) (-561.764) (-561.159) * (-561.252) (-564.548) (-561.938) [-563.005] -- 0:00:46
291500 -- (-560.582) [-561.256] (-562.943) (-567.874) * [-560.441] (-562.877) (-561.677) (-561.976) -- 0:00:46
292000 -- (-562.533) (-566.027) [-560.856] (-567.677) * (-561.200) (-563.852) (-561.650) [-563.790] -- 0:00:46
292500 -- (-561.008) (-563.384) (-560.368) [-562.309] * (-563.477) (-562.246) [-561.585] (-565.261) -- 0:00:45
293000 -- (-560.736) (-562.533) (-562.647) [-563.976] * [-561.946] (-565.250) (-563.491) (-562.672) -- 0:00:45
293500 -- [-563.020] (-562.154) (-563.212) (-561.282) * (-560.984) (-562.991) [-564.753] (-562.794) -- 0:00:45
294000 -- (-565.788) (-563.036) [-561.163] (-563.548) * (-561.624) [-562.715] (-564.829) (-564.074) -- 0:00:45
294500 -- [-562.990] (-563.069) (-565.035) (-562.981) * (-561.620) (-561.448) (-566.765) [-560.562] -- 0:00:45
295000 -- (-560.428) [-560.788] (-562.607) (-565.178) * [-562.303] (-565.097) (-562.464) (-561.388) -- 0:00:45
Average standard deviation of split frequencies: 0.016545
295500 -- (-560.745) [-561.988] (-563.246) (-563.615) * (-564.486) (-561.195) (-562.424) [-562.717] -- 0:00:45
296000 -- [-561.221] (-561.163) (-562.693) (-565.113) * (-562.284) [-562.142] (-564.630) (-560.649) -- 0:00:45
296500 -- (-564.413) (-560.539) (-561.178) [-568.058] * [-563.045] (-561.070) (-563.929) (-561.985) -- 0:00:45
297000 -- [-561.500] (-563.094) (-562.527) (-561.914) * (-562.955) [-564.985] (-561.946) (-560.694) -- 0:00:44
297500 -- (-564.018) [-561.177] (-563.541) (-561.324) * [-562.298] (-563.998) (-563.371) (-561.605) -- 0:00:44
298000 -- (-561.010) (-568.901) (-561.700) [-561.712] * [-563.460] (-562.169) (-563.723) (-561.368) -- 0:00:44
298500 -- (-561.798) [-563.048] (-561.566) (-567.027) * (-562.401) [-563.755] (-562.240) (-561.774) -- 0:00:44
299000 -- (-562.046) [-562.042] (-562.577) (-564.971) * [-562.702] (-561.241) (-562.559) (-561.419) -- 0:00:44
299500 -- (-563.468) [-562.710] (-561.960) (-564.717) * (-562.803) [-563.821] (-565.022) (-562.053) -- 0:00:44
300000 -- [-562.782] (-563.607) (-567.844) (-566.754) * (-562.944) (-562.795) (-562.464) [-561.687] -- 0:00:44
Average standard deviation of split frequencies: 0.015679
300500 -- (-563.896) (-562.119) [-564.789] (-561.495) * [-564.507] (-569.361) (-564.491) (-561.051) -- 0:00:44
301000 -- (-562.953) (-562.225) (-561.968) [-563.811] * [-564.616] (-563.405) (-561.033) (-562.727) -- 0:00:44
301500 -- [-566.118] (-562.368) (-565.581) (-565.062) * [-560.905] (-563.269) (-565.807) (-562.682) -- 0:00:44
302000 -- (-560.940) (-568.103) [-560.828] (-565.431) * (-562.478) (-561.513) [-565.104] (-562.345) -- 0:00:43
302500 -- (-565.829) [-563.849] (-563.691) (-561.667) * [-564.069] (-562.452) (-562.732) (-562.154) -- 0:00:43
303000 -- (-561.421) [-562.274] (-562.125) (-563.950) * (-563.424) (-561.185) [-563.617] (-562.289) -- 0:00:43
303500 -- (-562.414) (-560.967) (-562.628) [-560.572] * (-562.576) (-561.905) (-560.681) [-563.784] -- 0:00:43
304000 -- (-565.234) [-561.616] (-564.460) (-561.663) * (-566.428) (-562.497) (-562.979) [-560.448] -- 0:00:43
304500 -- (-562.091) [-567.144] (-561.060) (-561.183) * (-562.685) [-563.877] (-560.750) (-562.234) -- 0:00:43
305000 -- [-561.927] (-566.033) (-563.005) (-565.476) * [-563.518] (-564.843) (-564.611) (-563.867) -- 0:00:43
Average standard deviation of split frequencies: 0.015063
305500 -- [-564.874] (-563.758) (-561.036) (-563.105) * (-563.477) (-561.824) [-564.068] (-565.298) -- 0:00:43
306000 -- [-563.806] (-563.894) (-562.436) (-565.613) * (-562.325) (-563.223) (-563.339) [-561.812] -- 0:00:43
306500 -- (-564.875) [-562.403] (-564.703) (-566.045) * (-568.662) [-562.007] (-562.512) (-561.974) -- 0:00:45
307000 -- (-563.873) (-561.146) (-562.775) [-562.661] * (-563.799) (-561.580) (-564.517) [-562.221] -- 0:00:45
307500 -- (-563.848) [-562.867] (-562.821) (-562.457) * (-565.874) (-561.432) (-560.712) [-563.060] -- 0:00:45
308000 -- [-560.801] (-564.536) (-562.265) (-564.894) * (-564.135) (-561.291) [-564.318] (-563.224) -- 0:00:44
308500 -- [-561.262] (-566.893) (-563.810) (-561.415) * (-562.290) (-565.339) (-561.629) [-562.389] -- 0:00:44
309000 -- [-564.201] (-564.098) (-561.941) (-562.134) * [-561.667] (-563.100) (-564.870) (-561.908) -- 0:00:44
309500 -- [-560.573] (-563.952) (-562.802) (-563.394) * (-561.570) (-561.114) [-561.789] (-563.389) -- 0:00:44
310000 -- [-561.033] (-566.753) (-561.903) (-563.368) * (-563.754) [-562.816] (-564.522) (-561.839) -- 0:00:44
Average standard deviation of split frequencies: 0.015005
310500 -- [-563.815] (-566.042) (-561.754) (-561.631) * [-562.899] (-561.486) (-565.052) (-562.133) -- 0:00:44
311000 -- (-561.417) [-563.144] (-562.002) (-560.380) * (-563.965) (-564.306) [-562.131] (-561.373) -- 0:00:44
311500 -- [-563.743] (-562.010) (-561.258) (-560.849) * [-563.972] (-562.501) (-562.008) (-562.558) -- 0:00:44
312000 -- (-561.210) (-561.432) (-566.930) [-560.559] * (-560.982) [-564.539] (-565.403) (-562.861) -- 0:00:44
312500 -- (-562.279) (-561.484) [-562.017] (-563.080) * [-562.796] (-562.080) (-564.209) (-561.729) -- 0:00:44
313000 -- (-562.553) [-560.756] (-562.259) (-562.452) * [-563.413] (-560.694) (-561.253) (-564.219) -- 0:00:43
313500 -- (-564.135) (-563.838) [-561.906] (-563.724) * (-564.082) (-566.886) (-560.891) [-561.061] -- 0:00:43
314000 -- (-563.544) (-561.993) [-561.141] (-561.811) * (-562.473) (-563.865) (-563.092) [-562.737] -- 0:00:43
314500 -- (-562.911) [-562.940] (-566.930) (-566.604) * (-566.732) [-562.095] (-561.522) (-563.900) -- 0:00:43
315000 -- (-564.704) [-561.897] (-565.702) (-563.173) * (-562.799) (-561.795) [-566.533] (-562.148) -- 0:00:43
Average standard deviation of split frequencies: 0.015708
315500 -- [-561.957] (-563.373) (-560.454) (-565.506) * (-562.332) [-562.576] (-565.222) (-568.534) -- 0:00:43
316000 -- (-565.713) (-565.444) [-563.553] (-564.656) * (-563.298) (-565.340) (-565.183) [-563.622] -- 0:00:43
316500 -- [-562.129] (-563.917) (-567.845) (-561.555) * (-561.926) [-561.891] (-565.203) (-561.117) -- 0:00:43
317000 -- (-564.549) (-561.854) (-563.564) [-561.578] * (-566.056) (-562.444) (-562.525) [-560.421] -- 0:00:43
317500 -- [-564.124] (-562.704) (-561.437) (-561.409) * (-563.312) (-565.016) [-561.662] (-561.097) -- 0:00:42
318000 -- [-561.247] (-560.459) (-562.759) (-564.313) * (-562.466) [-560.643] (-562.617) (-566.765) -- 0:00:42
318500 -- (-562.530) [-562.586] (-562.990) (-561.326) * [-562.814] (-560.660) (-561.467) (-565.947) -- 0:00:42
319000 -- [-562.328] (-562.567) (-562.216) (-564.624) * (-563.651) (-561.166) (-562.926) [-562.051] -- 0:00:42
319500 -- (-560.741) (-561.749) [-562.041] (-563.282) * (-560.132) [-560.906] (-561.771) (-565.038) -- 0:00:42
320000 -- (-562.923) (-562.029) [-567.960] (-562.170) * [-564.154] (-562.367) (-562.767) (-564.184) -- 0:00:42
Average standard deviation of split frequencies: 0.013874
320500 -- [-564.255] (-563.688) (-563.634) (-561.665) * (-561.506) (-561.418) (-561.544) [-561.660] -- 0:00:42
321000 -- (-561.591) (-563.425) [-563.549] (-560.763) * (-561.254) (-560.733) [-561.291] (-565.091) -- 0:00:42
321500 -- (-562.256) (-563.284) [-563.757] (-565.364) * (-561.359) [-563.403] (-563.784) (-562.044) -- 0:00:42
322000 -- (-560.925) [-564.818] (-561.969) (-561.748) * (-561.552) [-560.844] (-561.946) (-563.865) -- 0:00:42
322500 -- (-562.316) [-563.198] (-561.213) (-564.433) * (-562.844) (-560.928) (-563.989) [-566.636] -- 0:00:42
323000 -- [-562.067] (-561.281) (-568.869) (-562.486) * [-562.472] (-561.561) (-560.975) (-565.566) -- 0:00:44
323500 -- (-561.040) (-561.661) (-569.289) [-565.628] * (-563.299) [-563.216] (-561.011) (-562.016) -- 0:00:43
324000 -- [-563.167] (-563.092) (-569.951) (-563.072) * (-561.034) (-562.911) (-564.301) [-561.698] -- 0:00:43
324500 -- (-561.639) (-563.969) (-567.145) [-560.608] * (-561.304) (-564.370) (-563.021) [-565.329] -- 0:00:43
325000 -- (-561.330) (-560.743) (-561.089) [-560.865] * (-562.600) [-564.521] (-562.717) (-563.287) -- 0:00:43
Average standard deviation of split frequencies: 0.014460
325500 -- (-561.248) (-562.626) (-567.853) [-560.748] * (-560.226) (-564.447) [-562.187] (-560.265) -- 0:00:43
326000 -- (-560.915) (-565.876) (-561.100) [-564.595] * (-562.745) (-569.370) (-563.104) [-562.415] -- 0:00:43
326500 -- [-561.653] (-563.848) (-566.131) (-562.687) * (-561.168) (-565.002) [-561.261] (-564.914) -- 0:00:43
327000 -- [-562.014] (-561.843) (-563.635) (-563.864) * (-562.312) (-561.780) (-562.926) [-564.544] -- 0:00:43
327500 -- (-562.281) (-562.957) (-566.526) [-562.996] * (-566.299) (-564.802) [-562.088] (-561.715) -- 0:00:43
328000 -- (-563.259) [-563.252] (-562.745) (-563.153) * (-562.460) (-560.545) [-561.988] (-562.074) -- 0:00:43
328500 -- (-563.477) [-561.599] (-565.850) (-563.676) * (-561.806) (-560.709) [-561.450] (-561.977) -- 0:00:42
329000 -- (-564.073) [-563.572] (-564.007) (-560.972) * (-565.891) (-562.037) (-563.515) [-563.812] -- 0:00:42
329500 -- [-562.275] (-568.452) (-564.552) (-561.402) * [-561.588] (-566.117) (-566.472) (-564.570) -- 0:00:42
330000 -- (-561.850) [-564.762] (-560.794) (-562.460) * [-562.427] (-561.660) (-562.588) (-567.040) -- 0:00:42
Average standard deviation of split frequencies: 0.014340
330500 -- (-563.314) (-564.662) [-564.346] (-564.461) * (-562.754) (-562.147) [-562.553] (-564.881) -- 0:00:42
331000 -- [-567.982] (-565.446) (-565.447) (-561.349) * (-563.158) (-563.258) (-562.710) [-562.842] -- 0:00:42
331500 -- (-562.197) (-566.463) (-565.711) [-562.571] * (-564.283) (-564.742) [-563.320] (-564.146) -- 0:00:42
332000 -- (-560.954) (-560.607) (-562.408) [-563.223] * (-563.249) [-562.518] (-562.760) (-561.496) -- 0:00:42
332500 -- (-561.853) (-560.874) [-561.771] (-561.942) * [-564.131] (-565.385) (-566.194) (-562.267) -- 0:00:42
333000 -- [-561.645] (-562.831) (-567.156) (-561.252) * (-563.314) (-562.494) [-561.954] (-564.702) -- 0:00:42
333500 -- (-565.166) (-560.986) [-562.201] (-565.333) * (-568.254) (-561.839) (-561.831) [-561.275] -- 0:00:41
334000 -- [-563.639] (-563.441) (-564.233) (-562.498) * (-567.223) (-564.997) (-562.480) [-561.392] -- 0:00:41
334500 -- (-562.733) [-562.030] (-565.665) (-562.623) * [-561.602] (-565.446) (-563.543) (-561.534) -- 0:00:41
335000 -- (-561.926) (-560.663) (-563.171) [-564.784] * [-560.935] (-560.528) (-563.941) (-563.883) -- 0:00:41
Average standard deviation of split frequencies: 0.013535
335500 -- (-560.969) [-561.105] (-566.731) (-564.394) * (-562.002) [-561.453] (-564.302) (-562.039) -- 0:00:41
336000 -- (-560.957) [-561.694] (-561.682) (-563.846) * (-564.547) (-566.739) (-563.405) [-561.595] -- 0:00:41
336500 -- (-560.695) (-565.730) [-561.710] (-561.715) * (-564.730) [-562.629] (-561.444) (-561.876) -- 0:00:41
337000 -- (-560.599) (-566.784) (-564.003) [-562.942] * (-562.951) [-561.941] (-560.246) (-561.926) -- 0:00:41
337500 -- (-560.450) (-564.321) [-562.179] (-561.856) * (-561.461) [-561.136] (-562.571) (-563.729) -- 0:00:41
338000 -- (-567.657) (-562.116) (-562.213) [-561.104] * (-562.274) [-560.774] (-563.474) (-560.822) -- 0:00:41
338500 -- [-562.966] (-562.972) (-563.344) (-562.474) * (-560.900) (-566.191) (-560.305) [-560.899] -- 0:00:41
339000 -- (-562.639) (-562.539) (-561.820) [-561.585] * [-560.337] (-567.314) (-560.620) (-560.752) -- 0:00:40
339500 -- (-563.346) (-566.455) (-562.510) [-561.579] * (-561.359) (-561.791) [-561.999] (-564.593) -- 0:00:40
340000 -- [-564.522] (-564.647) (-561.966) (-562.300) * (-560.889) [-561.035] (-561.925) (-563.011) -- 0:00:42
Average standard deviation of split frequencies: 0.012540
340500 -- [-562.445] (-563.562) (-561.910) (-560.827) * (-562.790) (-566.863) [-561.532] (-564.034) -- 0:00:42
341000 -- [-562.234] (-563.402) (-563.698) (-564.145) * [-561.781] (-561.273) (-562.036) (-560.259) -- 0:00:42
341500 -- [-561.023] (-562.971) (-564.323) (-560.574) * [-561.721] (-561.759) (-563.568) (-564.482) -- 0:00:42
342000 -- (-563.294) (-567.750) (-564.526) [-564.693] * [-561.568] (-562.732) (-563.291) (-563.277) -- 0:00:42
342500 -- (-563.621) (-567.009) [-562.551] (-561.635) * (-563.211) (-560.982) [-560.986] (-562.076) -- 0:00:42
343000 -- (-564.819) (-561.966) (-564.295) [-560.660] * (-562.033) (-561.304) [-561.594] (-564.552) -- 0:00:42
343500 -- (-561.477) (-560.863) (-561.376) [-561.590] * (-561.670) [-560.924] (-564.765) (-567.042) -- 0:00:42
344000 -- (-562.423) (-563.380) [-562.309] (-563.713) * (-562.868) [-563.357] (-565.378) (-561.874) -- 0:00:41
344500 -- (-565.300) (-561.832) (-562.662) [-567.670] * (-562.110) (-567.920) (-565.610) [-564.296] -- 0:00:41
345000 -- (-563.201) (-562.183) [-563.179] (-565.518) * [-561.757] (-565.223) (-567.482) (-562.894) -- 0:00:41
Average standard deviation of split frequencies: 0.014586
345500 -- (-561.580) (-561.159) (-562.138) [-565.474] * (-561.479) (-561.048) (-568.107) [-563.051] -- 0:00:41
346000 -- [-560.964] (-561.035) (-564.918) (-567.537) * (-563.629) (-563.118) (-562.871) [-562.032] -- 0:00:41
346500 -- [-563.295] (-563.132) (-562.622) (-567.005) * [-561.080] (-566.783) (-561.361) (-561.681) -- 0:00:41
347000 -- (-562.305) (-561.949) [-561.255] (-560.796) * (-560.940) (-566.944) [-563.016] (-563.734) -- 0:00:41
347500 -- (-561.222) [-561.621] (-560.948) (-563.203) * (-562.520) (-562.497) [-563.423] (-568.410) -- 0:00:41
348000 -- [-562.165] (-564.109) (-565.381) (-564.943) * [-560.641] (-563.554) (-560.933) (-567.304) -- 0:00:41
348500 -- (-560.729) (-563.166) (-563.126) [-562.820] * [-563.387] (-562.783) (-562.412) (-563.029) -- 0:00:41
349000 -- [-561.914] (-563.206) (-562.758) (-561.553) * (-565.418) [-563.124] (-561.616) (-565.648) -- 0:00:41
349500 -- (-561.365) [-560.670] (-561.992) (-562.484) * (-562.752) (-562.912) [-562.683] (-563.589) -- 0:00:40
350000 -- (-561.583) (-561.582) [-563.659] (-560.971) * [-562.432] (-563.200) (-564.479) (-567.159) -- 0:00:40
Average standard deviation of split frequencies: 0.012939
350500 -- (-562.021) (-562.298) (-561.956) [-562.064] * (-562.536) (-563.511) [-566.659] (-564.415) -- 0:00:40
351000 -- (-562.321) (-563.546) [-562.022] (-563.905) * (-562.570) (-561.536) [-563.106] (-562.054) -- 0:00:40
351500 -- [-561.567] (-563.794) (-561.838) (-564.073) * [-563.247] (-564.133) (-561.780) (-562.828) -- 0:00:40
352000 -- (-563.452) (-566.337) (-564.660) [-562.284] * (-561.541) (-565.495) [-561.382] (-565.040) -- 0:00:40
352500 -- (-561.280) [-562.839] (-563.409) (-563.566) * (-562.284) [-563.569] (-564.797) (-561.937) -- 0:00:40
353000 -- (-561.868) (-562.244) (-564.245) [-562.681] * (-561.455) [-564.656] (-565.549) (-560.964) -- 0:00:40
353500 -- (-561.400) (-562.888) (-563.254) [-560.305] * (-560.915) (-561.748) (-566.064) [-562.587] -- 0:00:40
354000 -- (-564.725) (-563.921) [-563.838] (-566.454) * [-561.137] (-562.755) (-565.331) (-563.940) -- 0:00:40
354500 -- [-562.946] (-563.025) (-563.936) (-562.947) * (-561.584) (-565.747) (-565.813) [-561.994] -- 0:00:40
355000 -- [-562.839] (-561.499) (-564.125) (-564.456) * [-560.959] (-564.840) (-566.713) (-561.943) -- 0:00:39
Average standard deviation of split frequencies: 0.014488
355500 -- (-562.480) (-563.443) (-563.616) [-561.400] * [-569.659] (-563.455) (-562.830) (-563.701) -- 0:00:39
356000 -- (-561.947) (-564.723) (-561.485) [-562.326] * (-563.635) (-564.910) (-566.339) [-564.688] -- 0:00:39
356500 -- (-563.657) [-568.989] (-560.527) (-562.299) * (-563.157) (-561.207) (-564.366) [-561.574] -- 0:00:41
357000 -- [-562.682] (-566.525) (-561.973) (-562.099) * (-565.445) [-562.262] (-563.828) (-560.657) -- 0:00:41
357500 -- (-568.250) (-566.902) (-563.341) [-561.779] * (-563.208) (-562.303) (-561.512) [-562.856] -- 0:00:41
358000 -- (-563.413) (-566.507) (-561.324) [-561.933] * [-563.331] (-562.623) (-561.600) (-564.490) -- 0:00:41
358500 -- (-563.818) [-560.885] (-560.667) (-561.759) * (-561.301) (-561.028) [-561.383] (-564.825) -- 0:00:41
359000 -- (-561.105) (-565.408) (-564.615) [-561.533] * (-561.589) (-562.319) [-561.382] (-565.789) -- 0:00:41
359500 -- [-560.469] (-565.001) (-563.687) (-563.908) * (-562.649) (-562.506) [-562.350] (-563.980) -- 0:00:40
360000 -- (-560.935) [-562.377] (-562.213) (-564.085) * (-561.033) (-560.652) [-560.707] (-562.777) -- 0:00:40
Average standard deviation of split frequencies: 0.012008
360500 -- (-564.344) (-564.464) [-562.709] (-564.762) * [-560.390] (-562.592) (-562.995) (-562.054) -- 0:00:40
361000 -- (-561.822) [-562.943] (-563.999) (-562.030) * (-561.507) (-563.556) [-561.917] (-564.074) -- 0:00:40
361500 -- [-561.038] (-568.478) (-565.273) (-562.798) * [-561.241] (-560.707) (-563.027) (-563.870) -- 0:00:40
362000 -- (-564.061) (-563.570) (-563.167) [-562.047] * (-562.335) (-564.537) (-562.251) [-562.095] -- 0:00:40
362500 -- (-563.993) (-561.588) [-561.917] (-561.772) * (-562.624) (-563.279) [-560.748] (-563.201) -- 0:00:40
363000 -- (-568.055) (-561.873) (-570.238) [-562.320] * (-566.108) (-562.970) [-560.732] (-561.865) -- 0:00:40
363500 -- (-563.400) [-562.569] (-561.864) (-561.641) * (-564.536) (-562.091) (-563.344) [-562.083] -- 0:00:40
364000 -- (-564.402) (-561.437) [-561.176] (-560.280) * (-565.209) (-561.856) [-561.552] (-564.096) -- 0:00:40
364500 -- [-564.838] (-564.069) (-564.109) (-561.004) * (-564.093) (-561.845) [-564.126] (-562.071) -- 0:00:40
365000 -- (-562.488) (-566.487) (-562.932) [-561.596] * (-563.379) (-561.573) (-562.828) [-562.854] -- 0:00:40
Average standard deviation of split frequencies: 0.011270
365500 -- [-565.655] (-566.310) (-561.783) (-562.659) * (-563.713) (-561.942) [-565.800] (-561.475) -- 0:00:39
366000 -- [-561.056] (-562.089) (-561.611) (-562.243) * (-562.502) [-561.358] (-564.361) (-562.263) -- 0:00:39
366500 -- (-560.375) (-562.783) [-561.341] (-561.242) * (-562.197) (-563.399) (-563.075) [-561.654] -- 0:00:39
367000 -- (-562.183) (-561.706) [-561.368] (-563.761) * [-561.582] (-561.396) (-563.129) (-562.301) -- 0:00:39
367500 -- (-563.629) (-562.265) [-561.208] (-562.636) * (-563.688) (-561.608) [-566.424] (-561.290) -- 0:00:39
368000 -- [-563.289] (-560.490) (-562.158) (-561.296) * (-565.317) (-565.898) (-562.406) [-566.247] -- 0:00:39
368500 -- (-562.866) [-561.754] (-561.372) (-563.067) * (-562.549) (-564.264) (-560.664) [-566.476] -- 0:00:39
369000 -- (-561.188) (-561.939) [-561.136] (-564.972) * (-564.762) (-561.255) [-561.247] (-564.000) -- 0:00:39
369500 -- [-562.745] (-562.233) (-561.465) (-560.514) * (-561.529) (-562.390) (-563.742) [-562.582] -- 0:00:39
370000 -- (-564.823) [-561.854] (-561.834) (-563.721) * [-562.952] (-563.292) (-562.148) (-567.344) -- 0:00:39
Average standard deviation of split frequencies: 0.011128
370500 -- (-566.599) (-561.711) [-563.471] (-566.561) * (-561.652) [-561.858] (-566.226) (-561.293) -- 0:00:39
371000 -- (-560.847) [-561.400] (-565.301) (-562.270) * (-563.893) [-564.349] (-562.888) (-560.595) -- 0:00:38
371500 -- (-562.851) (-563.218) (-561.333) [-563.108] * (-561.400) [-564.900] (-562.367) (-562.683) -- 0:00:38
372000 -- [-569.165] (-561.812) (-563.032) (-560.497) * (-562.583) [-562.758] (-562.451) (-570.414) -- 0:00:38
372500 -- (-563.821) (-564.868) [-562.108] (-564.118) * (-562.153) [-564.745] (-564.134) (-563.735) -- 0:00:38
373000 -- (-563.908) [-561.103] (-563.076) (-563.151) * (-568.174) (-562.400) (-562.135) [-565.366] -- 0:00:38
373500 -- (-563.167) [-562.608] (-562.264) (-565.195) * [-562.643] (-562.335) (-562.485) (-563.662) -- 0:00:40
374000 -- [-561.684] (-562.820) (-563.806) (-563.556) * [-561.398] (-564.048) (-562.681) (-563.443) -- 0:00:40
374500 -- (-563.297) (-561.666) (-563.127) [-560.398] * (-560.763) (-562.467) (-567.157) [-564.922] -- 0:00:40
375000 -- (-561.747) [-561.543] (-561.122) (-563.044) * (-563.514) (-561.357) [-566.833] (-562.922) -- 0:00:40
Average standard deviation of split frequencies: 0.010892
375500 -- (-563.641) (-568.835) [-564.475] (-563.806) * (-565.206) (-561.504) (-560.530) [-561.930] -- 0:00:39
376000 -- (-561.055) (-562.323) (-561.987) [-563.197] * (-562.093) [-564.253] (-560.491) (-561.680) -- 0:00:39
376500 -- [-562.731] (-561.859) (-563.644) (-561.765) * (-563.879) (-568.497) [-560.389] (-564.474) -- 0:00:39
377000 -- (-562.989) [-563.092] (-563.819) (-561.155) * (-560.840) [-563.835] (-560.639) (-562.279) -- 0:00:39
377500 -- [-560.936] (-564.307) (-565.858) (-562.739) * [-562.225] (-560.383) (-560.828) (-563.109) -- 0:00:39
378000 -- (-563.822) [-561.779] (-564.285) (-561.102) * (-566.918) (-563.189) [-565.192] (-564.050) -- 0:00:39
378500 -- (-562.233) [-563.821] (-562.190) (-560.654) * (-560.618) [-562.994] (-564.776) (-561.487) -- 0:00:39
379000 -- (-563.244) [-562.430] (-562.414) (-561.911) * (-561.217) (-564.445) [-563.080] (-561.745) -- 0:00:39
379500 -- [-563.893] (-563.080) (-564.458) (-562.578) * (-564.461) [-562.192] (-560.828) (-562.098) -- 0:00:39
380000 -- (-562.251) (-564.760) [-563.134] (-564.728) * (-562.394) [-564.427] (-561.091) (-562.984) -- 0:00:39
Average standard deviation of split frequencies: 0.009984
380500 -- [-564.083] (-561.006) (-565.505) (-565.375) * (-562.794) (-560.121) (-563.397) [-561.562] -- 0:00:39
381000 -- [-562.161] (-563.451) (-564.369) (-561.919) * [-560.895] (-561.281) (-563.339) (-562.933) -- 0:00:38
381500 -- [-563.347] (-563.520) (-563.227) (-563.701) * [-562.723] (-563.189) (-561.008) (-566.823) -- 0:00:38
382000 -- (-561.408) [-561.727] (-563.182) (-565.536) * (-560.344) [-561.498] (-560.787) (-564.213) -- 0:00:38
382500 -- (-562.342) (-564.153) [-562.737] (-562.949) * (-561.368) (-560.803) [-561.813] (-565.707) -- 0:00:38
383000 -- (-563.277) [-560.529] (-561.374) (-562.902) * [-561.067] (-563.194) (-564.269) (-566.009) -- 0:00:38
383500 -- [-562.408] (-561.010) (-563.103) (-560.531) * (-562.153) (-562.982) [-564.194] (-563.729) -- 0:00:38
384000 -- (-562.538) (-561.777) (-563.324) [-561.123] * (-561.502) (-563.315) [-561.365] (-561.562) -- 0:00:38
384500 -- (-565.696) (-561.032) [-562.306] (-566.115) * [-560.650] (-569.703) (-562.023) (-563.923) -- 0:00:38
385000 -- (-562.457) (-560.866) [-561.742] (-562.588) * (-560.670) (-565.616) [-562.067] (-562.838) -- 0:00:38
Average standard deviation of split frequencies: 0.010533
385500 -- (-564.092) [-560.604] (-564.960) (-563.019) * (-562.639) (-565.285) [-563.554] (-562.817) -- 0:00:38
386000 -- (-562.471) (-564.156) (-567.025) [-562.712] * [-563.087] (-567.537) (-561.751) (-561.903) -- 0:00:38
386500 -- [-564.069] (-562.296) (-569.163) (-563.830) * (-561.140) (-567.424) (-562.892) [-563.276] -- 0:00:38
387000 -- [-561.302] (-563.784) (-568.957) (-563.514) * [-561.151] (-562.736) (-561.612) (-560.897) -- 0:00:38
387500 -- (-561.155) (-562.531) (-565.246) [-563.715] * (-563.707) [-563.143] (-561.347) (-561.003) -- 0:00:37
388000 -- (-560.369) (-561.144) (-562.989) [-561.192] * [-560.785] (-561.066) (-560.305) (-561.919) -- 0:00:37
388500 -- (-560.900) (-564.579) [-564.393] (-563.478) * (-563.695) [-562.092] (-562.108) (-563.011) -- 0:00:37
389000 -- (-563.546) (-560.812) (-561.775) [-561.802] * (-562.942) [-561.721] (-562.567) (-562.541) -- 0:00:37
389500 -- [-566.247] (-565.091) (-563.541) (-561.286) * (-562.770) (-561.227) [-562.362] (-561.164) -- 0:00:37
390000 -- (-565.960) (-562.112) (-563.656) [-562.033] * (-564.078) (-564.368) (-562.676) [-564.775] -- 0:00:39
Average standard deviation of split frequencies: 0.011313
390500 -- [-560.724] (-564.609) (-562.410) (-562.288) * (-561.806) (-564.907) (-561.207) [-563.068] -- 0:00:39
391000 -- (-563.874) (-561.072) [-562.395] (-560.536) * (-563.162) (-563.505) (-564.968) [-560.707] -- 0:00:38
391500 -- [-562.554] (-562.380) (-563.895) (-563.102) * (-562.973) (-562.396) [-561.635] (-561.119) -- 0:00:38
392000 -- (-561.265) (-564.308) [-563.370] (-564.703) * [-560.628] (-564.117) (-562.459) (-561.052) -- 0:00:38
392500 -- (-561.492) (-563.379) [-563.283] (-566.562) * (-561.990) (-561.665) [-561.497] (-561.268) -- 0:00:38
393000 -- [-564.459] (-563.219) (-563.554) (-567.571) * (-561.281) (-562.712) (-560.801) [-563.811] -- 0:00:38
393500 -- (-563.334) (-563.644) (-562.606) [-562.908] * [-562.938] (-561.576) (-561.480) (-561.572) -- 0:00:38
394000 -- (-561.076) (-562.487) [-562.204] (-562.307) * (-564.711) (-564.990) [-561.089] (-564.998) -- 0:00:38
394500 -- [-561.955] (-561.747) (-562.347) (-562.991) * (-562.346) (-562.855) [-564.784] (-560.278) -- 0:00:38
395000 -- (-565.763) (-560.502) (-562.481) [-561.736] * (-560.833) (-560.977) [-561.929] (-560.978) -- 0:00:38
Average standard deviation of split frequencies: 0.011160
395500 -- (-562.089) (-560.925) [-562.133] (-562.248) * [-562.742] (-563.681) (-562.222) (-561.327) -- 0:00:38
396000 -- (-563.391) (-561.328) [-561.960] (-561.509) * [-561.872] (-562.305) (-563.373) (-561.867) -- 0:00:38
396500 -- (-562.538) [-562.019] (-566.028) (-562.798) * (-563.424) (-561.105) (-562.274) [-565.309] -- 0:00:38
397000 -- [-562.098] (-562.355) (-564.299) (-564.670) * (-563.856) (-560.325) (-565.846) [-562.283] -- 0:00:37
397500 -- (-561.368) [-561.151] (-567.049) (-561.277) * (-561.785) (-560.426) [-561.851] (-561.473) -- 0:00:37
398000 -- [-564.066] (-561.193) (-563.000) (-567.225) * [-562.487] (-563.718) (-562.598) (-563.059) -- 0:00:37
398500 -- [-562.122] (-562.188) (-560.801) (-563.961) * (-565.839) [-562.422] (-564.534) (-562.262) -- 0:00:37
399000 -- [-567.112] (-562.048) (-562.180) (-565.250) * (-562.520) [-561.178] (-561.800) (-563.462) -- 0:00:37
399500 -- (-564.382) [-560.693] (-563.487) (-564.903) * [-562.446] (-560.383) (-566.263) (-560.417) -- 0:00:37
400000 -- (-560.743) [-561.999] (-561.202) (-562.365) * (-562.155) (-564.813) [-563.611] (-561.015) -- 0:00:37
Average standard deviation of split frequencies: 0.011398
400500 -- (-560.518) (-563.452) (-563.508) [-562.071] * (-563.483) (-560.759) (-564.420) [-560.284] -- 0:00:37
401000 -- (-562.138) [-561.685] (-568.902) (-562.706) * [-568.704] (-562.109) (-562.717) (-560.749) -- 0:00:37
401500 -- [-563.406] (-563.984) (-562.966) (-562.336) * [-561.661] (-563.336) (-561.972) (-562.078) -- 0:00:37
402000 -- (-562.557) (-565.991) (-563.414) [-561.421] * [-561.883] (-570.235) (-568.162) (-564.280) -- 0:00:37
402500 -- (-561.506) [-564.442] (-564.775) (-564.243) * (-563.920) (-575.071) (-561.987) [-561.586] -- 0:00:37
403000 -- (-562.649) (-565.793) [-562.651] (-562.021) * (-562.989) (-562.342) [-560.882] (-562.530) -- 0:00:37
403500 -- [-561.732] (-562.113) (-565.537) (-564.974) * (-560.203) (-562.665) [-562.667] (-563.548) -- 0:00:36
404000 -- [-561.650] (-564.418) (-563.279) (-563.355) * (-561.292) (-562.799) (-562.535) [-561.192] -- 0:00:36
404500 -- (-564.374) [-561.802] (-561.897) (-566.878) * (-561.350) [-561.743] (-564.146) (-561.298) -- 0:00:36
405000 -- [-561.285] (-561.847) (-560.887) (-562.273) * [-560.781] (-564.273) (-565.959) (-561.485) -- 0:00:36
Average standard deviation of split frequencies: 0.011974
405500 -- (-561.333) (-562.146) (-560.218) [-561.246] * [-560.444] (-566.328) (-563.905) (-562.662) -- 0:00:36
406000 -- [-562.797] (-568.026) (-560.578) (-562.706) * (-561.953) [-563.069] (-565.566) (-563.345) -- 0:00:36
406500 -- (-560.675) (-565.780) (-564.951) [-562.267] * (-562.262) (-561.966) [-565.651] (-562.789) -- 0:00:37
407000 -- [-560.392] (-560.520) (-561.219) (-561.016) * (-563.379) [-560.429] (-563.095) (-562.681) -- 0:00:37
407500 -- (-562.738) [-564.131] (-561.578) (-560.783) * (-565.211) [-561.882] (-565.671) (-566.335) -- 0:00:37
408000 -- [-563.036] (-562.442) (-562.754) (-563.229) * [-562.906] (-562.891) (-563.566) (-563.821) -- 0:00:37
408500 -- (-563.194) (-560.716) [-561.428] (-564.073) * (-562.003) (-564.678) (-561.151) [-561.021] -- 0:00:37
409000 -- [-564.581] (-562.000) (-563.373) (-561.669) * (-561.501) (-562.021) [-561.008] (-562.564) -- 0:00:37
409500 -- [-561.207] (-565.906) (-564.687) (-564.063) * (-563.482) (-564.094) [-564.258] (-563.470) -- 0:00:37
410000 -- [-560.923] (-564.926) (-561.667) (-560.772) * (-563.321) (-562.017) [-561.792] (-561.122) -- 0:00:37
Average standard deviation of split frequencies: 0.012268
410500 -- (-561.563) (-565.685) [-563.122] (-564.206) * (-562.031) [-563.448] (-561.468) (-563.794) -- 0:00:37
411000 -- (-560.697) (-568.356) (-565.407) [-561.267] * (-562.505) [-560.763] (-560.992) (-562.843) -- 0:00:37
411500 -- (-561.207) [-561.391] (-566.169) (-564.683) * (-560.237) [-562.048] (-561.541) (-564.071) -- 0:00:37
412000 -- (-563.989) (-561.785) [-560.976] (-565.358) * (-561.323) (-563.489) (-561.668) [-562.198] -- 0:00:37
412500 -- (-561.362) (-561.531) [-561.391] (-561.846) * (-567.800) (-562.881) (-566.926) [-561.262] -- 0:00:37
413000 -- (-562.808) [-561.425] (-562.225) (-561.784) * [-561.602] (-562.737) (-561.109) (-561.030) -- 0:00:36
413500 -- (-563.561) [-561.512] (-562.248) (-561.727) * (-562.231) (-562.028) [-561.190] (-563.164) -- 0:00:36
414000 -- (-569.889) (-561.332) [-561.760] (-564.721) * (-563.969) (-563.462) [-561.222] (-561.386) -- 0:00:36
414500 -- (-566.249) (-563.307) [-562.115] (-562.570) * (-561.615) (-564.999) (-561.097) [-567.187] -- 0:00:36
415000 -- (-566.554) (-561.853) (-565.345) [-562.505] * [-561.408] (-564.495) (-560.742) (-564.385) -- 0:00:36
Average standard deviation of split frequencies: 0.013527
415500 -- (-562.612) [-562.561] (-568.869) (-562.233) * (-565.746) (-564.450) [-565.400] (-566.925) -- 0:00:36
416000 -- (-561.362) [-563.554] (-561.301) (-561.042) * (-565.974) (-566.100) (-564.027) [-563.640] -- 0:00:36
416500 -- (-566.739) [-565.110] (-564.422) (-563.430) * (-561.558) (-564.762) (-561.959) [-561.418] -- 0:00:36
417000 -- (-563.497) (-562.338) [-562.757] (-561.810) * (-563.833) [-560.957] (-562.726) (-563.490) -- 0:00:36
417500 -- (-564.958) [-561.709] (-562.373) (-562.208) * [-561.312] (-563.336) (-562.146) (-564.237) -- 0:00:36
418000 -- (-562.196) [-561.785] (-561.896) (-561.961) * (-561.402) [-561.922] (-562.105) (-562.786) -- 0:00:36
418500 -- (-561.545) (-566.066) [-561.652] (-562.156) * (-563.336) (-560.900) [-562.761] (-561.468) -- 0:00:36
419000 -- (-563.327) (-566.910) [-562.829] (-561.793) * [-562.948] (-562.184) (-567.382) (-560.804) -- 0:00:36
419500 -- (-563.645) (-561.288) [-562.022] (-562.268) * (-560.530) [-561.126] (-563.591) (-560.958) -- 0:00:35
420000 -- [-563.262] (-562.789) (-561.794) (-562.976) * [-562.200] (-563.543) (-566.194) (-564.646) -- 0:00:35
Average standard deviation of split frequencies: 0.014078
420500 -- (-563.155) (-566.956) (-562.216) [-563.366] * [-561.358] (-560.882) (-562.708) (-566.533) -- 0:00:35
421000 -- (-563.696) (-563.139) (-561.221) [-562.266] * (-562.296) (-564.443) [-560.744] (-563.151) -- 0:00:35
421500 -- (-561.477) [-561.551] (-567.310) (-567.953) * [-563.922] (-563.707) (-563.172) (-562.944) -- 0:00:35
422000 -- (-560.784) (-561.385) (-568.133) [-560.798] * [-561.605] (-563.018) (-561.522) (-566.198) -- 0:00:35
422500 -- (-561.733) (-561.710) [-560.882] (-564.390) * (-563.104) [-561.897] (-560.974) (-561.864) -- 0:00:35
423000 -- (-562.771) (-562.356) [-564.347] (-562.366) * (-567.833) (-565.030) [-564.896] (-560.573) -- 0:00:36
423500 -- (-562.980) (-560.913) (-561.980) [-563.463] * [-561.111] (-568.535) (-565.392) (-561.449) -- 0:00:36
424000 -- (-564.338) (-560.660) [-561.129] (-563.622) * [-561.115] (-563.483) (-562.540) (-565.660) -- 0:00:36
424500 -- (-563.257) [-561.402] (-561.040) (-561.200) * [-563.263] (-563.066) (-562.563) (-567.138) -- 0:00:36
425000 -- (-564.119) [-562.042] (-563.068) (-561.619) * (-561.374) (-564.311) (-561.971) [-561.540] -- 0:00:36
Average standard deviation of split frequencies: 0.014178
425500 -- [-560.502] (-560.174) (-562.559) (-564.642) * (-561.291) [-562.367] (-563.350) (-560.239) -- 0:00:36
426000 -- (-562.113) (-560.961) (-564.216) [-562.363] * (-561.309) (-561.455) [-562.455] (-560.764) -- 0:00:36
426500 -- [-561.553] (-564.905) (-561.974) (-564.593) * (-562.496) [-563.351] (-563.221) (-561.629) -- 0:00:36
427000 -- (-565.838) (-561.028) (-564.337) [-561.179] * [-560.606] (-565.252) (-561.700) (-563.891) -- 0:00:36
427500 -- (-562.396) (-562.426) [-562.270] (-561.779) * (-560.992) [-561.943] (-560.826) (-562.571) -- 0:00:36
428000 -- [-563.578] (-564.087) (-565.292) (-564.828) * (-562.125) (-561.867) [-562.201] (-561.160) -- 0:00:36
428500 -- [-564.822] (-563.208) (-563.969) (-561.433) * (-563.034) [-563.436] (-563.810) (-561.551) -- 0:00:36
429000 -- (-563.530) (-565.260) [-564.588] (-562.463) * (-564.795) [-567.467] (-560.699) (-561.942) -- 0:00:35
429500 -- (-563.514) [-561.544] (-564.948) (-562.823) * (-561.810) (-563.606) [-563.976] (-565.204) -- 0:00:35
430000 -- [-561.161] (-562.566) (-563.311) (-563.741) * (-561.890) (-561.773) [-560.927] (-567.688) -- 0:00:35
Average standard deviation of split frequencies: 0.014938
430500 -- (-560.334) (-561.252) (-564.624) [-565.807] * (-561.115) [-562.161] (-562.169) (-561.770) -- 0:00:35
431000 -- (-561.772) (-561.359) (-561.214) [-560.812] * (-563.695) (-562.623) (-566.180) [-561.311] -- 0:00:35
431500 -- (-563.254) (-562.501) [-563.962] (-562.431) * (-561.979) (-561.195) [-563.093] (-562.427) -- 0:00:35
432000 -- [-560.437] (-560.842) (-565.602) (-562.686) * (-565.015) (-565.348) (-560.472) [-564.470] -- 0:00:35
432500 -- (-562.486) [-562.978] (-565.652) (-562.871) * (-562.027) [-563.328] (-560.649) (-561.812) -- 0:00:35
433000 -- (-562.722) (-564.002) [-563.311] (-563.551) * (-565.364) (-561.065) (-561.462) [-562.462] -- 0:00:35
433500 -- [-561.426] (-561.122) (-561.198) (-567.349) * (-561.478) [-561.579] (-564.326) (-565.876) -- 0:00:35
434000 -- (-564.157) (-563.151) [-561.596] (-565.148) * [-561.538] (-561.786) (-562.324) (-565.906) -- 0:00:35
434500 -- (-561.807) (-563.103) [-562.859] (-564.693) * (-564.974) (-562.463) (-563.345) [-562.448] -- 0:00:35
435000 -- (-562.427) (-561.804) [-564.715] (-562.514) * (-564.138) (-563.019) (-568.196) [-561.724] -- 0:00:35
Average standard deviation of split frequencies: 0.013865
435500 -- (-563.651) (-562.167) (-561.934) [-564.292] * (-562.444) (-562.337) [-564.452] (-562.779) -- 0:00:34
436000 -- (-563.151) (-561.493) (-564.368) [-561.986] * [-562.648] (-562.146) (-561.177) (-561.412) -- 0:00:34
436500 -- [-562.344] (-561.499) (-566.541) (-565.208) * (-566.354) (-567.364) [-560.960] (-564.912) -- 0:00:34
437000 -- [-561.312] (-565.084) (-564.056) (-565.246) * (-563.120) [-562.917] (-563.860) (-562.066) -- 0:00:34
437500 -- (-561.505) (-563.495) (-563.605) [-561.693] * (-561.289) (-563.665) [-563.874] (-562.361) -- 0:00:34
438000 -- (-560.371) [-561.230] (-561.953) (-560.714) * (-561.336) [-562.156] (-567.116) (-561.561) -- 0:00:34
438500 -- (-561.338) [-562.914] (-563.329) (-561.245) * (-561.867) (-561.207) (-564.203) [-563.155] -- 0:00:34
439000 -- (-560.337) (-564.431) [-563.088] (-563.016) * (-562.780) (-562.365) [-562.234] (-561.631) -- 0:00:34
439500 -- (-561.875) (-561.175) (-561.303) [-562.045] * (-561.098) [-561.239] (-563.140) (-565.608) -- 0:00:34
440000 -- (-564.994) (-560.711) [-561.653] (-563.125) * (-560.802) [-562.198] (-561.355) (-565.376) -- 0:00:35
Average standard deviation of split frequencies: 0.012636
440500 -- (-562.690) (-562.667) (-561.016) [-561.519] * (-561.026) (-563.744) (-564.373) [-563.456] -- 0:00:35
441000 -- (-562.835) [-561.354] (-562.250) (-567.972) * (-562.072) [-564.304] (-561.035) (-564.017) -- 0:00:35
441500 -- (-562.320) (-566.060) (-563.742) [-567.702] * (-563.895) (-561.774) [-565.459] (-563.776) -- 0:00:35
442000 -- (-561.383) (-562.566) [-560.965] (-564.218) * (-562.073) [-566.727] (-562.191) (-561.850) -- 0:00:35
442500 -- [-560.929] (-563.397) (-561.419) (-560.371) * (-561.310) (-568.699) (-560.813) [-561.639] -- 0:00:35
443000 -- (-562.899) (-562.504) [-565.524] (-561.645) * (-564.639) (-561.666) (-563.447) [-564.957] -- 0:00:35
443500 -- (-561.743) (-562.231) [-565.153] (-563.167) * (-565.390) [-560.949] (-562.189) (-562.586) -- 0:00:35
444000 -- [-562.271] (-562.385) (-564.987) (-561.461) * (-563.080) [-561.611] (-560.765) (-562.838) -- 0:00:35
444500 -- [-562.717] (-562.624) (-562.624) (-563.377) * [-561.812] (-561.606) (-560.902) (-563.491) -- 0:00:34
445000 -- (-562.912) (-564.291) [-561.935] (-563.179) * (-561.406) (-561.618) (-568.428) [-562.380] -- 0:00:34
Average standard deviation of split frequencies: 0.012419
445500 -- (-566.098) [-562.148] (-564.655) (-563.510) * (-563.149) (-561.397) [-561.424] (-562.785) -- 0:00:34
446000 -- (-566.819) (-561.601) (-563.908) [-562.471] * (-561.264) (-561.663) (-562.182) [-562.822] -- 0:00:34
446500 -- (-562.654) (-562.372) (-561.960) [-561.436] * [-561.840] (-561.088) (-561.439) (-561.374) -- 0:00:34
447000 -- (-561.356) (-562.591) (-560.764) [-562.305] * (-563.155) (-569.590) [-561.941] (-562.623) -- 0:00:34
447500 -- (-560.842) (-565.201) (-564.587) [-563.125] * [-563.251] (-564.772) (-560.816) (-561.119) -- 0:00:34
448000 -- (-563.786) [-563.292] (-562.631) (-562.905) * (-562.073) (-564.856) [-563.245] (-563.098) -- 0:00:34
448500 -- (-561.595) [-563.250] (-564.134) (-568.370) * [-561.168] (-566.965) (-562.210) (-564.301) -- 0:00:34
449000 -- [-561.156] (-561.838) (-564.999) (-560.791) * (-562.046) (-561.706) [-562.458] (-562.947) -- 0:00:34
449500 -- [-563.439] (-563.082) (-562.616) (-569.536) * (-562.264) [-562.294] (-560.964) (-561.902) -- 0:00:34
450000 -- (-564.926) [-560.934] (-565.767) (-563.745) * (-564.004) [-560.997] (-561.353) (-565.776) -- 0:00:34
Average standard deviation of split frequencies: 0.011855
450500 -- (-564.263) [-561.575] (-561.822) (-561.801) * (-561.244) (-563.525) (-561.894) [-563.773] -- 0:00:34
451000 -- (-563.635) [-561.386] (-564.807) (-560.831) * [-561.315] (-574.198) (-561.735) (-564.412) -- 0:00:34
451500 -- (-565.616) (-562.105) (-564.571) [-562.438] * (-561.438) (-571.829) [-561.312] (-563.199) -- 0:00:34
452000 -- (-569.161) (-560.544) [-563.677] (-562.953) * (-563.890) (-565.594) [-561.312] (-560.873) -- 0:00:33
452500 -- (-565.283) (-561.169) [-561.390] (-564.705) * (-565.636) (-566.581) [-560.917] (-562.516) -- 0:00:33
453000 -- (-563.814) [-560.613] (-560.667) (-566.298) * (-562.513) (-564.638) [-562.446] (-564.848) -- 0:00:33
453500 -- (-562.099) (-560.811) (-564.324) [-561.235] * [-561.599] (-567.943) (-563.720) (-561.605) -- 0:00:33
454000 -- (-561.515) (-565.046) [-562.355] (-561.211) * (-562.352) [-564.016] (-561.711) (-560.689) -- 0:00:33
454500 -- (-563.712) (-564.023) (-563.370) [-562.156] * (-562.105) (-561.929) [-561.411] (-561.190) -- 0:00:33
455000 -- [-562.507] (-566.773) (-562.171) (-561.346) * (-562.987) (-560.696) [-561.219] (-564.072) -- 0:00:33
Average standard deviation of split frequencies: 0.011992
455500 -- [-563.088] (-561.882) (-562.537) (-562.083) * (-562.971) [-560.573] (-561.185) (-561.292) -- 0:00:33
456000 -- (-561.743) (-562.254) [-561.220] (-563.732) * [-563.357] (-560.664) (-561.016) (-561.847) -- 0:00:33
456500 -- (-560.835) (-561.897) (-565.415) [-564.728] * (-565.826) [-561.394] (-561.262) (-560.566) -- 0:00:33
457000 -- (-561.115) (-564.619) (-560.195) [-563.348] * (-565.360) (-561.495) (-562.538) [-561.074] -- 0:00:34
457500 -- (-567.022) (-563.137) (-560.574) [-560.237] * (-563.016) (-562.503) [-562.715] (-563.790) -- 0:00:34
458000 -- (-567.766) [-562.225] (-561.320) (-561.715) * (-562.614) (-562.642) (-561.658) [-561.558] -- 0:00:34
458500 -- (-565.796) (-562.437) [-561.614] (-561.168) * (-562.781) [-562.169] (-560.663) (-561.879) -- 0:00:34
459000 -- (-561.186) (-564.978) [-560.934] (-563.792) * (-561.157) (-562.411) (-563.296) [-560.810] -- 0:00:34
459500 -- (-567.747) (-563.665) [-560.540] (-562.364) * [-562.642] (-562.715) (-565.695) (-561.458) -- 0:00:34
460000 -- (-563.048) [-563.714] (-561.846) (-563.643) * (-562.892) (-562.399) (-568.369) [-561.367] -- 0:00:34
Average standard deviation of split frequencies: 0.011666
460500 -- [-560.575] (-562.722) (-563.125) (-561.545) * [-563.706] (-562.381) (-565.642) (-561.871) -- 0:00:33
461000 -- (-564.275) (-564.636) (-563.482) [-562.405] * [-562.335] (-562.947) (-565.392) (-563.610) -- 0:00:33
461500 -- (-563.526) (-566.764) [-560.747] (-563.710) * (-561.941) (-560.664) (-563.741) [-561.900] -- 0:00:33
462000 -- (-561.453) (-565.163) [-560.647] (-561.550) * (-564.121) (-561.925) (-562.578) [-564.188] -- 0:00:33
462500 -- [-562.103] (-563.006) (-562.335) (-562.681) * (-562.372) (-561.074) (-565.137) [-560.898] -- 0:00:33
463000 -- (-562.588) [-564.134] (-563.111) (-560.787) * (-568.686) (-562.878) (-562.599) [-561.822] -- 0:00:33
463500 -- (-563.693) (-562.603) [-561.673] (-563.594) * (-563.574) (-561.509) (-560.875) [-561.050] -- 0:00:33
464000 -- (-561.608) (-561.968) [-565.593] (-560.948) * (-562.655) (-562.775) (-560.666) [-561.237] -- 0:00:33
464500 -- (-561.262) (-561.991) (-564.847) [-561.244] * (-563.620) (-561.384) (-561.882) [-561.553] -- 0:00:33
465000 -- [-561.106] (-563.949) (-561.441) (-563.149) * (-563.812) [-562.224] (-566.825) (-561.306) -- 0:00:33
Average standard deviation of split frequencies: 0.011600
465500 -- (-562.315) [-561.210] (-561.126) (-564.900) * [-563.793] (-564.903) (-563.689) (-561.619) -- 0:00:33
466000 -- (-560.675) [-562.383] (-561.535) (-560.798) * [-561.382] (-562.443) (-562.759) (-560.848) -- 0:00:33
466500 -- (-561.202) (-561.623) [-562.052] (-560.779) * (-565.054) [-562.802] (-562.740) (-561.017) -- 0:00:33
467000 -- (-562.503) (-567.698) (-564.172) [-564.381] * (-563.277) [-562.189] (-562.303) (-565.458) -- 0:00:33
467500 -- (-562.891) (-563.459) [-563.028] (-562.147) * (-561.962) (-562.467) (-560.977) [-564.541] -- 0:00:33
468000 -- (-562.657) [-565.915] (-562.345) (-562.362) * (-561.441) (-566.035) (-563.953) [-563.859] -- 0:00:32
468500 -- (-564.398) (-561.178) [-562.907] (-561.910) * (-561.899) (-565.150) [-566.101] (-561.113) -- 0:00:32
469000 -- (-561.707) (-563.907) (-562.190) [-562.459] * (-565.382) (-568.163) (-562.169) [-562.356] -- 0:00:32
469500 -- (-563.699) (-564.328) (-562.093) [-560.923] * (-562.674) (-562.801) (-564.826) [-560.767] -- 0:00:32
470000 -- (-564.527) (-562.131) [-561.036] (-562.140) * (-562.724) (-562.884) [-568.396] (-562.923) -- 0:00:32
Average standard deviation of split frequencies: 0.011485
470500 -- (-561.640) [-562.074] (-563.033) (-564.730) * (-563.835) (-563.209) [-560.638] (-561.852) -- 0:00:32
471000 -- (-563.765) (-560.648) (-562.629) [-561.428] * (-566.244) [-561.001] (-560.763) (-561.955) -- 0:00:32
471500 -- [-563.406] (-564.368) (-567.417) (-561.403) * (-565.297) [-563.342] (-561.044) (-562.583) -- 0:00:32
472000 -- [-560.885] (-562.029) (-564.171) (-563.806) * (-560.780) (-564.384) [-561.236] (-562.394) -- 0:00:32
472500 -- [-560.739] (-561.482) (-564.390) (-566.214) * (-564.103) (-562.690) [-561.316] (-562.094) -- 0:00:32
473000 -- (-562.097) (-561.978) (-561.908) [-565.105] * [-562.788] (-561.056) (-561.058) (-564.446) -- 0:00:32
473500 -- (-564.157) (-561.311) (-563.457) [-562.594] * (-563.599) (-561.424) (-561.097) [-561.807] -- 0:00:32
474000 -- [-569.188] (-561.547) (-563.289) (-562.908) * (-563.468) (-562.838) [-562.383] (-565.287) -- 0:00:33
474500 -- (-564.884) [-561.889] (-561.768) (-562.607) * [-560.471] (-563.612) (-564.743) (-563.810) -- 0:00:33
475000 -- (-561.820) (-562.271) [-562.157] (-566.410) * [-565.571] (-562.664) (-560.569) (-562.973) -- 0:00:33
Average standard deviation of split frequencies: 0.011290
475500 -- [-563.826] (-563.166) (-561.600) (-563.810) * (-564.526) (-563.769) (-568.610) [-562.999] -- 0:00:33
476000 -- (-561.415) (-562.351) (-562.157) [-561.145] * (-561.696) (-566.283) (-562.453) [-563.037] -- 0:00:33
476500 -- (-560.656) (-564.865) [-565.110] (-564.158) * (-561.903) (-563.597) [-562.981] (-565.549) -- 0:00:32
477000 -- (-561.764) (-562.851) [-561.951] (-560.959) * [-564.262] (-562.965) (-561.814) (-563.032) -- 0:00:32
477500 -- (-563.939) (-562.613) [-561.988] (-563.860) * (-561.568) (-561.162) [-562.904] (-561.187) -- 0:00:32
478000 -- (-565.660) (-561.787) [-560.203] (-562.371) * [-566.073] (-560.546) (-562.291) (-562.742) -- 0:00:32
478500 -- (-561.292) [-566.240] (-560.845) (-565.690) * [-563.554] (-563.348) (-561.866) (-565.303) -- 0:00:32
479000 -- [-560.718] (-561.209) (-564.110) (-563.947) * (-560.816) (-562.604) [-562.379] (-561.924) -- 0:00:32
479500 -- (-561.474) (-563.497) [-562.879] (-562.413) * (-562.750) (-563.458) (-566.381) [-564.864] -- 0:00:32
480000 -- (-562.000) (-561.223) [-562.921] (-564.623) * (-567.627) [-563.293] (-565.421) (-563.041) -- 0:00:32
Average standard deviation of split frequencies: 0.012030
480500 -- (-562.190) (-563.373) [-566.663] (-563.457) * (-564.775) (-565.511) (-561.613) [-564.878] -- 0:00:32
481000 -- (-560.729) (-561.018) [-565.025] (-563.156) * (-564.682) [-563.332] (-564.566) (-564.007) -- 0:00:32
481500 -- [-563.540] (-561.106) (-564.835) (-560.619) * (-563.299) [-561.779] (-562.268) (-562.068) -- 0:00:32
482000 -- (-565.712) (-561.134) [-562.598] (-562.427) * (-564.528) [-563.145] (-560.989) (-562.094) -- 0:00:32
482500 -- (-567.198) (-563.627) (-562.674) [-562.354] * [-561.542] (-567.323) (-561.441) (-562.131) -- 0:00:32
483000 -- (-566.873) (-561.446) [-561.171] (-560.733) * (-562.623) [-563.157] (-562.513) (-560.394) -- 0:00:32
483500 -- [-561.144] (-564.434) (-565.253) (-560.967) * (-565.432) [-562.766] (-563.028) (-560.556) -- 0:00:32
484000 -- (-565.531) (-562.905) [-563.755] (-560.756) * (-568.462) [-564.644] (-561.426) (-561.881) -- 0:00:31
484500 -- (-561.225) (-564.059) (-561.616) [-562.417] * (-564.564) (-563.066) (-561.529) [-561.670] -- 0:00:31
485000 -- (-561.033) (-565.154) [-560.987] (-563.319) * (-565.274) (-560.921) (-562.715) [-564.047] -- 0:00:31
Average standard deviation of split frequencies: 0.011640
485500 -- (-562.071) [-563.782] (-561.580) (-562.091) * (-563.274) (-562.196) (-562.431) [-561.694] -- 0:00:31
486000 -- (-565.792) [-563.141] (-561.054) (-565.118) * [-562.405] (-564.450) (-562.695) (-562.875) -- 0:00:31
486500 -- (-566.109) (-563.852) (-560.609) [-562.248] * (-562.080) [-561.085] (-563.101) (-565.997) -- 0:00:31
487000 -- (-562.642) [-563.798] (-563.106) (-561.632) * (-561.265) (-561.606) (-562.471) [-564.288] -- 0:00:31
487500 -- (-560.665) (-563.617) [-561.570] (-560.976) * (-562.628) (-565.723) [-563.223] (-561.563) -- 0:00:31
488000 -- (-560.263) (-560.359) (-564.834) [-564.063] * [-562.732] (-562.665) (-561.481) (-561.043) -- 0:00:31
488500 -- (-562.091) (-563.250) [-566.909] (-567.644) * [-561.210] (-564.228) (-561.070) (-563.294) -- 0:00:31
489000 -- (-562.445) [-561.900] (-563.380) (-566.705) * (-562.088) (-560.616) (-560.986) [-562.026] -- 0:00:31
489500 -- (-561.794) [-561.766] (-564.435) (-563.158) * (-563.839) (-563.483) (-561.581) [-562.138] -- 0:00:31
490000 -- (-562.260) (-561.146) [-562.949] (-563.578) * (-566.639) (-562.247) [-560.917] (-564.827) -- 0:00:31
Average standard deviation of split frequencies: 0.012129
490500 -- (-565.878) [-561.935] (-564.326) (-561.938) * (-565.182) [-562.820] (-562.072) (-563.135) -- 0:00:32
491000 -- (-563.833) (-562.306) (-562.142) [-560.933] * [-560.506] (-563.686) (-561.925) (-562.922) -- 0:00:32
491500 -- (-560.587) (-568.004) (-562.237) [-562.665] * (-563.524) (-562.304) (-561.439) [-565.514] -- 0:00:32
492000 -- [-561.459] (-562.919) (-561.146) (-563.668) * [-565.621] (-563.721) (-562.066) (-563.164) -- 0:00:32
492500 -- (-565.729) (-563.648) (-562.381) [-563.338] * (-563.433) (-562.205) (-561.467) [-566.031] -- 0:00:31
493000 -- (-561.415) (-563.317) (-562.474) [-566.464] * [-561.740] (-563.713) (-563.219) (-567.976) -- 0:00:31
493500 -- [-561.231] (-563.089) (-561.781) (-566.525) * (-561.653) [-561.958] (-564.129) (-562.345) -- 0:00:31
494000 -- [-560.714] (-565.195) (-561.705) (-563.733) * (-560.566) (-561.754) [-561.760] (-562.101) -- 0:00:31
494500 -- [-562.698] (-561.613) (-561.799) (-563.607) * [-562.570] (-563.349) (-564.437) (-560.637) -- 0:00:31
495000 -- (-561.808) [-562.702] (-564.057) (-565.454) * (-566.518) [-562.551] (-568.124) (-561.533) -- 0:00:31
Average standard deviation of split frequencies: 0.011595
495500 -- (-562.807) [-561.294] (-563.474) (-564.260) * (-566.321) (-564.547) [-563.750] (-562.130) -- 0:00:31
496000 -- (-561.373) [-561.597] (-563.763) (-564.839) * (-564.500) (-562.228) (-562.076) [-564.106] -- 0:00:31
496500 -- [-560.803] (-563.259) (-561.220) (-560.147) * [-561.448] (-560.454) (-566.184) (-563.916) -- 0:00:31
497000 -- (-562.564) (-561.229) (-564.873) [-564.829] * (-561.148) (-561.550) [-561.421] (-563.056) -- 0:00:31
497500 -- [-564.078] (-564.356) (-563.626) (-560.656) * [-561.302] (-561.543) (-561.376) (-562.032) -- 0:00:31
498000 -- (-561.779) [-561.833] (-565.416) (-560.570) * (-560.608) [-560.355] (-563.049) (-562.719) -- 0:00:31
498500 -- [-566.366] (-561.215) (-566.515) (-563.924) * (-565.797) [-560.721] (-562.374) (-561.534) -- 0:00:31
499000 -- (-563.000) [-561.199] (-567.886) (-566.877) * (-561.330) (-561.886) [-565.812] (-564.389) -- 0:00:31
499500 -- (-563.114) (-561.588) (-562.307) [-561.028] * (-564.741) (-564.687) [-561.703] (-562.182) -- 0:00:31
500000 -- (-562.643) [-562.089] (-563.000) (-561.343) * (-561.835) (-563.010) [-562.165] (-564.807) -- 0:00:31
Average standard deviation of split frequencies: 0.012064
500500 -- (-565.089) (-565.148) [-560.312] (-565.100) * [-561.440] (-561.983) (-562.285) (-567.618) -- 0:00:30
501000 -- (-562.595) (-563.021) [-561.773] (-568.263) * [-563.978] (-561.813) (-563.727) (-561.040) -- 0:00:30
501500 -- (-562.017) (-564.248) (-562.614) [-561.257] * (-562.538) (-563.825) [-569.448] (-561.147) -- 0:00:30
502000 -- (-561.045) (-561.743) (-562.457) [-561.201] * (-560.531) [-561.195] (-564.262) (-566.436) -- 0:00:30
502500 -- [-560.595] (-563.223) (-565.436) (-561.548) * (-560.305) (-560.893) (-562.342) [-561.542] -- 0:00:30
503000 -- [-563.951] (-566.681) (-562.097) (-563.216) * (-562.182) (-563.663) (-563.359) [-561.196] -- 0:00:30
503500 -- (-562.869) (-565.515) [-563.640] (-563.790) * [-563.995] (-560.919) (-562.115) (-563.827) -- 0:00:30
504000 -- (-561.309) (-561.278) (-561.613) [-560.725] * (-565.069) (-561.908) [-562.226] (-563.156) -- 0:00:30
504500 -- (-570.049) (-561.116) [-563.640] (-560.820) * (-561.640) [-564.980] (-562.185) (-563.096) -- 0:00:30
505000 -- (-567.615) [-561.226] (-561.360) (-561.319) * (-567.039) (-562.878) [-562.363] (-560.295) -- 0:00:30
Average standard deviation of split frequencies: 0.011937
505500 -- (-565.642) [-561.432] (-565.160) (-561.486) * [-562.306] (-562.929) (-561.054) (-563.365) -- 0:00:30
506000 -- (-566.585) [-564.843] (-564.204) (-565.280) * (-563.829) (-560.559) (-564.040) [-564.667] -- 0:00:30
506500 -- (-564.726) [-563.970] (-564.048) (-561.712) * (-561.637) [-561.125] (-562.091) (-561.730) -- 0:00:30
507000 -- [-561.680] (-562.952) (-563.145) (-561.410) * (-562.012) [-560.935] (-562.824) (-567.356) -- 0:00:31
507500 -- (-560.149) [-566.309] (-560.987) (-564.466) * [-565.376] (-563.904) (-565.207) (-561.713) -- 0:00:31
508000 -- (-561.547) (-562.059) (-560.948) [-563.617] * (-562.565) (-563.468) [-563.956] (-563.044) -- 0:00:30
508500 -- (-563.509) [-562.114] (-563.461) (-563.135) * (-561.549) (-563.004) [-563.389] (-564.551) -- 0:00:30
509000 -- [-563.142] (-562.874) (-563.268) (-572.835) * (-560.446) (-562.350) (-563.841) [-561.783] -- 0:00:30
509500 -- (-561.282) (-565.847) (-561.865) [-563.638] * (-561.686) [-561.987] (-563.873) (-564.640) -- 0:00:30
510000 -- (-561.914) (-563.177) (-560.574) [-562.550] * [-561.660] (-564.711) (-565.114) (-562.528) -- 0:00:30
Average standard deviation of split frequencies: 0.011654
510500 -- [-561.977] (-568.151) (-561.051) (-562.650) * (-561.474) (-561.600) (-560.976) [-561.857] -- 0:00:30
511000 -- (-562.081) (-563.376) [-561.916] (-563.263) * (-561.778) (-564.833) [-560.819] (-561.967) -- 0:00:30
511500 -- (-563.531) (-564.960) (-560.740) [-560.942] * [-561.753] (-566.720) (-561.410) (-561.480) -- 0:00:30
512000 -- (-565.096) (-562.565) (-561.422) [-561.402] * (-562.923) (-566.082) [-561.290] (-560.754) -- 0:00:30
512500 -- [-561.893] (-561.119) (-565.063) (-560.901) * (-561.723) (-565.655) [-561.127] (-564.665) -- 0:00:30
513000 -- [-561.057] (-563.416) (-566.995) (-561.105) * (-572.424) (-562.162) [-562.277] (-562.103) -- 0:00:30
513500 -- (-561.175) [-566.643] (-566.393) (-565.128) * (-561.857) (-560.531) [-562.411] (-562.136) -- 0:00:30
514000 -- (-562.988) (-563.322) (-563.047) [-563.959] * [-565.157] (-563.187) (-563.693) (-562.979) -- 0:00:30
514500 -- (-563.063) [-561.306] (-567.775) (-563.964) * (-564.925) (-564.599) [-562.734] (-561.774) -- 0:00:30
515000 -- (-565.864) (-563.511) [-561.633] (-563.207) * (-560.613) [-563.006] (-560.486) (-564.674) -- 0:00:30
Average standard deviation of split frequencies: 0.011648
515500 -- (-563.965) (-565.120) [-560.695] (-564.314) * (-562.671) [-561.469] (-561.599) (-566.222) -- 0:00:30
516000 -- (-564.461) (-562.465) [-561.256] (-566.098) * (-562.553) (-565.218) [-562.276] (-565.065) -- 0:00:30
516500 -- (-562.615) (-562.591) [-561.408] (-565.875) * (-567.267) (-566.252) [-562.067] (-562.097) -- 0:00:29
517000 -- [-560.565] (-562.437) (-562.867) (-565.099) * (-562.271) (-564.914) [-563.843] (-566.273) -- 0:00:29
517500 -- [-560.312] (-561.116) (-563.596) (-563.878) * (-561.922) (-561.923) (-563.269) [-566.384] -- 0:00:29
518000 -- (-562.483) (-560.688) (-564.157) [-561.188] * [-561.293] (-564.384) (-561.632) (-561.429) -- 0:00:29
518500 -- (-560.386) (-560.883) [-564.433] (-562.715) * [-562.279] (-564.699) (-563.459) (-563.963) -- 0:00:29
519000 -- (-564.424) (-562.838) (-561.335) [-562.349] * (-563.648) (-561.765) (-561.271) [-565.289] -- 0:00:29
519500 -- [-562.066] (-560.255) (-560.559) (-564.533) * (-560.730) (-561.676) [-560.779] (-563.117) -- 0:00:29
520000 -- (-561.076) (-560.642) (-562.158) [-562.565] * (-563.334) (-560.516) (-560.739) [-561.242] -- 0:00:29
Average standard deviation of split frequencies: 0.011996
520500 -- (-561.402) (-561.856) (-563.013) [-561.855] * (-562.344) (-561.147) [-561.965] (-561.080) -- 0:00:29
521000 -- (-561.365) (-561.629) (-564.901) [-562.104] * (-561.147) (-563.723) (-564.946) [-563.921] -- 0:00:29
521500 -- [-564.364] (-566.874) (-566.521) (-565.044) * (-560.918) (-561.436) [-561.967] (-561.866) -- 0:00:29
522000 -- [-561.535] (-562.214) (-564.919) (-567.414) * [-560.918] (-564.465) (-563.131) (-563.112) -- 0:00:29
522500 -- [-566.227] (-564.709) (-561.785) (-562.508) * (-563.015) (-563.337) [-563.059] (-560.876) -- 0:00:29
523000 -- (-564.623) [-560.572] (-562.099) (-563.033) * [-561.950] (-561.302) (-562.140) (-560.676) -- 0:00:29
523500 -- (-564.135) (-563.701) [-561.537] (-563.821) * [-564.806] (-565.822) (-562.518) (-563.994) -- 0:00:29
524000 -- (-563.427) [-561.111] (-563.577) (-564.395) * [-563.103] (-562.225) (-562.600) (-563.814) -- 0:00:29
524500 -- [-561.187] (-563.689) (-562.796) (-562.565) * [-562.786] (-568.634) (-561.655) (-562.511) -- 0:00:29
525000 -- (-563.581) [-562.165] (-564.805) (-563.017) * (-565.084) (-568.819) (-563.341) [-566.747] -- 0:00:29
Average standard deviation of split frequencies: 0.011763
525500 -- (-567.504) (-563.426) (-562.709) [-562.265] * (-563.216) [-562.243] (-561.030) (-562.322) -- 0:00:29
526000 -- (-562.976) (-564.102) [-562.116] (-563.401) * (-565.872) (-562.033) [-562.014] (-563.545) -- 0:00:29
526500 -- (-562.608) [-563.189] (-563.382) (-561.734) * (-563.435) (-565.009) (-560.674) [-562.956] -- 0:00:29
527000 -- [-565.427] (-560.956) (-560.945) (-560.357) * (-562.638) [-563.694] (-562.596) (-562.786) -- 0:00:29
527500 -- (-563.863) (-562.003) [-560.832] (-561.136) * [-561.741] (-562.095) (-561.998) (-563.012) -- 0:00:29
528000 -- (-562.388) (-561.303) [-562.126] (-562.951) * (-561.921) (-562.346) [-561.221] (-561.927) -- 0:00:29
528500 -- (-563.403) (-562.488) (-565.671) [-562.265] * (-562.046) (-561.588) [-561.720] (-560.407) -- 0:00:29
529000 -- (-563.276) (-562.305) [-562.493] (-563.303) * [-561.014] (-565.074) (-561.035) (-562.626) -- 0:00:29
529500 -- (-563.041) (-566.735) (-562.778) [-565.970] * (-565.239) [-567.590] (-561.209) (-570.340) -- 0:00:29
530000 -- [-562.053] (-564.735) (-563.511) (-560.898) * [-565.069] (-569.126) (-562.149) (-561.906) -- 0:00:29
Average standard deviation of split frequencies: 0.011430
530500 -- [-564.645] (-563.738) (-565.067) (-562.948) * (-563.609) (-561.425) (-560.447) [-560.837] -- 0:00:29
531000 -- [-561.479] (-562.139) (-563.977) (-563.438) * (-561.295) [-562.032] (-560.856) (-564.937) -- 0:00:29
531500 -- (-561.748) (-565.191) [-564.802] (-564.381) * (-562.146) [-561.531] (-561.338) (-561.163) -- 0:00:29
532000 -- (-562.125) [-561.064] (-563.037) (-561.777) * (-562.694) (-561.768) (-562.557) [-560.767] -- 0:00:29
532500 -- (-561.448) (-561.114) [-562.719] (-567.004) * [-562.421] (-561.526) (-561.751) (-562.400) -- 0:00:28
533000 -- [-561.143] (-562.252) (-561.453) (-562.774) * (-565.026) [-561.688] (-561.595) (-561.340) -- 0:00:28
533500 -- (-561.921) (-562.133) (-563.365) [-563.190] * (-563.137) (-561.909) [-562.583] (-561.640) -- 0:00:28
534000 -- [-563.082] (-561.558) (-560.689) (-560.934) * [-563.301] (-562.596) (-561.918) (-564.115) -- 0:00:28
534500 -- (-562.891) [-560.996] (-563.344) (-560.993) * (-564.036) (-563.260) (-562.752) [-562.251] -- 0:00:28
535000 -- (-561.273) [-561.192] (-563.740) (-561.599) * (-565.133) (-563.739) (-563.022) [-564.870] -- 0:00:28
Average standard deviation of split frequencies: 0.011023
535500 -- (-561.013) (-565.174) [-562.353] (-564.306) * [-561.416] (-561.702) (-562.899) (-564.529) -- 0:00:28
536000 -- (-561.285) [-563.227] (-560.586) (-561.232) * (-561.972) (-561.064) [-563.030] (-561.943) -- 0:00:28
536500 -- (-564.450) [-561.653] (-564.405) (-565.648) * (-562.094) [-560.730] (-562.426) (-561.940) -- 0:00:28
537000 -- (-561.402) (-561.152) [-564.275] (-563.225) * (-561.702) (-562.749) [-565.948] (-561.338) -- 0:00:28
537500 -- (-562.684) [-564.478] (-561.842) (-561.956) * (-561.163) (-563.033) (-565.518) [-560.878] -- 0:00:28
538000 -- (-564.859) (-564.724) (-563.514) [-561.408] * (-560.707) [-563.952] (-562.674) (-563.441) -- 0:00:28
538500 -- (-563.093) (-563.250) (-565.110) [-561.493] * (-560.624) (-564.058) [-562.634] (-562.332) -- 0:00:28
539000 -- (-565.252) [-562.515] (-561.750) (-563.453) * [-562.952] (-561.725) (-563.423) (-562.339) -- 0:00:28
539500 -- (-561.482) (-563.395) [-563.508] (-562.650) * [-561.895] (-571.713) (-563.501) (-562.880) -- 0:00:28
540000 -- (-565.764) [-561.719] (-562.759) (-565.755) * [-562.810] (-564.224) (-562.624) (-560.642) -- 0:00:28
Average standard deviation of split frequencies: 0.010637
540500 -- (-564.269) (-563.236) [-562.056] (-569.972) * (-560.857) (-569.632) [-561.871] (-566.994) -- 0:00:28
541000 -- (-565.390) (-564.394) [-564.228] (-571.611) * [-562.875] (-560.480) (-562.465) (-562.263) -- 0:00:28
541500 -- (-566.497) (-561.863) [-561.625] (-566.135) * (-564.036) (-563.069) (-561.932) [-562.544] -- 0:00:28
542000 -- (-561.718) (-561.771) [-560.878] (-562.659) * (-563.254) (-562.922) [-562.266] (-562.455) -- 0:00:28
542500 -- (-562.076) [-562.311] (-561.529) (-562.438) * (-562.686) (-565.996) (-563.868) [-562.176] -- 0:00:28
543000 -- (-568.718) [-562.291] (-566.287) (-561.017) * [-560.431] (-561.253) (-561.912) (-564.062) -- 0:00:28
543500 -- (-565.076) (-562.476) [-564.557] (-562.026) * [-560.291] (-561.865) (-565.093) (-563.149) -- 0:00:28
544000 -- (-566.140) [-560.813] (-564.222) (-565.726) * [-564.284] (-563.836) (-564.278) (-569.156) -- 0:00:28
544500 -- (-564.878) [-560.459] (-564.155) (-562.963) * [-562.107] (-562.807) (-564.900) (-566.058) -- 0:00:28
545000 -- (-566.819) [-561.549] (-563.059) (-560.567) * (-562.403) (-561.852) [-562.680] (-561.159) -- 0:00:28
Average standard deviation of split frequencies: 0.010073
545500 -- (-565.549) (-565.099) [-565.795] (-561.382) * (-563.486) (-560.615) (-562.785) [-564.665] -- 0:00:28
546000 -- (-563.898) (-568.452) [-568.072] (-565.153) * (-565.126) (-560.615) [-561.232] (-561.723) -- 0:00:28
546500 -- (-560.575) (-566.500) (-564.019) [-564.334] * (-564.037) (-563.483) [-564.421] (-561.491) -- 0:00:28
547000 -- (-562.787) (-563.140) (-568.575) [-563.134] * (-561.675) (-563.552) [-562.344] (-565.391) -- 0:00:28
547500 -- (-561.271) [-560.735] (-566.292) (-563.143) * (-563.419) (-566.382) (-561.072) [-564.052] -- 0:00:28
548000 -- [-561.528] (-562.296) (-567.389) (-560.614) * (-560.543) (-564.841) (-561.819) [-562.356] -- 0:00:28
548500 -- (-561.387) (-560.667) (-562.747) [-563.230] * (-561.112) (-564.282) [-566.853] (-561.635) -- 0:00:27
549000 -- (-562.748) (-560.265) [-562.277] (-562.117) * [-563.613] (-563.083) (-563.256) (-564.634) -- 0:00:27
549500 -- [-565.258] (-561.128) (-564.536) (-563.999) * (-561.171) [-562.500] (-562.042) (-565.696) -- 0:00:27
550000 -- (-561.281) (-563.190) [-563.025] (-561.048) * (-562.209) [-562.626] (-565.131) (-563.909) -- 0:00:27
Average standard deviation of split frequencies: 0.009702
550500 -- [-565.755] (-561.533) (-561.794) (-562.514) * [-562.847] (-560.977) (-561.996) (-562.329) -- 0:00:27
551000 -- [-563.241] (-562.327) (-562.426) (-560.795) * (-565.940) [-565.169] (-560.992) (-564.954) -- 0:00:27
551500 -- (-560.739) (-562.127) (-561.856) [-560.811] * (-569.240) [-566.752] (-563.833) (-561.176) -- 0:00:27
552000 -- (-566.358) (-562.988) (-561.312) [-563.523] * (-563.888) (-564.260) (-562.159) [-561.566] -- 0:00:27
552500 -- (-565.469) (-562.147) (-563.942) [-561.443] * (-563.464) (-561.622) [-563.376] (-561.765) -- 0:00:27
553000 -- (-563.006) (-560.865) [-561.316] (-563.492) * [-560.935] (-562.101) (-561.831) (-562.671) -- 0:00:27
553500 -- (-561.530) [-562.515] (-562.361) (-563.488) * (-561.690) [-565.849] (-562.359) (-561.409) -- 0:00:27
554000 -- (-561.375) [-561.655] (-564.161) (-562.589) * (-561.184) (-561.816) [-561.381] (-562.413) -- 0:00:27
554500 -- (-562.588) [-562.564] (-562.162) (-561.293) * (-561.399) [-560.284] (-564.208) (-561.086) -- 0:00:27
555000 -- (-562.524) (-561.966) [-560.533] (-564.557) * (-562.439) (-560.290) (-562.347) [-563.272] -- 0:00:27
Average standard deviation of split frequencies: 0.009496
555500 -- (-563.826) [-560.865] (-562.581) (-561.176) * (-561.119) (-561.651) [-561.417] (-562.687) -- 0:00:28
556000 -- [-563.169] (-566.872) (-561.276) (-560.818) * (-562.194) (-563.272) (-564.360) [-563.944] -- 0:00:27
556500 -- (-565.676) (-564.497) [-560.810] (-563.374) * (-564.666) (-565.216) [-563.011] (-562.497) -- 0:00:27
557000 -- (-561.757) (-565.458) [-561.419] (-565.079) * (-562.121) (-562.031) (-561.282) [-563.332] -- 0:00:27
557500 -- (-561.115) (-561.859) [-561.652] (-562.517) * (-561.398) (-564.975) [-561.996] (-562.206) -- 0:00:27
558000 -- (-565.850) [-565.599] (-562.360) (-562.833) * (-560.618) (-562.176) (-565.243) [-563.017] -- 0:00:27
558500 -- (-561.955) (-561.117) [-562.285] (-561.516) * (-560.393) (-561.573) (-561.339) [-561.477] -- 0:00:27
559000 -- (-562.291) (-562.304) (-562.400) [-560.738] * (-561.951) [-560.516] (-562.232) (-561.465) -- 0:00:27
559500 -- [-560.592] (-563.145) (-562.118) (-561.335) * (-561.825) [-561.964] (-561.189) (-561.314) -- 0:00:27
560000 -- (-561.554) (-566.103) (-561.182) [-563.467] * (-561.332) (-562.601) (-569.933) [-561.135] -- 0:00:27
Average standard deviation of split frequencies: 0.009753
560500 -- (-560.605) (-562.172) (-560.977) [-561.671] * [-562.104] (-562.963) (-571.293) (-562.920) -- 0:00:27
561000 -- [-561.856] (-564.417) (-560.340) (-560.601) * (-565.742) (-563.652) (-561.955) [-562.928] -- 0:00:27
561500 -- [-563.518] (-562.059) (-566.042) (-564.978) * [-568.222] (-561.378) (-562.205) (-561.998) -- 0:00:27
562000 -- [-562.417] (-563.086) (-565.791) (-561.749) * (-563.306) (-561.885) (-562.926) [-563.940] -- 0:00:27
562500 -- (-564.843) (-563.921) [-563.245] (-561.376) * (-561.436) [-561.419] (-563.889) (-563.585) -- 0:00:27
563000 -- [-562.132] (-561.861) (-564.160) (-562.677) * (-560.456) (-564.762) [-561.086] (-562.001) -- 0:00:27
563500 -- (-563.959) [-562.624] (-562.960) (-565.130) * (-561.181) [-561.562] (-561.151) (-564.327) -- 0:00:27
564000 -- (-568.079) (-563.809) (-562.520) [-563.169] * (-563.209) [-562.792] (-561.575) (-564.115) -- 0:00:27
564500 -- [-561.730] (-562.980) (-564.506) (-566.700) * [-560.767] (-563.316) (-562.971) (-563.477) -- 0:00:27
565000 -- [-560.850] (-563.115) (-561.342) (-563.236) * (-562.724) (-562.104) (-562.226) [-563.613] -- 0:00:26
Average standard deviation of split frequencies: 0.009550
565500 -- [-563.131] (-561.676) (-565.705) (-562.098) * (-564.443) [-561.392] (-565.159) (-567.742) -- 0:00:26
566000 -- (-561.641) (-563.149) (-560.779) [-561.730] * (-565.788) [-561.489] (-562.043) (-563.918) -- 0:00:26
566500 -- (-560.820) [-565.060] (-564.784) (-569.341) * (-565.114) (-562.022) [-561.751] (-560.742) -- 0:00:26
567000 -- (-561.288) [-560.358] (-561.917) (-565.363) * (-563.079) [-561.903] (-561.106) (-561.648) -- 0:00:26
567500 -- (-561.610) (-561.580) [-561.588] (-564.330) * [-563.850] (-561.599) (-562.595) (-564.545) -- 0:00:26
568000 -- (-561.032) (-562.524) [-560.705] (-561.886) * (-566.036) (-562.654) (-561.120) [-564.330] -- 0:00:26
568500 -- (-561.951) [-561.010] (-562.602) (-565.388) * (-561.718) (-570.706) (-561.367) [-562.681] -- 0:00:26
569000 -- [-561.633] (-562.707) (-563.178) (-565.533) * [-561.203] (-564.220) (-561.421) (-561.748) -- 0:00:26
569500 -- (-564.413) (-563.735) [-561.684] (-561.443) * [-566.422] (-561.142) (-566.970) (-562.068) -- 0:00:26
570000 -- (-562.373) [-561.373] (-560.752) (-563.185) * (-565.336) [-562.617] (-562.790) (-562.795) -- 0:00:26
Average standard deviation of split frequencies: 0.009362
570500 -- (-561.808) [-564.823] (-560.313) (-562.588) * (-563.633) [-561.134] (-566.997) (-561.469) -- 0:00:26
571000 -- (-565.475) (-561.078) [-561.999] (-562.033) * (-564.966) (-563.555) (-565.322) [-561.249] -- 0:00:26
571500 -- (-569.425) [-562.512] (-561.831) (-562.049) * [-562.275] (-564.873) (-563.339) (-565.594) -- 0:00:26
572000 -- (-562.408) (-563.729) [-562.966] (-569.515) * (-565.111) [-560.758] (-561.832) (-562.117) -- 0:00:26
572500 -- [-561.779] (-563.758) (-565.785) (-563.525) * [-561.939] (-561.500) (-561.979) (-563.041) -- 0:00:26
573000 -- (-561.902) [-564.470] (-569.175) (-567.854) * [-563.268] (-562.587) (-560.886) (-563.368) -- 0:00:26
573500 -- [-563.348] (-564.453) (-562.621) (-565.181) * [-560.700] (-563.040) (-563.281) (-561.233) -- 0:00:26
574000 -- (-565.385) [-561.761] (-561.513) (-561.461) * (-561.163) (-565.531) (-561.937) [-561.696] -- 0:00:26
574500 -- [-560.424] (-563.590) (-560.611) (-560.825) * (-563.866) [-561.244] (-561.877) (-562.271) -- 0:00:26
575000 -- (-560.442) [-561.116] (-562.232) (-562.157) * (-564.885) [-561.985] (-561.104) (-564.371) -- 0:00:26
Average standard deviation of split frequencies: 0.009275
575500 -- (-564.291) (-561.282) [-562.811] (-561.150) * (-565.892) (-564.835) (-564.253) [-561.491] -- 0:00:26
576000 -- (-562.645) [-562.430] (-568.054) (-563.476) * [-561.418] (-565.105) (-563.707) (-561.614) -- 0:00:26
576500 -- (-563.557) [-562.067] (-561.080) (-562.795) * (-561.621) (-563.815) [-562.046] (-561.483) -- 0:00:26
577000 -- (-563.419) [-561.339] (-565.089) (-565.857) * (-562.190) [-560.331] (-567.907) (-565.361) -- 0:00:26
577500 -- [-561.344] (-561.811) (-564.046) (-566.813) * (-569.135) (-560.841) (-565.126) [-566.639] -- 0:00:26
578000 -- (-561.356) (-561.920) (-560.904) [-560.966] * (-566.601) [-560.339] (-560.639) (-574.676) -- 0:00:26
578500 -- (-566.476) (-563.337) (-564.487) [-563.872] * [-560.427] (-561.361) (-566.710) (-565.552) -- 0:00:26
579000 -- [-562.744] (-561.446) (-566.096) (-560.314) * (-562.393) (-560.603) [-563.372] (-561.888) -- 0:00:26
579500 -- (-562.704) (-561.340) (-566.065) [-563.244] * [-561.732] (-560.524) (-562.133) (-562.236) -- 0:00:26
580000 -- [-564.444] (-562.126) (-563.573) (-563.190) * (-560.300) (-567.443) [-563.435] (-568.657) -- 0:00:26
Average standard deviation of split frequencies: 0.009363
580500 -- (-565.489) [-561.920] (-569.196) (-565.657) * (-560.492) (-561.728) (-562.440) [-562.324] -- 0:00:26
581000 -- (-565.586) (-561.537) (-563.775) [-561.481] * (-562.290) (-565.579) (-561.187) [-562.367] -- 0:00:25
581500 -- (-564.445) (-562.994) (-562.499) [-563.421] * (-562.811) [-561.466] (-562.709) (-560.294) -- 0:00:25
582000 -- (-564.001) (-562.893) (-560.785) [-564.970] * (-563.046) [-561.975] (-564.729) (-560.275) -- 0:00:25
582500 -- [-563.129] (-564.129) (-562.013) (-565.636) * (-562.316) [-561.451] (-561.477) (-562.523) -- 0:00:25
583000 -- (-560.920) (-563.133) (-561.044) [-563.512] * (-561.275) [-561.908] (-561.549) (-562.121) -- 0:00:25
583500 -- (-562.430) [-561.267] (-562.822) (-563.160) * [-560.889] (-561.698) (-562.193) (-561.021) -- 0:00:25
584000 -- (-561.152) (-562.527) (-561.968) [-562.901] * (-562.526) [-561.534] (-561.809) (-560.521) -- 0:00:25
584500 -- (-561.876) (-565.382) (-567.247) [-561.686] * (-564.489) (-561.902) [-562.212] (-563.564) -- 0:00:25
585000 -- (-563.162) (-561.126) (-567.313) [-563.241] * (-564.298) (-561.234) (-561.013) [-563.685] -- 0:00:25
Average standard deviation of split frequencies: 0.009224
585500 -- (-562.893) (-562.414) [-561.606] (-563.092) * (-563.241) (-561.502) [-562.943] (-563.271) -- 0:00:25
586000 -- [-562.565] (-563.998) (-561.777) (-562.816) * (-561.781) (-561.553) [-561.753] (-562.499) -- 0:00:26
586500 -- (-562.301) (-561.626) [-560.442] (-564.541) * (-563.068) (-563.014) [-561.969] (-563.778) -- 0:00:26
587000 -- (-567.707) (-563.894) (-563.227) [-563.268] * (-564.886) (-563.162) (-561.217) [-563.276] -- 0:00:26
587500 -- (-561.902) (-564.415) [-561.023] (-562.085) * (-566.368) (-563.212) (-561.976) [-565.460] -- 0:00:25
588000 -- (-561.072) (-565.991) [-561.909] (-560.542) * (-566.250) [-561.129] (-563.651) (-565.309) -- 0:00:25
588500 -- (-565.904) (-565.339) [-561.900] (-560.342) * [-561.413] (-566.202) (-563.481) (-565.479) -- 0:00:25
589000 -- (-564.115) (-563.567) [-561.042] (-560.924) * (-563.077) (-565.205) [-560.890] (-563.871) -- 0:00:25
589500 -- (-560.721) (-560.152) [-561.345] (-560.472) * (-562.220) (-562.250) [-560.775] (-564.622) -- 0:00:25
590000 -- (-560.425) [-561.923] (-560.986) (-561.807) * (-562.850) (-560.723) [-561.639] (-561.312) -- 0:00:25
Average standard deviation of split frequencies: 0.008513
590500 -- (-562.485) [-561.322] (-561.290) (-565.513) * (-561.354) (-561.829) [-562.707] (-563.648) -- 0:00:25
591000 -- (-564.049) (-561.187) [-563.407] (-561.670) * (-561.953) (-561.236) (-562.589) [-562.365] -- 0:00:25
591500 -- (-562.034) (-565.912) (-563.989) [-560.885] * (-562.092) (-562.859) [-565.284] (-563.593) -- 0:00:25
592000 -- (-560.657) (-561.781) (-565.014) [-561.995] * (-562.880) (-562.537) [-562.504] (-562.807) -- 0:00:25
592500 -- (-564.676) (-560.594) (-567.498) [-563.986] * [-562.009] (-562.102) (-566.542) (-567.508) -- 0:00:25
593000 -- (-561.390) (-564.031) (-568.292) [-563.325] * (-563.554) [-561.583] (-564.223) (-563.887) -- 0:00:25
593500 -- [-560.475] (-561.740) (-564.982) (-561.558) * [-563.313] (-563.240) (-566.166) (-561.585) -- 0:00:25
594000 -- (-561.790) (-568.927) [-562.623] (-560.678) * (-562.249) (-565.680) (-560.828) [-561.640] -- 0:00:25
594500 -- (-563.715) [-560.550] (-561.369) (-562.422) * (-564.435) (-562.417) [-561.184] (-562.307) -- 0:00:25
595000 -- (-563.224) (-562.614) [-564.100] (-561.753) * (-562.137) [-560.384] (-561.898) (-562.908) -- 0:00:25
Average standard deviation of split frequencies: 0.008859
595500 -- (-565.351) [-562.138] (-560.495) (-563.174) * (-561.566) [-560.411] (-565.159) (-563.574) -- 0:00:25
596000 -- (-561.653) [-562.420] (-561.443) (-565.808) * (-562.807) (-561.775) (-561.921) [-561.172] -- 0:00:25
596500 -- (-561.588) [-562.930] (-562.710) (-562.357) * [-561.330] (-563.009) (-562.945) (-561.222) -- 0:00:25
597000 -- (-562.862) (-562.451) [-563.722] (-561.726) * (-563.529) (-562.932) [-562.544] (-563.667) -- 0:00:24
597500 -- (-563.467) (-564.084) [-564.575] (-561.729) * (-561.593) [-561.724] (-564.762) (-563.618) -- 0:00:24
598000 -- [-562.861] (-561.682) (-561.944) (-560.357) * (-561.850) (-564.523) (-561.683) [-561.233] -- 0:00:25
598500 -- (-562.899) (-562.402) [-561.737] (-561.130) * (-565.127) (-562.032) [-561.707] (-563.915) -- 0:00:25
599000 -- (-562.568) [-562.799] (-563.564) (-562.519) * (-563.721) (-563.030) (-561.181) [-563.178] -- 0:00:25
599500 -- (-563.141) (-560.864) (-566.282) [-561.921] * (-562.065) [-563.936] (-560.869) (-560.766) -- 0:00:25
600000 -- (-562.093) [-563.402] (-561.959) (-563.630) * [-562.762] (-563.496) (-560.954) (-562.337) -- 0:00:25
Average standard deviation of split frequencies: 0.008528
600500 -- (-561.601) [-564.919] (-562.063) (-563.573) * [-561.769] (-562.258) (-563.222) (-562.413) -- 0:00:25
601000 -- (-560.678) (-562.539) [-561.714] (-562.590) * [-560.656] (-562.874) (-562.850) (-565.489) -- 0:00:25
601500 -- [-560.931] (-562.170) (-562.240) (-562.615) * (-560.389) (-562.263) (-565.707) [-562.092] -- 0:00:25
602000 -- [-560.512] (-562.705) (-562.618) (-562.540) * (-560.450) [-560.895] (-564.965) (-565.526) -- 0:00:25
602500 -- [-561.679] (-560.616) (-567.017) (-562.410) * (-560.895) (-561.801) (-564.252) [-565.306] -- 0:00:25
603000 -- (-561.349) (-561.190) (-561.518) [-561.559] * (-562.239) (-563.802) [-562.937] (-561.780) -- 0:00:25
603500 -- [-561.585] (-562.659) (-561.489) (-562.025) * (-565.722) (-562.775) (-564.572) [-561.313] -- 0:00:24
604000 -- (-563.851) [-561.111] (-562.160) (-564.744) * [-561.883] (-566.744) (-563.181) (-561.155) -- 0:00:24
604500 -- (-561.947) (-563.611) [-561.864] (-564.069) * [-563.019] (-562.020) (-561.187) (-565.623) -- 0:00:24
605000 -- [-561.795] (-565.018) (-562.026) (-561.575) * (-562.302) (-565.296) [-562.776] (-563.187) -- 0:00:24
Average standard deviation of split frequencies: 0.009024
605500 -- (-562.374) (-565.463) [-561.996] (-564.519) * (-563.430) [-560.666] (-563.238) (-563.255) -- 0:00:24
606000 -- (-563.162) [-562.301] (-563.751) (-564.611) * (-571.709) (-567.360) (-563.114) [-561.407] -- 0:00:24
606500 -- (-561.490) (-562.130) (-562.213) [-563.062] * (-565.037) (-572.151) (-561.360) [-563.455] -- 0:00:24
607000 -- (-563.502) (-562.342) [-562.097] (-563.345) * (-567.138) (-566.303) [-564.541] (-563.851) -- 0:00:24
607500 -- (-564.363) (-560.896) [-563.331] (-563.700) * (-566.668) [-561.565] (-563.491) (-564.187) -- 0:00:24
608000 -- (-562.508) [-562.279] (-571.065) (-561.127) * (-564.406) [-562.298] (-563.174) (-564.899) -- 0:00:24
608500 -- (-563.580) [-564.496] (-562.666) (-561.613) * (-563.476) [-562.153] (-565.072) (-564.760) -- 0:00:24
609000 -- (-564.863) (-563.093) [-563.480] (-564.360) * (-560.990) (-561.524) [-561.654] (-560.631) -- 0:00:24
609500 -- (-562.113) [-560.924] (-563.033) (-562.547) * (-562.756) (-566.649) (-564.979) [-560.098] -- 0:00:24
610000 -- (-561.736) (-562.668) (-566.354) [-561.143] * [-561.331] (-565.728) (-563.254) (-560.742) -- 0:00:24
Average standard deviation of split frequencies: 0.009263
610500 -- [-560.978] (-563.065) (-563.332) (-560.902) * (-563.151) (-564.776) [-562.209] (-561.307) -- 0:00:24
611000 -- (-564.787) (-561.482) [-563.594] (-560.629) * (-565.557) (-562.327) [-560.811] (-561.560) -- 0:00:24
611500 -- [-562.278] (-563.384) (-562.793) (-564.788) * (-565.250) (-562.703) [-560.806] (-561.691) -- 0:00:24
612000 -- (-560.613) (-561.854) [-561.355] (-564.098) * (-563.177) [-560.962] (-562.773) (-563.080) -- 0:00:24
612500 -- [-561.567] (-563.280) (-565.540) (-561.206) * (-563.379) [-563.917] (-562.940) (-562.531) -- 0:00:24
613000 -- [-561.934] (-561.747) (-566.399) (-562.122) * (-564.268) (-562.829) (-565.387) [-562.858] -- 0:00:24
613500 -- [-562.081] (-565.521) (-562.135) (-565.017) * (-561.683) (-562.543) (-563.721) [-563.941] -- 0:00:24
614000 -- (-561.945) (-563.629) (-564.493) [-561.105] * (-560.890) [-562.107] (-561.825) (-561.316) -- 0:00:24
614500 -- (-562.529) [-568.819] (-560.809) (-562.103) * (-561.535) [-560.925] (-562.608) (-561.781) -- 0:00:24
615000 -- [-561.907] (-566.006) (-562.051) (-566.132) * (-563.972) [-561.136] (-569.434) (-560.889) -- 0:00:24
Average standard deviation of split frequencies: 0.008561
615500 -- (-562.127) [-565.067] (-564.205) (-562.510) * (-561.664) [-563.731] (-563.349) (-563.208) -- 0:00:24
616000 -- [-561.398] (-562.385) (-563.335) (-564.008) * (-562.916) (-564.778) [-562.544] (-562.554) -- 0:00:24
616500 -- [-562.334] (-565.473) (-562.270) (-562.335) * (-566.271) (-560.727) [-561.828] (-563.478) -- 0:00:24
617000 -- (-563.322) [-565.263] (-560.903) (-562.212) * [-562.931] (-560.590) (-564.071) (-565.335) -- 0:00:24
617500 -- (-562.768) [-562.239] (-561.851) (-561.658) * (-561.077) (-561.316) [-562.445] (-562.922) -- 0:00:24
618000 -- (-560.535) (-570.673) [-561.077] (-562.826) * (-561.671) [-560.639] (-562.771) (-563.992) -- 0:00:24
618500 -- (-561.961) [-563.134] (-560.680) (-562.438) * (-560.412) [-561.837] (-561.523) (-563.863) -- 0:00:24
619000 -- (-561.526) (-562.652) [-560.964] (-562.729) * [-564.942] (-562.953) (-561.861) (-568.818) -- 0:00:24
619500 -- (-563.250) (-561.595) [-561.704] (-561.559) * (-562.798) (-561.866) [-561.861] (-562.699) -- 0:00:23
620000 -- (-562.800) [-565.321] (-563.825) (-562.430) * (-570.183) (-562.751) (-563.142) [-560.451] -- 0:00:23
Average standard deviation of split frequencies: 0.008212
620500 -- (-561.354) (-561.863) (-560.314) [-562.726] * (-562.677) (-563.144) (-562.452) [-560.207] -- 0:00:23
621000 -- (-560.368) [-561.288] (-561.202) (-562.433) * (-563.384) (-561.138) (-560.705) [-564.862] -- 0:00:23
621500 -- (-560.798) (-562.594) (-560.863) [-564.207] * (-561.056) (-562.896) [-561.217] (-568.068) -- 0:00:23
622000 -- [-562.072] (-563.813) (-563.811) (-561.715) * (-563.544) (-562.823) (-560.482) [-562.226] -- 0:00:23
622500 -- (-561.527) (-562.463) [-561.825] (-561.906) * (-560.323) (-563.762) (-560.895) [-561.672] -- 0:00:23
623000 -- (-561.455) (-565.789) (-563.070) [-561.364] * (-562.042) (-561.983) [-562.449] (-563.835) -- 0:00:23
623500 -- (-561.477) [-560.699] (-562.605) (-562.967) * (-561.184) [-563.074] (-561.275) (-561.253) -- 0:00:23
624000 -- (-563.423) (-564.025) [-566.262] (-562.931) * (-564.248) (-566.148) (-563.015) [-562.613] -- 0:00:23
624500 -- (-562.814) [-562.645] (-563.585) (-561.930) * [-563.373] (-563.691) (-562.311) (-561.427) -- 0:00:23
625000 -- [-561.801] (-563.619) (-562.806) (-561.534) * (-561.358) (-562.236) [-565.416] (-562.990) -- 0:00:23
Average standard deviation of split frequencies: 0.009037
625500 -- (-566.160) (-563.431) (-561.010) [-563.070] * (-562.759) [-562.327] (-565.955) (-563.260) -- 0:00:23
626000 -- (-563.229) (-561.679) [-563.013] (-563.692) * [-564.441] (-562.275) (-561.301) (-564.022) -- 0:00:23
626500 -- [-563.378] (-563.369) (-561.523) (-566.069) * (-562.845) (-562.790) (-562.474) [-561.017] -- 0:00:23
627000 -- (-562.397) (-561.401) [-561.150] (-563.290) * [-562.094] (-561.910) (-563.886) (-563.276) -- 0:00:23
627500 -- (-564.011) (-564.005) [-564.418] (-566.856) * (-561.549) [-563.299] (-561.804) (-563.264) -- 0:00:23
628000 -- (-563.290) (-563.031) [-562.093] (-561.064) * [-564.767] (-562.472) (-562.275) (-560.893) -- 0:00:23
628500 -- (-562.548) (-566.172) (-561.317) [-561.550] * (-564.408) [-566.198] (-560.810) (-561.518) -- 0:00:23
629000 -- (-561.018) (-562.453) (-562.283) [-561.665] * [-563.832] (-561.527) (-563.106) (-562.394) -- 0:00:23
629500 -- (-564.844) (-562.563) [-566.621] (-560.983) * (-561.764) [-560.636] (-563.765) (-570.852) -- 0:00:22
630000 -- (-562.984) [-563.733] (-562.978) (-562.216) * [-561.832] (-563.528) (-562.785) (-563.907) -- 0:00:23
Average standard deviation of split frequencies: 0.009518
630500 -- [-562.236] (-561.797) (-564.215) (-561.983) * (-561.119) [-563.247] (-563.225) (-562.806) -- 0:00:23
631000 -- (-561.537) (-561.601) (-567.869) [-565.725] * (-569.550) (-563.065) [-561.109] (-563.842) -- 0:00:23
631500 -- [-561.244] (-562.632) (-564.873) (-560.869) * (-565.529) [-560.705] (-564.281) (-565.662) -- 0:00:23
632000 -- [-563.589] (-561.619) (-564.279) (-564.338) * (-563.108) (-561.040) [-562.319] (-562.739) -- 0:00:23
632500 -- (-564.310) (-560.849) [-563.149] (-561.399) * (-562.183) (-561.106) [-561.023] (-561.674) -- 0:00:23
633000 -- (-561.720) (-560.888) [-560.527] (-561.610) * (-560.837) (-563.334) [-564.747] (-560.906) -- 0:00:23
633500 -- (-560.801) (-561.889) [-561.036] (-561.221) * (-563.005) [-563.519] (-563.005) (-561.931) -- 0:00:23
634000 -- [-560.796] (-561.163) (-561.122) (-562.317) * [-561.652] (-562.299) (-561.194) (-561.764) -- 0:00:23
634500 -- (-565.626) [-561.157] (-561.628) (-561.583) * (-561.177) (-563.056) (-561.578) [-563.616] -- 0:00:23
635000 -- (-570.654) [-561.112] (-561.871) (-562.366) * (-562.183) (-560.936) [-561.987] (-561.334) -- 0:00:22
Average standard deviation of split frequencies: 0.009543
635500 -- (-563.028) (-565.694) [-563.019] (-563.230) * [-564.975] (-560.729) (-562.932) (-563.125) -- 0:00:22
636000 -- (-564.271) (-563.624) (-562.314) [-561.306] * (-562.771) (-563.425) (-565.010) [-562.645] -- 0:00:22
636500 -- (-564.568) [-562.433] (-561.243) (-565.599) * (-565.084) (-562.314) [-562.481] (-565.768) -- 0:00:22
637000 -- (-565.023) (-565.161) [-562.950] (-564.090) * (-562.920) (-563.522) [-561.122] (-562.390) -- 0:00:22
637500 -- [-560.842] (-564.127) (-565.715) (-565.153) * [-562.048] (-563.762) (-564.746) (-561.842) -- 0:00:22
638000 -- [-561.798] (-563.079) (-560.907) (-562.683) * [-564.698] (-565.934) (-564.349) (-566.707) -- 0:00:22
638500 -- (-562.385) [-561.827] (-563.596) (-560.945) * [-563.244] (-562.840) (-562.152) (-561.583) -- 0:00:22
639000 -- [-563.404] (-560.704) (-561.251) (-561.544) * (-561.801) (-564.074) [-561.154] (-562.771) -- 0:00:22
639500 -- (-562.950) (-562.456) [-564.145] (-564.170) * [-563.213] (-561.939) (-564.183) (-567.527) -- 0:00:22
640000 -- (-563.080) (-561.266) (-563.660) [-565.027] * (-562.388) [-562.062] (-565.378) (-561.906) -- 0:00:22
Average standard deviation of split frequencies: 0.009795
640500 -- (-563.258) [-562.931] (-563.076) (-564.392) * [-562.403] (-561.690) (-563.310) (-563.848) -- 0:00:22
641000 -- (-566.234) (-560.950) [-563.325] (-560.925) * [-560.994] (-561.811) (-564.109) (-566.145) -- 0:00:22
641500 -- (-565.423) (-562.883) [-565.063] (-562.250) * (-563.205) (-560.532) (-561.621) [-563.787] -- 0:00:22
642000 -- (-563.000) [-562.219] (-566.102) (-562.063) * (-561.743) (-562.756) [-561.877] (-561.983) -- 0:00:22
642500 -- [-565.385] (-561.470) (-564.336) (-560.968) * (-561.992) (-566.523) (-562.212) [-561.251] -- 0:00:22
643000 -- [-560.308] (-561.624) (-563.613) (-564.449) * (-560.854) (-561.626) (-566.952) [-562.206] -- 0:00:22
643500 -- [-562.653] (-564.439) (-564.547) (-563.355) * (-563.446) (-567.771) (-567.443) [-563.331] -- 0:00:22
644000 -- (-565.029) (-561.493) (-563.318) [-561.677] * (-562.594) (-567.630) (-562.241) [-562.881] -- 0:00:22
644500 -- [-563.639] (-562.080) (-561.158) (-565.320) * (-562.660) (-565.563) [-560.622] (-562.496) -- 0:00:22
645000 -- [-562.725] (-564.648) (-561.962) (-563.221) * (-561.747) (-561.695) [-560.626] (-561.442) -- 0:00:22
Average standard deviation of split frequencies: 0.010079
645500 -- (-563.726) (-562.813) (-562.022) [-567.472] * (-562.143) [-562.409] (-561.480) (-566.969) -- 0:00:21
646000 -- [-563.352] (-563.475) (-562.034) (-564.550) * (-562.046) [-562.107] (-560.781) (-561.331) -- 0:00:21
646500 -- [-560.734] (-563.382) (-563.519) (-563.767) * (-561.174) (-562.779) [-562.019] (-566.769) -- 0:00:21
647000 -- (-562.479) (-562.065) (-563.187) [-563.185] * (-562.008) [-562.418] (-565.480) (-564.087) -- 0:00:22
647500 -- (-561.159) (-564.188) (-563.495) [-562.839] * (-561.629) (-561.513) [-562.913] (-562.041) -- 0:00:22
648000 -- [-562.822] (-567.772) (-564.117) (-561.711) * (-561.753) (-565.136) (-562.136) [-561.060] -- 0:00:22
648500 -- (-564.229) (-566.502) [-562.294] (-562.595) * (-563.947) [-564.654] (-563.134) (-562.477) -- 0:00:22
649000 -- (-566.011) (-562.585) (-561.405) [-562.504] * (-562.128) (-568.487) [-564.748] (-562.028) -- 0:00:22
649500 -- (-565.467) [-564.248] (-565.382) (-561.160) * (-572.487) (-565.538) [-561.723] (-561.198) -- 0:00:22
650000 -- (-571.225) (-563.766) [-562.908] (-561.223) * [-561.921] (-562.817) (-560.456) (-560.612) -- 0:00:22
Average standard deviation of split frequencies: 0.009600
650500 -- (-564.166) (-560.135) [-560.403] (-561.833) * (-563.743) [-561.256] (-561.990) (-561.428) -- 0:00:22
651000 -- [-561.920] (-560.938) (-561.550) (-566.689) * (-564.352) (-561.407) [-563.814] (-561.625) -- 0:00:21
651500 -- (-562.132) (-562.543) (-562.074) [-561.849] * [-561.153] (-563.444) (-561.229) (-562.504) -- 0:00:21
652000 -- (-563.161) (-563.403) (-561.196) [-560.401] * (-564.028) (-565.479) [-563.149] (-560.545) -- 0:00:21
652500 -- (-563.079) (-562.787) [-561.524] (-562.188) * (-564.568) [-562.211] (-566.066) (-562.332) -- 0:00:21
653000 -- (-562.995) [-563.702] (-560.837) (-562.739) * [-560.989] (-561.946) (-563.947) (-561.821) -- 0:00:21
653500 -- (-563.484) (-563.113) (-562.824) [-560.595] * (-562.500) [-561.752] (-561.814) (-564.772) -- 0:00:21
654000 -- (-562.509) (-563.033) (-561.430) [-562.123] * (-561.032) (-561.913) (-560.487) [-561.634] -- 0:00:21
654500 -- (-562.424) [-562.500] (-566.257) (-561.625) * [-562.398] (-563.333) (-560.649) (-561.932) -- 0:00:21
655000 -- (-563.131) [-563.760] (-562.595) (-564.169) * [-562.121] (-561.390) (-563.297) (-563.400) -- 0:00:21
Average standard deviation of split frequencies: 0.008983
655500 -- (-560.598) (-562.149) (-561.487) [-561.614] * (-563.558) [-561.143] (-560.849) (-561.245) -- 0:00:21
656000 -- [-560.748] (-562.139) (-561.825) (-565.968) * (-562.064) (-564.878) (-562.227) [-561.835] -- 0:00:21
656500 -- [-561.660] (-560.221) (-565.662) (-568.565) * (-566.071) [-562.832] (-563.858) (-562.195) -- 0:00:21
657000 -- (-560.703) [-561.694] (-561.536) (-562.826) * (-562.391) (-561.632) (-561.809) [-563.318] -- 0:00:21
657500 -- [-560.869] (-560.904) (-563.119) (-560.664) * (-563.237) (-564.231) (-563.832) [-563.133] -- 0:00:21
658000 -- (-561.827) (-562.684) (-565.922) [-561.375] * [-560.892] (-561.100) (-562.970) (-562.708) -- 0:00:21
658500 -- [-563.250] (-561.687) (-563.467) (-562.251) * [-561.605] (-562.065) (-568.806) (-563.201) -- 0:00:21
659000 -- (-563.057) (-567.796) (-561.919) [-564.570] * [-562.561] (-569.327) (-564.208) (-562.455) -- 0:00:21
659500 -- (-564.124) (-564.863) (-564.029) [-561.390] * (-561.775) (-566.845) (-562.875) [-562.114] -- 0:00:21
660000 -- (-564.133) [-561.744] (-563.990) (-564.547) * (-561.732) (-562.565) (-563.165) [-561.732] -- 0:00:21
Average standard deviation of split frequencies: 0.008964
660500 -- [-563.170] (-562.674) (-565.523) (-561.636) * [-561.319] (-563.415) (-560.584) (-561.588) -- 0:00:21
661000 -- [-566.767] (-560.891) (-567.215) (-561.033) * [-561.527] (-562.696) (-560.706) (-565.343) -- 0:00:21
661500 -- (-563.794) (-563.396) [-563.514] (-563.827) * [-560.537] (-562.166) (-561.482) (-560.758) -- 0:00:20
662000 -- [-560.743] (-563.568) (-562.675) (-562.289) * (-561.259) [-562.011] (-565.185) (-560.872) -- 0:00:20
662500 -- (-562.112) (-563.738) [-561.355] (-562.189) * (-561.331) (-562.521) [-563.006] (-561.556) -- 0:00:20
663000 -- [-562.505] (-562.447) (-562.208) (-562.242) * (-560.776) (-563.292) [-562.425] (-562.095) -- 0:00:20
663500 -- (-562.929) (-563.545) [-561.475] (-563.873) * (-565.021) (-564.739) (-564.844) [-561.881] -- 0:00:20
664000 -- (-568.995) (-562.751) (-564.707) [-561.408] * (-563.257) [-561.398] (-563.402) (-561.381) -- 0:00:21
664500 -- (-564.533) (-561.771) (-563.324) [-562.431] * (-562.845) [-560.646] (-561.824) (-561.514) -- 0:00:21
665000 -- (-564.796) (-561.815) [-561.889] (-563.850) * (-562.225) [-563.538] (-563.075) (-561.793) -- 0:00:21
Average standard deviation of split frequencies: 0.009157
665500 -- (-561.970) (-562.455) [-561.289] (-560.758) * (-566.875) (-566.615) [-560.494] (-563.974) -- 0:00:21
666000 -- (-563.174) [-562.979] (-561.708) (-561.569) * [-561.503] (-564.144) (-562.631) (-562.115) -- 0:00:21
666500 -- (-561.626) [-562.549] (-561.203) (-562.224) * [-561.123] (-562.540) (-561.141) (-568.850) -- 0:00:21
667000 -- [-562.230] (-566.435) (-561.536) (-561.965) * [-563.035] (-564.180) (-565.713) (-568.165) -- 0:00:20
667500 -- (-562.171) (-563.356) (-561.755) [-562.187] * (-563.530) [-563.310] (-563.943) (-564.982) -- 0:00:20
668000 -- (-561.259) [-563.075] (-560.960) (-562.991) * (-563.682) [-561.417] (-564.126) (-562.282) -- 0:00:20
668500 -- (-562.173) [-562.008] (-562.208) (-561.848) * (-564.344) (-562.980) [-563.254] (-561.681) -- 0:00:20
669000 -- (-562.900) (-561.827) [-560.967] (-563.824) * (-564.935) (-562.525) (-564.969) [-561.715] -- 0:00:20
669500 -- (-561.814) [-563.130] (-563.172) (-563.734) * (-567.642) [-562.258] (-562.860) (-562.149) -- 0:00:20
670000 -- (-562.609) (-562.610) (-561.204) [-568.650] * (-560.672) [-561.143] (-566.781) (-562.253) -- 0:00:20
Average standard deviation of split frequencies: 0.009357
670500 -- (-561.930) [-560.498] (-561.756) (-564.262) * [-561.125] (-560.485) (-563.208) (-561.077) -- 0:00:20
671000 -- (-561.289) (-566.748) (-560.612) [-564.401] * (-561.326) (-563.104) [-561.012] (-562.379) -- 0:00:20
671500 -- [-563.818] (-561.625) (-564.583) (-563.123) * (-564.750) (-562.985) (-560.505) [-562.048] -- 0:00:20
672000 -- (-562.670) (-564.442) (-562.366) [-561.195] * (-561.457) (-565.261) [-562.168] (-561.098) -- 0:00:20
672500 -- (-564.725) (-562.800) (-560.449) [-561.649] * (-561.507) (-564.686) (-560.722) [-560.980] -- 0:00:20
673000 -- (-565.742) [-563.925] (-561.347) (-564.995) * (-561.292) (-567.722) [-561.066] (-562.039) -- 0:00:20
673500 -- (-564.763) (-564.985) [-564.356] (-563.498) * (-561.836) [-563.518] (-561.014) (-568.288) -- 0:00:20
674000 -- (-562.348) (-561.407) [-561.049] (-564.469) * (-563.135) (-564.578) (-565.083) [-562.951] -- 0:00:20
674500 -- (-563.239) (-563.017) (-562.982) [-561.810] * (-563.954) [-561.507] (-562.069) (-562.479) -- 0:00:20
675000 -- [-560.751] (-561.255) (-563.141) (-561.038) * [-561.553] (-563.710) (-562.630) (-562.808) -- 0:00:20
Average standard deviation of split frequencies: 0.008978
675500 -- (-567.389) (-561.196) [-563.383] (-568.360) * (-560.584) (-564.303) [-561.261] (-563.985) -- 0:00:20
676000 -- (-567.582) (-561.994) [-562.822] (-563.341) * (-566.590) (-563.068) (-561.400) [-560.600] -- 0:00:20
676500 -- (-563.506) [-561.788] (-560.927) (-564.072) * [-563.498] (-564.160) (-563.885) (-561.102) -- 0:00:20
677000 -- (-565.180) (-561.776) [-563.745] (-560.167) * (-560.602) [-561.474] (-568.473) (-561.024) -- 0:00:20
677500 -- (-562.425) (-566.007) [-562.394] (-561.778) * (-563.795) (-565.047) (-565.647) [-561.743] -- 0:00:19
678000 -- (-562.352) (-561.811) [-560.904] (-561.223) * (-561.169) (-562.611) [-560.980] (-568.334) -- 0:00:19
678500 -- (-560.935) [-563.422] (-560.890) (-564.526) * [-560.723] (-562.888) (-561.426) (-567.529) -- 0:00:19
679000 -- [-562.086] (-562.031) (-562.893) (-560.682) * [-560.473] (-562.880) (-561.063) (-563.760) -- 0:00:19
679500 -- (-561.690) [-561.738] (-561.610) (-562.172) * (-561.796) (-561.940) (-562.188) [-563.644] -- 0:00:19
680000 -- (-564.337) [-561.758] (-566.663) (-562.117) * (-565.145) [-561.618] (-561.056) (-561.641) -- 0:00:19
Average standard deviation of split frequencies: 0.008960
680500 -- [-564.095] (-562.434) (-563.043) (-563.289) * (-563.501) (-563.162) [-562.073] (-567.081) -- 0:00:20
681000 -- [-563.053] (-562.675) (-563.905) (-560.990) * [-561.997] (-565.648) (-561.896) (-563.273) -- 0:00:20
681500 -- (-560.736) (-563.607) [-562.722] (-561.545) * (-563.425) (-561.474) [-561.042] (-569.150) -- 0:00:20
682000 -- (-561.800) [-562.037] (-562.301) (-562.889) * [-562.203] (-561.076) (-562.502) (-561.782) -- 0:00:20
682500 -- (-562.417) [-563.695] (-563.185) (-563.922) * (-562.663) (-561.490) (-564.117) [-564.278] -- 0:00:20
683000 -- (-564.013) (-561.597) (-560.582) [-563.093] * (-561.491) (-560.945) (-561.685) [-564.243] -- 0:00:19
683500 -- (-561.677) (-561.199) [-563.077] (-562.630) * (-561.209) [-560.794] (-563.459) (-561.522) -- 0:00:19
684000 -- (-561.019) (-565.564) [-564.719] (-560.849) * (-561.512) (-561.958) (-564.020) [-562.499] -- 0:00:19
684500 -- [-560.748] (-561.853) (-563.312) (-562.196) * (-560.952) (-561.865) [-561.018] (-563.656) -- 0:00:19
685000 -- [-560.980] (-561.332) (-565.074) (-564.211) * [-561.419] (-563.767) (-561.708) (-560.520) -- 0:00:19
Average standard deviation of split frequencies: 0.008976
685500 -- [-560.992] (-562.721) (-562.734) (-562.775) * [-560.456] (-562.196) (-564.212) (-564.688) -- 0:00:19
686000 -- [-562.482] (-561.416) (-562.175) (-565.962) * [-560.936] (-561.980) (-568.887) (-566.090) -- 0:00:19
686500 -- (-563.214) (-563.157) (-563.259) [-561.792] * (-561.951) (-562.538) (-562.594) [-565.176] -- 0:00:19
687000 -- (-562.368) [-560.422] (-564.623) (-561.071) * (-560.716) [-562.612] (-561.562) (-562.845) -- 0:00:19
687500 -- (-561.994) (-563.633) [-564.578] (-566.511) * (-560.565) [-561.007] (-562.765) (-562.976) -- 0:00:19
688000 -- (-562.394) (-566.603) (-564.756) [-563.890] * (-560.489) (-561.999) (-568.846) [-561.284] -- 0:00:19
688500 -- (-562.834) (-564.849) (-562.516) [-561.303] * [-563.063] (-563.365) (-560.428) (-560.507) -- 0:00:19
689000 -- (-564.603) (-565.800) (-561.228) [-561.651] * (-566.176) (-562.402) (-560.708) [-563.846] -- 0:00:19
689500 -- (-565.074) [-565.805] (-562.916) (-562.776) * (-562.129) (-564.883) (-563.060) [-562.168] -- 0:00:19
690000 -- [-562.323] (-564.180) (-562.311) (-560.732) * (-560.749) (-566.160) [-561.897] (-563.292) -- 0:00:19
Average standard deviation of split frequencies: 0.009172
690500 -- [-562.707] (-566.980) (-562.220) (-561.837) * [-560.900] (-567.559) (-564.456) (-565.191) -- 0:00:19
691000 -- [-562.319] (-562.617) (-561.908) (-563.451) * (-562.239) (-562.235) [-561.897] (-563.857) -- 0:00:19
691500 -- (-562.597) (-564.472) [-561.126] (-562.977) * (-561.207) (-562.757) [-561.317] (-562.586) -- 0:00:19
692000 -- [-560.736] (-560.433) (-562.710) (-562.241) * (-566.845) [-563.372] (-562.270) (-561.116) -- 0:00:19
692500 -- (-562.920) [-562.174] (-561.470) (-560.805) * (-562.229) (-561.938) (-562.745) [-562.782] -- 0:00:19
693000 -- (-562.832) (-560.983) (-562.175) [-560.449] * (-564.443) [-564.528] (-561.919) (-563.705) -- 0:00:19
693500 -- (-565.895) (-561.671) [-562.647] (-561.035) * (-563.847) [-562.594] (-561.468) (-562.214) -- 0:00:19
694000 -- (-566.672) (-561.317) [-562.885] (-563.283) * (-565.466) (-560.718) [-563.574] (-563.746) -- 0:00:18
694500 -- (-565.587) (-563.194) (-565.294) [-562.141] * (-563.247) (-562.856) (-562.557) [-562.101] -- 0:00:18
695000 -- (-563.375) (-562.317) (-563.656) [-561.177] * (-561.352) [-563.459] (-562.275) (-562.901) -- 0:00:18
Average standard deviation of split frequencies: 0.009144
695500 -- [-563.021] (-562.331) (-562.124) (-561.284) * (-564.251) [-562.965] (-561.260) (-566.595) -- 0:00:18
696000 -- (-563.167) (-562.780) [-561.222] (-561.294) * (-562.313) (-562.550) [-563.629] (-562.156) -- 0:00:18
696500 -- [-563.107] (-563.239) (-564.867) (-561.840) * (-562.872) [-562.232] (-561.782) (-561.732) -- 0:00:18
697000 -- (-569.620) (-566.052) [-563.986] (-562.959) * [-561.985] (-561.548) (-562.234) (-562.348) -- 0:00:19
697500 -- (-563.297) (-563.920) [-562.934] (-560.965) * [-564.911] (-563.193) (-562.755) (-562.578) -- 0:00:19
698000 -- (-561.980) [-560.733] (-562.497) (-562.100) * [-561.827] (-560.714) (-563.164) (-565.226) -- 0:00:19
698500 -- [-565.060] (-562.248) (-562.124) (-562.287) * [-562.830] (-562.131) (-562.674) (-564.052) -- 0:00:18
699000 -- (-564.084) [-560.443] (-564.261) (-564.809) * (-562.772) (-562.029) (-563.091) [-566.398] -- 0:00:18
699500 -- [-565.001] (-560.561) (-563.509) (-562.577) * (-561.630) (-566.273) (-561.569) [-564.109] -- 0:00:18
700000 -- [-560.860] (-561.997) (-563.151) (-561.519) * [-564.748] (-562.815) (-562.118) (-563.270) -- 0:00:18
Average standard deviation of split frequencies: 0.009083
700500 -- (-561.612) (-562.431) [-564.667] (-562.272) * (-561.353) (-561.957) (-562.265) [-566.348] -- 0:00:18
701000 -- [-560.917] (-562.861) (-562.717) (-561.844) * (-562.944) (-561.108) [-564.146] (-564.741) -- 0:00:18
701500 -- (-564.951) (-562.094) (-560.915) [-562.764] * (-562.493) [-560.999] (-563.004) (-562.228) -- 0:00:18
702000 -- (-561.416) [-562.003] (-562.790) (-567.123) * (-563.215) (-560.870) [-562.453] (-562.145) -- 0:00:18
702500 -- (-561.049) (-561.934) [-562.413] (-563.580) * (-562.060) (-561.611) [-563.469] (-563.180) -- 0:00:18
703000 -- (-563.964) [-562.572] (-569.149) (-562.854) * (-561.409) (-569.241) (-562.072) [-564.013] -- 0:00:18
703500 -- [-568.201] (-562.644) (-563.904) (-562.395) * [-565.751] (-562.523) (-563.378) (-565.577) -- 0:00:18
704000 -- [-561.162] (-560.760) (-565.773) (-565.501) * (-561.171) (-562.482) (-562.935) [-564.577] -- 0:00:18
704500 -- [-561.963] (-562.555) (-564.440) (-563.239) * (-562.857) (-565.309) [-561.772] (-563.412) -- 0:00:18
705000 -- (-565.360) [-565.289] (-564.108) (-561.027) * [-561.748] (-563.502) (-563.778) (-562.581) -- 0:00:18
Average standard deviation of split frequencies: 0.008972
705500 -- [-562.069] (-562.773) (-564.506) (-561.717) * [-560.646] (-561.488) (-565.544) (-561.937) -- 0:00:18
706000 -- (-564.063) [-565.109] (-563.907) (-562.278) * [-565.105] (-561.790) (-564.773) (-561.241) -- 0:00:18
706500 -- (-563.759) [-562.349] (-566.101) (-560.646) * (-563.915) [-564.391] (-562.057) (-561.061) -- 0:00:18
707000 -- (-563.694) [-566.783] (-564.688) (-563.103) * (-564.628) (-564.564) [-560.954] (-562.897) -- 0:00:18
707500 -- (-562.022) [-564.166] (-566.084) (-560.711) * (-564.214) (-561.603) [-563.292] (-564.133) -- 0:00:18
708000 -- (-561.771) (-561.811) (-561.841) [-561.070] * (-566.544) (-561.257) [-560.798] (-562.726) -- 0:00:18
708500 -- (-562.821) (-563.094) (-565.094) [-563.403] * (-565.304) (-564.644) [-561.375] (-563.325) -- 0:00:18
709000 -- (-562.125) [-563.312] (-562.282) (-564.201) * (-561.610) (-562.111) [-561.399] (-560.775) -- 0:00:18
709500 -- (-561.465) (-565.645) [-563.121] (-563.466) * (-562.233) (-565.459) [-562.624] (-563.308) -- 0:00:18
710000 -- [-564.449] (-564.274) (-562.266) (-565.560) * (-562.522) [-561.304] (-562.207) (-564.214) -- 0:00:17
Average standard deviation of split frequencies: 0.008582
710500 -- (-565.291) (-561.833) (-561.478) [-564.327] * [-560.531] (-566.176) (-560.918) (-564.596) -- 0:00:17
711000 -- (-566.330) (-560.725) (-566.022) [-564.589] * (-561.289) (-566.849) [-562.624] (-565.822) -- 0:00:17
711500 -- (-560.588) [-564.232] (-563.635) (-562.558) * (-562.185) (-562.853) (-563.019) [-561.781] -- 0:00:17
712000 -- [-561.737] (-562.571) (-563.339) (-560.474) * (-561.650) (-562.793) [-562.911] (-562.060) -- 0:00:17
712500 -- (-562.426) (-562.962) (-561.560) [-560.763] * [-561.519] (-562.352) (-563.386) (-561.014) -- 0:00:17
713000 -- (-562.625) (-560.762) [-561.399] (-562.276) * (-563.840) [-563.598] (-565.600) (-560.653) -- 0:00:17
713500 -- [-564.055] (-562.467) (-563.277) (-564.693) * (-566.544) [-563.102] (-564.000) (-562.004) -- 0:00:17
714000 -- (-564.811) (-561.358) [-564.204] (-565.549) * [-561.980] (-563.654) (-562.840) (-562.883) -- 0:00:18
714500 -- (-561.171) (-562.350) [-562.639] (-562.403) * (-564.357) (-563.431) [-561.319] (-565.097) -- 0:00:17
715000 -- (-561.130) (-562.740) (-561.643) [-562.485] * (-564.758) (-562.931) (-563.416) [-563.294] -- 0:00:17
Average standard deviation of split frequencies: 0.008394
715500 -- [-560.713] (-561.571) (-562.753) (-560.382) * [-564.031] (-565.897) (-563.093) (-561.854) -- 0:00:17
716000 -- [-562.373] (-564.316) (-562.898) (-562.959) * (-570.644) [-562.210] (-563.850) (-562.963) -- 0:00:17
716500 -- (-561.802) (-562.605) [-560.579] (-563.351) * (-561.367) [-561.880] (-564.024) (-562.588) -- 0:00:17
717000 -- (-564.086) (-563.096) (-560.978) [-565.080] * (-564.328) [-561.524] (-563.966) (-561.250) -- 0:00:17
717500 -- (-564.555) (-562.164) (-560.806) [-563.255] * [-560.431] (-562.118) (-561.766) (-562.297) -- 0:00:17
718000 -- (-566.461) [-561.201] (-562.076) (-564.814) * (-561.462) (-560.582) (-562.791) [-562.296] -- 0:00:17
718500 -- (-564.512) (-563.357) (-563.094) [-562.293] * [-560.707] (-560.949) (-563.245) (-561.687) -- 0:00:17
719000 -- (-564.062) (-562.609) [-560.606] (-564.277) * [-560.634] (-560.539) (-569.874) (-561.264) -- 0:00:17
719500 -- [-561.878] (-562.578) (-565.570) (-561.251) * [-563.293] (-560.872) (-565.016) (-560.715) -- 0:00:17
720000 -- (-561.225) [-563.031] (-565.056) (-563.531) * (-562.949) [-560.975] (-561.286) (-562.340) -- 0:00:17
Average standard deviation of split frequencies: 0.008708
720500 -- (-562.720) (-562.077) [-564.888] (-562.069) * (-561.630) (-561.299) [-563.559] (-561.815) -- 0:00:17
721000 -- (-564.506) (-561.505) (-563.228) [-562.484] * (-561.524) (-562.484) [-563.045] (-567.363) -- 0:00:17
721500 -- (-566.572) (-560.497) [-561.478] (-560.462) * (-562.505) (-564.351) (-561.232) [-561.668] -- 0:00:17
722000 -- (-566.493) (-562.614) (-562.351) [-561.874] * (-562.259) [-560.793] (-566.520) (-564.835) -- 0:00:17
722500 -- [-562.567] (-562.226) (-563.394) (-560.570) * [-563.317] (-560.723) (-568.592) (-563.666) -- 0:00:17
723000 -- [-560.725] (-564.438) (-561.422) (-561.438) * (-563.781) [-562.533] (-564.318) (-564.678) -- 0:00:17
723500 -- (-562.068) (-561.825) (-565.352) [-562.508] * [-561.692] (-561.415) (-565.172) (-562.522) -- 0:00:17
724000 -- (-564.555) [-561.374] (-562.855) (-561.767) * (-561.457) [-562.944] (-562.695) (-563.560) -- 0:00:17
724500 -- (-562.806) [-564.872] (-563.333) (-563.507) * (-562.217) (-564.548) [-566.001] (-560.670) -- 0:00:17
725000 -- (-562.099) (-564.373) (-560.965) [-561.793] * (-561.456) (-567.840) (-564.093) [-562.748] -- 0:00:17
Average standard deviation of split frequencies: 0.008847
725500 -- (-562.036) (-565.952) [-565.307] (-561.298) * (-561.748) (-563.190) [-560.338] (-562.740) -- 0:00:17
726000 -- (-562.694) (-563.271) [-565.660] (-561.317) * [-563.956] (-563.784) (-560.458) (-561.326) -- 0:00:16
726500 -- (-562.119) (-562.304) [-563.561] (-562.143) * (-562.140) (-563.170) [-560.558] (-562.722) -- 0:00:16
727000 -- (-563.064) (-564.798) (-566.480) [-564.252] * [-564.738] (-563.407) (-562.114) (-562.133) -- 0:00:16
727500 -- [-561.292] (-567.354) (-564.444) (-563.696) * (-560.918) [-562.923] (-560.444) (-562.106) -- 0:00:16
728000 -- [-561.516] (-562.186) (-563.053) (-562.123) * (-561.711) (-564.852) (-563.482) [-561.404] -- 0:00:16
728500 -- (-561.182) (-561.584) [-561.256] (-561.351) * (-561.239) (-563.024) [-560.970] (-563.233) -- 0:00:16
729000 -- (-561.180) [-560.949] (-567.820) (-564.371) * (-560.754) [-560.194] (-568.892) (-560.583) -- 0:00:16
729500 -- (-563.225) (-562.411) [-563.956] (-566.349) * [-561.419] (-562.513) (-566.920) (-561.922) -- 0:00:16
730000 -- (-562.791) (-561.308) [-564.941] (-562.970) * [-561.797] (-563.552) (-568.233) (-562.328) -- 0:00:16
Average standard deviation of split frequencies: 0.009194
730500 -- (-561.285) (-563.969) (-561.557) [-562.386] * (-560.880) (-568.749) [-562.036] (-563.153) -- 0:00:16
731000 -- [-562.999] (-565.017) (-566.066) (-561.961) * (-562.696) [-561.363] (-563.382) (-562.575) -- 0:00:16
731500 -- [-563.462] (-563.957) (-561.099) (-561.662) * [-564.462] (-561.573) (-561.777) (-564.318) -- 0:00:16
732000 -- (-561.632) (-561.823) (-562.456) [-561.525] * [-561.691] (-561.608) (-565.845) (-562.181) -- 0:00:16
732500 -- (-561.530) (-562.247) (-563.967) [-563.999] * (-563.584) (-563.642) (-562.413) [-561.863] -- 0:00:16
733000 -- (-561.680) (-562.174) (-564.186) [-561.168] * (-564.163) (-562.336) [-562.175] (-560.463) -- 0:00:16
733500 -- (-562.418) (-563.655) (-563.672) [-562.199] * (-561.530) [-560.545] (-562.693) (-561.794) -- 0:00:16
734000 -- (-566.179) (-565.052) [-561.147] (-563.421) * [-562.162] (-564.973) (-562.396) (-561.971) -- 0:00:16
734500 -- (-564.456) (-565.775) [-564.572] (-564.674) * (-562.421) (-562.841) [-562.829] (-560.706) -- 0:00:16
735000 -- (-563.573) (-564.299) [-562.219] (-561.661) * (-563.540) (-562.264) [-562.678] (-561.646) -- 0:00:16
Average standard deviation of split frequencies: 0.008807
735500 -- [-562.794] (-561.744) (-564.764) (-562.540) * (-560.701) (-562.535) (-563.637) [-561.896] -- 0:00:16
736000 -- (-564.332) [-560.813] (-565.919) (-563.577) * [-563.513] (-563.800) (-562.014) (-562.756) -- 0:00:16
736500 -- (-564.703) (-561.943) [-561.748] (-564.706) * (-565.342) [-562.396] (-561.063) (-561.714) -- 0:00:16
737000 -- (-563.019) (-562.205) [-561.210] (-568.316) * (-564.002) (-562.187) [-562.322] (-561.554) -- 0:00:16
737500 -- [-563.948] (-564.652) (-563.840) (-563.420) * [-561.703] (-564.116) (-563.110) (-563.857) -- 0:00:16
738000 -- (-562.544) (-561.178) (-565.308) [-564.848] * (-560.291) (-564.081) (-561.657) [-563.702] -- 0:00:16
738500 -- (-563.735) (-561.469) (-561.996) [-562.180] * (-561.133) (-560.592) [-562.441] (-562.414) -- 0:00:16
739000 -- (-565.486) (-562.844) (-560.937) [-561.068] * [-564.169] (-561.461) (-563.124) (-560.665) -- 0:00:16
739500 -- (-570.632) (-565.499) (-563.258) [-561.765] * (-561.902) [-563.018] (-562.101) (-561.715) -- 0:00:16
740000 -- (-564.231) [-563.383] (-562.011) (-565.382) * (-560.665) [-563.719] (-563.827) (-562.300) -- 0:00:16
Average standard deviation of split frequencies: 0.008910
740500 -- [-561.073] (-562.746) (-565.842) (-561.974) * (-563.494) (-564.452) (-561.119) [-561.770] -- 0:00:16
741000 -- (-565.688) [-561.918] (-562.616) (-563.604) * (-561.086) [-562.264] (-561.820) (-563.463) -- 0:00:16
741500 -- (-562.154) (-562.966) [-562.897] (-562.923) * (-564.002) (-563.909) (-561.182) [-561.338] -- 0:00:16
742000 -- (-561.206) [-565.780] (-565.020) (-562.312) * (-561.318) (-562.838) (-562.382) [-562.323] -- 0:00:15
742500 -- (-562.776) (-562.297) [-561.534] (-560.898) * [-562.697] (-563.234) (-564.813) (-562.238) -- 0:00:15
743000 -- (-562.089) (-563.163) [-560.677] (-564.194) * (-562.930) (-572.533) [-562.280] (-566.188) -- 0:00:15
743500 -- (-561.240) (-561.955) (-562.175) [-563.911] * (-563.252) (-561.594) [-561.464] (-562.462) -- 0:00:15
744000 -- (-562.410) [-560.824] (-562.231) (-567.581) * (-563.223) (-567.707) (-561.686) [-561.306] -- 0:00:15
744500 -- (-562.618) [-562.050] (-561.840) (-564.706) * (-563.821) (-563.178) [-563.205] (-566.166) -- 0:00:15
745000 -- (-561.605) (-562.024) (-566.823) [-565.417] * (-568.274) (-564.327) [-561.956] (-561.022) -- 0:00:15
Average standard deviation of split frequencies: 0.008610
745500 -- (-561.463) (-562.474) [-564.243] (-562.593) * (-563.535) (-561.969) (-562.829) [-560.907] -- 0:00:15
746000 -- (-565.771) (-563.869) (-564.604) [-562.837] * (-562.119) (-560.927) (-560.750) [-562.353] -- 0:00:15
746500 -- (-564.774) (-560.990) (-564.411) [-561.460] * (-563.924) (-564.838) (-561.070) [-560.774] -- 0:00:15
747000 -- [-560.276] (-561.464) (-564.055) (-563.004) * (-563.320) [-561.603] (-562.441) (-561.427) -- 0:00:15
747500 -- [-560.533] (-561.759) (-565.536) (-564.118) * (-564.218) (-562.995) (-564.119) [-562.084] -- 0:00:15
748000 -- (-560.824) (-562.608) [-562.516] (-562.382) * (-561.670) [-561.545] (-561.075) (-561.603) -- 0:00:15
748500 -- (-562.720) (-566.046) (-562.590) [-564.747] * (-562.252) (-562.265) [-561.037] (-561.031) -- 0:00:15
749000 -- (-561.429) (-561.138) [-561.442] (-567.149) * (-562.250) (-561.328) [-564.604] (-562.746) -- 0:00:15
749500 -- (-562.580) [-561.047] (-561.768) (-561.394) * (-562.041) (-561.429) [-564.426] (-561.893) -- 0:00:15
750000 -- (-561.985) (-562.278) [-566.445] (-564.602) * (-560.937) [-560.607] (-561.010) (-562.112) -- 0:00:15
Average standard deviation of split frequencies: 0.008595
750500 -- (-562.464) (-565.132) (-563.438) [-561.967] * (-567.270) (-561.177) (-562.465) [-562.339] -- 0:00:15
751000 -- (-560.514) (-563.947) [-565.162] (-564.324) * (-561.398) (-563.585) [-565.637] (-563.026) -- 0:00:15
751500 -- (-560.555) (-561.322) (-564.412) [-560.231] * (-566.399) (-564.316) [-561.167] (-562.982) -- 0:00:15
752000 -- [-562.201] (-561.455) (-563.637) (-561.552) * [-562.760] (-562.262) (-566.190) (-562.887) -- 0:00:15
752500 -- (-562.940) [-561.658] (-561.803) (-562.807) * (-560.852) (-561.274) [-560.874] (-561.476) -- 0:00:15
753000 -- [-561.575] (-561.308) (-563.904) (-561.101) * [-563.245] (-563.180) (-562.068) (-561.620) -- 0:00:15
753500 -- (-560.573) [-565.414] (-564.032) (-562.545) * (-565.943) [-562.194] (-560.767) (-563.905) -- 0:00:15
754000 -- (-560.716) (-563.675) (-562.056) [-562.467] * (-563.498) (-563.013) (-560.385) [-560.373] -- 0:00:15
754500 -- (-560.956) (-564.435) (-561.508) [-561.804] * [-562.605] (-562.318) (-560.310) (-563.118) -- 0:00:15
755000 -- (-560.703) (-566.173) (-563.173) [-562.577] * (-565.530) (-560.853) (-560.450) [-565.599] -- 0:00:15
Average standard deviation of split frequencies: 0.008340
755500 -- (-563.924) (-563.244) [-563.245] (-563.527) * (-564.052) (-561.557) [-562.830] (-564.071) -- 0:00:15
756000 -- (-563.987) [-562.400] (-565.451) (-562.791) * (-562.763) [-563.653] (-561.771) (-561.493) -- 0:00:15
756500 -- [-563.559] (-565.082) (-564.144) (-560.961) * (-561.154) [-562.287] (-560.660) (-561.985) -- 0:00:15
757000 -- [-564.300] (-560.707) (-567.064) (-563.798) * (-565.908) [-560.773] (-560.922) (-564.295) -- 0:00:15
757500 -- [-563.187] (-560.648) (-567.590) (-563.219) * (-565.508) (-560.941) [-561.755] (-562.816) -- 0:00:15
758000 -- (-563.535) (-561.838) [-560.795] (-561.358) * (-565.502) (-561.432) (-563.253) [-561.519] -- 0:00:15
758500 -- (-561.276) [-562.167] (-560.924) (-560.371) * [-564.068] (-561.763) (-561.229) (-561.520) -- 0:00:14
759000 -- [-562.765] (-563.207) (-562.255) (-562.482) * (-565.926) (-563.677) (-562.761) [-562.992] -- 0:00:14
759500 -- [-563.861] (-564.366) (-562.382) (-560.387) * (-561.600) (-563.730) [-561.641] (-563.494) -- 0:00:14
760000 -- (-561.049) (-563.059) [-562.830] (-560.525) * (-562.442) (-562.636) (-561.879) [-562.577] -- 0:00:14
Average standard deviation of split frequencies: 0.008328
760500 -- (-561.869) (-561.510) [-565.505] (-565.269) * [-561.503] (-560.684) (-560.606) (-564.524) -- 0:00:14
761000 -- (-565.114) (-562.540) [-561.678] (-561.111) * [-561.430] (-561.791) (-564.147) (-561.150) -- 0:00:14
761500 -- (-567.076) (-563.347) (-562.377) [-560.985] * [-561.176] (-560.508) (-560.984) (-560.736) -- 0:00:14
762000 -- (-561.927) (-567.673) [-561.413] (-561.643) * [-561.767] (-563.375) (-561.449) (-561.934) -- 0:00:14
762500 -- [-563.595] (-564.022) (-563.475) (-561.037) * [-563.172] (-564.486) (-564.498) (-561.526) -- 0:00:14
763000 -- [-560.995] (-563.415) (-565.607) (-561.805) * (-563.845) [-560.632] (-561.351) (-563.243) -- 0:00:14
763500 -- (-562.828) (-563.367) (-563.576) [-563.043] * (-562.455) [-561.361] (-562.987) (-561.516) -- 0:00:14
764000 -- (-561.776) (-561.486) [-562.098] (-566.628) * (-562.065) (-562.250) (-566.139) [-560.788] -- 0:00:14
764500 -- [-561.770] (-560.738) (-564.418) (-561.292) * (-565.113) (-562.668) (-561.336) [-561.780] -- 0:00:14
765000 -- (-562.141) [-562.323] (-564.615) (-562.974) * (-563.469) (-562.358) (-564.521) [-561.826] -- 0:00:14
Average standard deviation of split frequencies: 0.008385
765500 -- [-561.528] (-563.939) (-568.813) (-562.452) * (-562.954) (-561.524) [-564.240] (-561.031) -- 0:00:14
766000 -- [-561.199] (-566.251) (-568.925) (-564.396) * (-563.807) (-564.814) (-565.919) [-561.670] -- 0:00:14
766500 -- (-560.872) [-563.390] (-563.549) (-561.651) * (-563.291) (-560.614) (-561.085) [-561.552] -- 0:00:14
767000 -- (-561.166) (-563.340) (-563.575) [-561.729] * [-560.675] (-560.892) (-560.719) (-562.691) -- 0:00:14
767500 -- (-560.416) (-562.039) (-560.624) [-560.547] * (-560.645) (-560.408) [-560.966] (-561.896) -- 0:00:14
768000 -- (-563.800) [-560.612] (-563.934) (-564.972) * (-568.021) (-560.363) (-567.064) [-563.706] -- 0:00:14
768500 -- (-562.801) [-560.859] (-563.343) (-560.867) * (-561.524) [-562.387] (-562.237) (-561.071) -- 0:00:14
769000 -- (-562.749) [-563.466] (-563.539) (-563.113) * [-563.418] (-563.759) (-562.960) (-562.684) -- 0:00:14
769500 -- (-561.427) (-564.151) (-560.809) [-561.366] * (-560.859) (-560.611) [-564.200] (-562.707) -- 0:00:14
770000 -- (-564.510) [-562.390] (-567.479) (-563.902) * [-562.025] (-560.667) (-563.678) (-563.820) -- 0:00:14
Average standard deviation of split frequencies: 0.008319
770500 -- (-563.375) (-562.602) (-564.550) [-564.054] * [-561.820] (-561.446) (-565.484) (-560.445) -- 0:00:14
771000 -- (-565.719) (-563.111) (-562.203) [-564.013] * (-562.453) (-560.419) (-563.099) [-560.445] -- 0:00:14
771500 -- (-562.680) (-564.018) (-564.605) [-561.594] * (-561.716) [-560.666] (-561.338) (-562.795) -- 0:00:14
772000 -- (-562.981) [-563.353] (-560.977) (-560.425) * (-562.390) [-562.948] (-564.851) (-561.951) -- 0:00:14
772500 -- (-562.663) (-561.751) [-560.946] (-560.639) * [-562.046] (-562.377) (-562.981) (-564.721) -- 0:00:14
773000 -- (-560.944) (-560.975) [-561.366] (-561.537) * [-562.237] (-562.174) (-567.604) (-561.482) -- 0:00:14
773500 -- (-562.439) (-561.681) [-562.786] (-561.505) * (-561.247) (-561.163) [-560.710] (-561.492) -- 0:00:14
774000 -- (-564.119) (-564.795) (-566.839) [-560.536] * (-564.363) (-561.264) (-563.368) [-561.890] -- 0:00:14
774500 -- (-566.984) (-565.400) (-569.286) [-561.655] * [-562.866] (-561.940) (-561.061) (-562.229) -- 0:00:13
775000 -- [-562.163] (-565.397) (-562.226) (-561.802) * (-566.221) [-561.851] (-561.398) (-562.400) -- 0:00:13
Average standard deviation of split frequencies: 0.008343
775500 -- [-562.034] (-564.600) (-561.433) (-563.046) * (-562.148) [-561.509] (-568.208) (-561.180) -- 0:00:13
776000 -- (-561.512) (-561.841) [-561.535] (-563.655) * (-562.021) (-561.205) (-564.240) [-560.678] -- 0:00:13
776500 -- (-562.767) (-562.683) [-561.869] (-560.534) * (-561.666) (-565.530) [-561.151] (-560.668) -- 0:00:13
777000 -- [-560.953] (-560.966) (-564.973) (-560.452) * (-561.260) (-563.775) [-564.402] (-562.605) -- 0:00:13
777500 -- (-561.486) (-561.011) [-563.754] (-565.536) * (-562.493) (-560.650) (-564.210) [-564.252] -- 0:00:14
778000 -- (-564.643) (-563.254) (-562.532) [-563.322] * (-562.404) (-562.116) (-561.481) [-561.871] -- 0:00:13
778500 -- (-563.456) (-561.805) (-561.511) [-561.988] * (-562.573) (-562.873) [-564.379] (-562.731) -- 0:00:13
779000 -- (-565.745) (-561.387) (-562.031) [-560.875] * [-560.303] (-562.763) (-563.781) (-561.480) -- 0:00:13
779500 -- [-561.133] (-561.237) (-563.407) (-560.856) * [-561.164] (-561.621) (-563.371) (-562.786) -- 0:00:13
780000 -- [-562.547] (-565.195) (-563.375) (-561.043) * [-560.603] (-562.207) (-563.732) (-561.555) -- 0:00:13
Average standard deviation of split frequencies: 0.008333
780500 -- (-561.958) (-564.145) [-563.356] (-561.101) * (-566.366) (-562.741) [-562.915] (-562.026) -- 0:00:13
781000 -- [-562.312] (-565.863) (-561.932) (-564.010) * [-563.156] (-563.778) (-562.549) (-562.320) -- 0:00:13
781500 -- [-562.964] (-564.472) (-563.065) (-561.191) * (-563.424) (-561.670) (-561.243) [-562.713] -- 0:00:13
782000 -- (-562.929) (-564.557) (-563.481) [-561.073] * [-562.602] (-561.415) (-563.197) (-562.275) -- 0:00:13
782500 -- (-561.410) [-561.886] (-562.791) (-560.740) * [-562.760] (-563.898) (-561.622) (-561.271) -- 0:00:13
783000 -- [-562.091] (-560.790) (-563.406) (-563.540) * [-561.832] (-562.662) (-563.437) (-563.352) -- 0:00:13
783500 -- (-560.402) [-565.883] (-563.736) (-563.615) * (-561.606) (-561.899) (-565.505) [-561.545] -- 0:00:13
784000 -- (-561.585) (-562.394) (-563.902) [-563.983] * (-564.559) (-562.373) [-561.626] (-561.985) -- 0:00:13
784500 -- (-562.647) (-565.123) [-562.814] (-561.229) * [-562.123] (-561.161) (-560.961) (-563.312) -- 0:00:13
785000 -- (-563.875) (-565.004) (-561.927) [-560.737] * (-562.057) (-563.661) [-563.271] (-560.677) -- 0:00:13
Average standard deviation of split frequencies: 0.008397
785500 -- (-562.276) [-564.297] (-563.434) (-561.983) * (-563.070) [-563.368] (-561.729) (-561.597) -- 0:00:13
786000 -- (-563.003) (-563.562) [-561.781] (-562.199) * (-563.071) [-562.002] (-561.768) (-562.153) -- 0:00:13
786500 -- (-565.244) (-566.107) (-560.706) [-562.069] * [-561.020] (-561.403) (-561.496) (-563.080) -- 0:00:13
787000 -- (-562.475) (-564.749) [-560.275] (-562.599) * [-563.774] (-562.762) (-560.682) (-564.755) -- 0:00:13
787500 -- (-562.249) (-564.184) (-560.911) [-561.840] * (-562.699) [-561.563] (-564.322) (-568.704) -- 0:00:13
788000 -- (-564.603) (-566.016) [-563.131] (-567.994) * [-561.939] (-562.933) (-561.134) (-562.361) -- 0:00:13
788500 -- (-562.872) (-563.646) [-561.118] (-568.746) * [-562.150] (-569.563) (-561.202) (-563.180) -- 0:00:13
789000 -- (-560.845) (-562.625) [-561.937] (-563.325) * (-563.297) [-560.269] (-564.958) (-563.477) -- 0:00:13
789500 -- (-561.656) (-561.449) [-561.885] (-562.681) * (-561.341) [-561.788] (-563.126) (-560.778) -- 0:00:13
790000 -- (-564.028) (-560.698) [-562.282] (-564.982) * [-562.050] (-565.489) (-561.151) (-563.321) -- 0:00:13
Average standard deviation of split frequencies: 0.008903
790500 -- (-565.251) [-560.357] (-565.205) (-565.186) * (-560.620) (-563.546) [-564.441] (-567.752) -- 0:00:12
791000 -- (-562.062) [-564.985] (-561.229) (-564.777) * (-560.955) (-563.171) (-560.665) [-564.504] -- 0:00:12
791500 -- [-562.862] (-561.273) (-560.860) (-567.917) * [-565.581] (-562.470) (-563.140) (-563.366) -- 0:00:12
792000 -- (-561.043) (-560.434) [-564.323] (-566.123) * (-565.817) [-566.171] (-562.240) (-562.660) -- 0:00:12
792500 -- (-561.596) (-562.025) [-563.489] (-563.418) * [-564.779] (-560.737) (-561.834) (-563.940) -- 0:00:12
793000 -- [-562.629] (-561.612) (-564.101) (-564.397) * (-569.496) [-565.970] (-562.217) (-565.792) -- 0:00:13
793500 -- (-561.866) [-561.312] (-561.935) (-562.927) * (-566.695) (-560.851) (-566.083) [-565.065] -- 0:00:13
794000 -- [-561.781] (-563.776) (-561.753) (-562.535) * (-565.458) (-561.199) [-566.546] (-564.843) -- 0:00:12
794500 -- (-565.355) (-563.751) (-563.115) [-561.810] * [-562.709] (-563.391) (-577.728) (-562.738) -- 0:00:12
795000 -- (-560.473) (-563.384) [-562.884] (-562.658) * [-562.524] (-561.521) (-571.237) (-561.762) -- 0:00:12
Average standard deviation of split frequencies: 0.009253
795500 -- (-560.689) (-562.987) (-561.513) [-563.317] * (-560.705) (-562.123) [-565.966] (-561.831) -- 0:00:12
796000 -- (-563.593) (-566.592) [-562.759] (-566.134) * [-563.577] (-561.897) (-562.170) (-560.681) -- 0:00:12
796500 -- [-562.014] (-570.118) (-563.686) (-565.503) * [-562.664] (-572.921) (-567.949) (-561.503) -- 0:00:12
797000 -- [-563.030] (-565.917) (-560.885) (-565.031) * (-560.860) (-566.841) [-566.890] (-564.161) -- 0:00:12
797500 -- [-560.714] (-564.031) (-564.122) (-564.400) * (-561.752) (-565.833) [-562.704] (-564.824) -- 0:00:12
798000 -- [-560.580] (-562.756) (-561.873) (-562.988) * (-563.656) (-562.468) (-563.150) [-561.482] -- 0:00:12
798500 -- [-561.643] (-562.030) (-562.646) (-560.902) * (-563.622) (-560.928) [-561.731] (-562.319) -- 0:00:12
799000 -- (-562.287) (-563.209) (-562.933) [-560.899] * [-561.207] (-563.883) (-563.573) (-560.924) -- 0:00:12
799500 -- (-562.970) (-562.765) (-560.481) [-565.314] * [-561.100] (-563.408) (-560.814) (-560.294) -- 0:00:12
800000 -- (-564.383) (-565.703) (-567.131) [-562.841] * (-565.458) (-563.798) [-561.042] (-562.408) -- 0:00:12
Average standard deviation of split frequencies: 0.008910
800500 -- [-563.709] (-565.739) (-561.539) (-561.296) * (-563.546) [-561.810] (-561.660) (-562.091) -- 0:00:12
801000 -- [-562.619] (-560.700) (-562.192) (-566.542) * [-562.423] (-561.492) (-562.298) (-561.373) -- 0:00:12
801500 -- (-562.453) [-562.848] (-563.630) (-565.988) * (-561.208) (-560.682) (-560.905) [-563.142] -- 0:00:12
802000 -- (-564.287) (-563.637) (-563.910) [-563.838] * (-563.298) (-561.851) [-562.134] (-561.053) -- 0:00:12
802500 -- (-563.567) (-560.940) [-563.103] (-567.051) * (-564.055) [-561.601] (-561.330) (-560.397) -- 0:00:12
803000 -- (-563.051) (-561.793) [-561.231] (-565.150) * (-565.260) [-562.927] (-566.293) (-562.485) -- 0:00:12
803500 -- (-562.000) (-561.568) [-562.082] (-562.911) * [-563.160] (-566.412) (-563.161) (-565.824) -- 0:00:12
804000 -- (-562.394) [-561.697] (-562.376) (-562.773) * (-562.670) [-562.813] (-561.744) (-563.869) -- 0:00:12
804500 -- (-562.611) (-561.260) (-565.896) [-566.020] * (-561.369) (-563.433) (-561.685) [-561.835] -- 0:00:12
805000 -- (-562.417) (-560.723) (-561.919) [-568.295] * (-564.227) (-562.604) (-561.091) [-562.811] -- 0:00:12
Average standard deviation of split frequencies: 0.008734
805500 -- (-564.273) (-562.329) [-560.514] (-568.057) * [-562.880] (-564.169) (-561.328) (-560.790) -- 0:00:12
806000 -- (-562.564) (-563.965) (-561.902) [-565.194] * [-565.428] (-568.372) (-565.297) (-561.763) -- 0:00:12
806500 -- (-563.986) (-562.544) (-564.277) [-562.325] * (-566.532) (-563.291) (-562.359) [-563.696] -- 0:00:11
807000 -- [-561.327] (-565.130) (-562.111) (-561.574) * [-564.160] (-561.856) (-563.515) (-562.706) -- 0:00:11
807500 -- (-566.429) (-562.648) (-561.251) [-561.231] * (-563.215) [-562.065] (-560.868) (-561.340) -- 0:00:11
808000 -- [-563.192] (-562.738) (-562.080) (-563.808) * (-563.016) [-560.895] (-560.790) (-561.903) -- 0:00:11
808500 -- [-562.028] (-561.960) (-562.927) (-562.244) * (-561.044) [-561.955] (-562.757) (-564.058) -- 0:00:11
809000 -- (-565.371) (-561.983) (-565.111) [-563.484] * (-562.113) (-561.495) [-561.572] (-561.889) -- 0:00:11
809500 -- (-562.221) (-561.724) [-563.038] (-561.600) * [-562.843] (-562.677) (-561.243) (-564.016) -- 0:00:12
810000 -- (-561.485) (-563.522) [-562.133] (-561.139) * (-561.451) (-562.143) [-561.458] (-563.620) -- 0:00:11
Average standard deviation of split frequencies: 0.008296
810500 -- (-565.037) (-563.114) [-564.027] (-562.577) * (-565.398) (-561.965) (-562.007) [-562.290] -- 0:00:11
811000 -- [-563.107] (-561.831) (-563.787) (-560.811) * (-562.286) [-561.981] (-561.164) (-561.473) -- 0:00:11
811500 -- (-563.270) (-564.373) (-561.151) [-561.061] * (-560.939) (-563.859) (-560.595) [-560.496] -- 0:00:11
812000 -- (-568.119) [-564.755] (-562.975) (-560.303) * (-562.478) (-565.507) [-560.885] (-560.436) -- 0:00:11
812500 -- (-561.045) (-562.101) [-562.063] (-562.922) * [-563.021] (-563.438) (-560.885) (-564.469) -- 0:00:11
813000 -- (-565.111) (-564.175) (-564.800) [-561.182] * (-561.851) (-563.225) (-562.469) [-562.537] -- 0:00:11
813500 -- (-564.903) (-567.783) (-563.405) [-563.885] * (-565.311) (-568.307) [-561.899] (-562.005) -- 0:00:11
814000 -- (-563.134) [-564.082] (-562.585) (-564.256) * (-561.572) (-568.926) (-562.252) [-562.176] -- 0:00:11
814500 -- (-563.583) (-561.948) (-561.064) [-560.759] * (-560.939) [-564.575] (-561.686) (-561.689) -- 0:00:11
815000 -- [-565.454] (-560.882) (-561.092) (-560.696) * (-561.388) [-563.742] (-563.373) (-562.756) -- 0:00:11
Average standard deviation of split frequencies: 0.007934
815500 -- (-566.101) (-561.336) (-561.781) [-562.759] * [-560.869] (-562.432) (-561.666) (-563.218) -- 0:00:11
816000 -- (-565.919) [-561.655] (-560.401) (-561.304) * (-564.809) (-564.514) [-562.825] (-562.211) -- 0:00:11
816500 -- [-561.133] (-561.312) (-563.838) (-560.900) * [-560.307] (-560.672) (-563.300) (-562.613) -- 0:00:11
817000 -- [-564.923] (-563.140) (-562.154) (-560.451) * [-561.837] (-560.907) (-561.534) (-564.415) -- 0:00:11
817500 -- (-561.857) (-560.460) (-563.643) [-561.420] * (-563.198) (-562.049) [-561.432] (-562.614) -- 0:00:11
818000 -- (-563.503) (-561.573) (-561.123) [-562.117] * (-565.295) [-561.019] (-569.070) (-565.135) -- 0:00:11
818500 -- (-565.782) [-562.000] (-563.100) (-565.411) * (-562.729) (-562.712) [-562.085] (-561.846) -- 0:00:11
819000 -- (-560.822) (-566.821) [-562.214] (-564.070) * (-563.410) (-562.414) [-563.320] (-565.191) -- 0:00:11
819500 -- (-561.654) [-562.789] (-564.162) (-564.359) * [-563.875] (-562.470) (-561.009) (-562.267) -- 0:00:11
820000 -- (-561.534) (-565.644) [-561.371] (-562.061) * (-562.291) [-562.667] (-561.164) (-561.232) -- 0:00:11
Average standard deviation of split frequencies: 0.008080
820500 -- (-563.510) [-561.332] (-561.632) (-561.169) * (-562.490) [-560.759] (-561.970) (-561.669) -- 0:00:11
821000 -- (-561.806) (-561.404) [-562.868] (-564.976) * (-563.748) (-561.499) (-563.635) [-561.307] -- 0:00:11
821500 -- (-561.520) (-561.001) [-562.175] (-563.676) * (-565.982) (-563.780) (-563.085) [-564.152] -- 0:00:11
822000 -- [-561.065] (-569.883) (-564.518) (-562.684) * (-568.888) (-561.321) (-561.651) [-561.084] -- 0:00:11
822500 -- (-563.424) [-561.723] (-564.072) (-563.033) * [-561.245] (-562.701) (-563.655) (-564.527) -- 0:00:11
823000 -- (-562.366) (-562.540) [-563.464] (-561.222) * [-562.550] (-565.329) (-565.215) (-562.982) -- 0:00:10
823500 -- (-562.886) (-561.090) (-569.133) [-562.301] * (-563.190) [-565.514] (-563.739) (-563.369) -- 0:00:10
824000 -- [-562.597] (-563.597) (-568.962) (-562.196) * (-565.422) [-561.624] (-562.278) (-563.339) -- 0:00:10
824500 -- (-561.202) (-563.901) (-575.003) [-561.272] * (-561.244) [-561.612] (-568.532) (-562.392) -- 0:00:10
825000 -- [-564.057] (-561.289) (-574.288) (-563.520) * [-563.955] (-561.578) (-563.521) (-565.302) -- 0:00:10
Average standard deviation of split frequencies: 0.007609
825500 -- (-563.978) (-566.675) [-564.493] (-563.961) * (-562.574) (-563.517) [-562.117] (-562.749) -- 0:00:10
826000 -- [-561.308] (-565.202) (-568.320) (-566.853) * (-566.696) (-561.995) (-562.300) [-561.976] -- 0:00:10
826500 -- (-561.400) (-563.702) [-563.620] (-562.450) * (-561.143) [-561.524] (-564.021) (-561.134) -- 0:00:10
827000 -- (-561.904) (-561.960) [-562.259] (-560.699) * (-562.851) (-561.648) [-560.645] (-561.284) -- 0:00:10
827500 -- (-566.458) [-566.217] (-563.397) (-561.042) * (-562.144) (-563.772) (-562.122) [-561.864] -- 0:00:10
828000 -- (-561.763) (-562.975) (-561.989) [-560.326] * (-563.660) (-564.009) [-562.772] (-561.764) -- 0:00:10
828500 -- [-561.825] (-565.513) (-563.747) (-563.126) * (-565.268) (-562.294) (-560.539) [-561.093] -- 0:00:10
829000 -- (-562.745) [-566.561] (-562.784) (-563.044) * (-562.497) [-562.650] (-565.603) (-561.585) -- 0:00:10
829500 -- (-565.290) (-562.698) (-563.136) [-563.459] * (-564.165) (-561.534) [-561.737] (-561.927) -- 0:00:10
830000 -- (-564.281) [-563.988] (-562.796) (-565.131) * (-565.899) (-560.849) [-561.660] (-563.562) -- 0:00:10
Average standard deviation of split frequencies: 0.007188
830500 -- (-562.521) (-562.089) (-560.659) [-561.062] * [-565.296] (-560.630) (-565.602) (-566.476) -- 0:00:10
831000 -- [-565.220] (-562.949) (-568.186) (-563.259) * [-565.176] (-560.629) (-563.692) (-563.421) -- 0:00:10
831500 -- (-566.094) (-561.671) [-562.801] (-565.754) * (-564.334) [-560.778] (-562.239) (-561.654) -- 0:00:10
832000 -- (-563.096) [-562.060] (-562.907) (-563.360) * (-560.602) [-564.784] (-561.366) (-562.672) -- 0:00:10
832500 -- (-564.891) [-561.036] (-562.610) (-563.510) * (-561.026) [-566.071] (-560.840) (-561.808) -- 0:00:10
833000 -- (-562.520) (-564.684) (-563.075) [-564.094] * [-561.242] (-561.149) (-562.057) (-564.335) -- 0:00:10
833500 -- (-561.818) (-566.477) [-562.285] (-565.769) * (-560.640) [-562.612] (-561.215) (-563.480) -- 0:00:10
834000 -- (-560.644) (-560.955) [-561.858] (-563.800) * (-561.285) (-562.404) (-562.569) [-561.547] -- 0:00:10
834500 -- (-562.314) (-561.793) (-564.772) [-562.953] * (-562.394) [-561.969] (-561.394) (-562.440) -- 0:00:10
835000 -- (-563.778) (-561.340) [-563.497] (-560.412) * [-562.268] (-560.915) (-561.102) (-561.147) -- 0:00:10
Average standard deviation of split frequencies: 0.007330
835500 -- (-563.066) (-562.884) (-568.197) [-563.464] * (-561.950) (-562.584) (-563.513) [-562.408] -- 0:00:10
836000 -- [-561.344] (-560.359) (-563.151) (-562.699) * [-561.463] (-562.737) (-562.667) (-565.848) -- 0:00:10
836500 -- (-561.060) (-562.373) [-561.412] (-564.302) * (-566.717) (-560.911) [-561.977] (-566.354) -- 0:00:10
837000 -- (-562.669) (-561.507) [-565.209] (-562.747) * [-564.542] (-561.144) (-561.629) (-563.238) -- 0:00:10
837500 -- (-562.805) [-565.710] (-561.841) (-565.468) * (-562.049) (-563.149) [-561.349] (-562.452) -- 0:00:10
838000 -- (-573.281) [-561.627] (-562.286) (-566.189) * (-562.796) [-560.956] (-561.616) (-564.330) -- 0:00:10
838500 -- [-563.998] (-563.566) (-563.595) (-565.283) * (-564.500) (-564.520) [-561.591] (-561.481) -- 0:00:10
839000 -- (-563.386) (-561.129) [-561.294] (-564.885) * (-562.149) [-564.694] (-561.375) (-561.865) -- 0:00:09
839500 -- (-561.783) (-566.820) [-561.711] (-562.132) * (-566.369) (-561.190) [-564.433] (-560.892) -- 0:00:09
840000 -- (-563.899) (-565.180) [-561.126] (-560.925) * [-563.842] (-561.225) (-563.438) (-563.725) -- 0:00:09
Average standard deviation of split frequencies: 0.007103
840500 -- (-566.528) (-562.278) [-561.903] (-563.129) * (-562.325) (-562.053) [-563.971] (-560.860) -- 0:00:09
841000 -- (-569.253) [-561.496] (-562.339) (-562.602) * (-563.763) [-561.199] (-563.264) (-563.282) -- 0:00:09
841500 -- (-565.286) [-561.106] (-561.517) (-561.342) * [-560.888] (-563.351) (-564.064) (-564.781) -- 0:00:09
842000 -- (-564.650) (-562.107) [-561.806] (-562.237) * (-564.249) (-563.939) (-562.094) [-562.638] -- 0:00:09
842500 -- (-562.477) (-560.472) [-562.798] (-560.680) * (-565.587) (-563.614) (-562.072) [-565.541] -- 0:00:09
843000 -- (-567.632) [-561.745] (-562.764) (-561.539) * (-564.660) (-562.707) [-560.614] (-562.655) -- 0:00:09
843500 -- (-562.531) [-560.538] (-563.915) (-561.184) * (-562.201) [-561.952] (-560.580) (-564.759) -- 0:00:09
844000 -- (-562.222) (-562.113) [-563.541] (-562.455) * (-560.714) (-564.450) (-563.560) [-561.907] -- 0:00:09
844500 -- (-562.002) (-563.619) [-564.597] (-566.327) * (-563.840) [-562.199] (-561.882) (-561.655) -- 0:00:09
845000 -- (-564.396) (-563.996) (-561.818) [-560.938] * (-561.488) (-561.360) [-564.761] (-561.764) -- 0:00:09
Average standard deviation of split frequencies: 0.006984
845500 -- [-561.767] (-562.312) (-562.140) (-560.614) * (-561.617) (-564.547) (-562.145) [-560.948] -- 0:00:09
846000 -- (-562.363) [-562.594] (-560.754) (-560.919) * (-562.935) [-564.127] (-564.163) (-562.115) -- 0:00:09
846500 -- (-564.224) (-560.841) (-562.869) [-561.690] * (-561.629) (-562.500) (-561.288) [-562.536] -- 0:00:09
847000 -- [-560.771] (-564.909) (-563.087) (-566.794) * (-560.943) (-564.784) [-561.010] (-564.049) -- 0:00:09
847500 -- [-564.774] (-564.150) (-564.282) (-564.546) * [-561.394] (-561.164) (-561.555) (-563.183) -- 0:00:09
848000 -- (-563.216) [-562.069] (-562.221) (-560.561) * (-563.355) [-563.556] (-562.666) (-566.270) -- 0:00:09
848500 -- (-565.055) (-562.483) (-563.093) [-563.643] * (-563.251) (-563.382) (-564.744) [-565.096] -- 0:00:09
849000 -- [-562.782] (-561.903) (-566.806) (-560.572) * (-563.625) (-565.235) (-562.516) [-561.956] -- 0:00:09
849500 -- [-562.446] (-562.512) (-565.184) (-563.969) * (-561.841) (-560.996) (-562.122) [-562.602] -- 0:00:09
850000 -- (-561.082) (-563.041) (-565.471) [-562.214] * [-560.967] (-560.855) (-564.455) (-562.852) -- 0:00:09
Average standard deviation of split frequencies: 0.007389
850500 -- (-563.189) (-561.757) (-562.868) [-562.094] * (-561.649) [-564.513] (-565.466) (-563.154) -- 0:00:09
851000 -- (-561.369) [-562.109] (-562.341) (-563.002) * [-562.946] (-563.770) (-561.002) (-561.584) -- 0:00:09
851500 -- (-561.361) (-560.964) (-563.103) [-566.989] * (-561.051) (-563.887) (-560.189) [-561.225] -- 0:00:09
852000 -- [-560.306] (-563.694) (-567.120) (-561.502) * (-561.452) (-562.594) (-560.979) [-561.516] -- 0:00:09
852500 -- (-563.585) (-561.633) (-563.739) [-560.602] * (-560.766) (-562.892) [-560.704] (-562.275) -- 0:00:09
853000 -- (-561.407) (-563.819) (-561.317) [-560.193] * (-562.189) (-561.713) [-563.641] (-565.704) -- 0:00:09
853500 -- [-561.008] (-562.119) (-561.175) (-563.678) * (-563.239) (-561.226) (-560.749) [-563.404] -- 0:00:09
854000 -- [-562.018] (-560.778) (-560.776) (-560.707) * (-560.411) (-561.202) (-566.951) [-562.440] -- 0:00:09
854500 -- (-563.518) (-566.939) (-566.229) [-562.092] * (-561.117) (-564.520) (-563.373) [-561.888] -- 0:00:09
855000 -- (-561.334) [-560.788] (-563.699) (-560.720) * (-561.988) (-562.631) (-561.280) [-564.764] -- 0:00:08
Average standard deviation of split frequencies: 0.007490
855500 -- (-565.533) (-562.367) (-563.558) [-563.638] * (-565.197) [-561.856] (-560.303) (-564.914) -- 0:00:08
856000 -- (-564.310) [-562.317] (-569.225) (-561.726) * (-563.067) (-563.237) (-562.423) [-563.630] -- 0:00:08
856500 -- (-565.171) [-560.916] (-562.684) (-562.318) * (-561.426) [-566.040] (-563.274) (-566.753) -- 0:00:08
857000 -- (-560.945) [-565.753] (-561.501) (-562.410) * (-565.059) (-563.429) [-562.573] (-567.757) -- 0:00:08
857500 -- (-562.606) [-561.614] (-563.822) (-563.344) * (-568.481) [-564.856] (-561.124) (-564.254) -- 0:00:08
858000 -- (-561.886) [-563.026] (-564.735) (-563.320) * (-561.126) [-561.873] (-563.332) (-565.244) -- 0:00:08
858500 -- [-561.308] (-568.232) (-565.354) (-561.190) * (-560.841) (-561.463) (-561.196) [-562.802] -- 0:00:08
859000 -- (-563.543) [-563.993] (-563.167) (-560.681) * (-564.639) [-563.974] (-562.163) (-566.192) -- 0:00:08
859500 -- (-561.736) (-564.596) (-564.955) [-560.461] * (-564.147) (-563.259) (-560.777) [-562.043] -- 0:00:08
860000 -- [-563.679] (-562.327) (-562.150) (-560.711) * (-562.685) (-563.554) (-564.167) [-563.071] -- 0:00:08
Average standard deviation of split frequencies: 0.007449
860500 -- [-562.219] (-561.883) (-561.048) (-561.299) * (-561.872) [-561.999] (-562.438) (-563.462) -- 0:00:08
861000 -- (-569.722) (-560.552) (-561.456) [-565.241] * [-561.876] (-561.101) (-563.268) (-565.735) -- 0:00:08
861500 -- (-574.031) (-561.452) [-562.432] (-564.525) * (-562.049) (-564.095) [-562.167] (-562.506) -- 0:00:08
862000 -- (-570.618) (-562.576) (-561.240) [-565.337] * (-562.490) (-562.749) (-561.327) [-561.963] -- 0:00:08
862500 -- (-563.821) (-562.131) (-560.818) [-560.388] * [-563.829] (-563.948) (-564.372) (-567.099) -- 0:00:08
863000 -- (-564.218) (-563.703) (-561.706) [-561.061] * (-564.313) (-565.528) [-560.817] (-564.204) -- 0:00:08
863500 -- (-560.305) (-564.248) [-564.750] (-562.384) * [-563.069] (-560.995) (-560.777) (-561.244) -- 0:00:08
864000 -- [-562.126] (-569.008) (-563.135) (-562.896) * (-561.076) (-562.262) [-561.157] (-560.894) -- 0:00:08
864500 -- (-562.184) [-561.949] (-564.475) (-561.861) * [-561.494] (-562.253) (-563.802) (-560.587) -- 0:00:08
865000 -- [-561.426] (-563.790) (-563.533) (-563.442) * (-564.193) (-561.236) [-562.953] (-567.401) -- 0:00:08
Average standard deviation of split frequencies: 0.007331
865500 -- (-562.545) [-561.133] (-562.352) (-563.239) * [-561.251] (-561.705) (-565.839) (-563.956) -- 0:00:08
866000 -- (-563.317) [-563.721] (-565.996) (-561.906) * (-562.047) (-561.519) (-565.125) [-563.381] -- 0:00:08
866500 -- (-561.294) (-560.975) (-561.293) [-562.990] * [-560.556] (-563.420) (-564.383) (-561.258) -- 0:00:08
867000 -- (-561.377) [-564.158] (-561.561) (-566.074) * [-562.718] (-560.654) (-562.600) (-564.718) -- 0:00:08
867500 -- (-564.519) [-561.986] (-565.344) (-564.818) * (-565.805) [-560.525] (-565.326) (-564.023) -- 0:00:08
868000 -- (-564.148) (-565.629) [-562.686] (-565.295) * (-561.838) (-562.293) (-564.083) [-563.915] -- 0:00:08
868500 -- (-561.767) (-563.601) [-562.643] (-562.969) * (-562.699) (-562.971) [-565.351] (-562.242) -- 0:00:08
869000 -- (-560.839) (-561.496) [-563.036] (-563.049) * (-562.966) [-561.048] (-562.367) (-563.553) -- 0:00:08
869500 -- (-560.641) (-563.296) (-560.952) [-563.778] * (-562.429) [-561.937] (-561.692) (-562.091) -- 0:00:08
870000 -- (-562.186) (-561.603) (-562.030) [-562.789] * (-562.155) (-560.850) (-564.205) [-561.675] -- 0:00:08
Average standard deviation of split frequencies: 0.007219
870500 -- (-561.540) (-562.025) (-563.821) [-561.154] * (-562.720) (-563.667) (-561.528) [-561.092] -- 0:00:08
871000 -- [-560.579] (-563.147) (-563.399) (-561.023) * (-562.254) [-562.032] (-560.826) (-564.451) -- 0:00:07
871500 -- (-563.717) [-561.795] (-564.391) (-564.445) * (-565.494) (-563.468) [-562.029] (-564.033) -- 0:00:07
872000 -- (-563.962) (-567.093) [-563.821] (-566.727) * (-561.903) (-562.055) (-563.764) [-560.772] -- 0:00:07
872500 -- (-562.774) [-561.177] (-562.536) (-563.431) * (-564.898) (-564.560) [-563.940] (-560.930) -- 0:00:07
873000 -- (-561.890) [-561.348] (-561.601) (-565.382) * (-561.838) [-561.861] (-562.929) (-562.340) -- 0:00:07
873500 -- [-560.703] (-562.041) (-562.442) (-561.633) * (-561.245) (-564.766) (-563.311) [-561.636] -- 0:00:07
874000 -- (-566.914) (-560.729) (-562.319) [-561.758] * (-563.194) [-560.904] (-562.319) (-564.731) -- 0:00:07
874500 -- (-564.032) (-562.787) (-561.303) [-566.963] * (-562.042) [-561.775] (-561.374) (-562.168) -- 0:00:07
875000 -- [-562.813] (-562.227) (-564.227) (-564.384) * (-560.949) (-562.936) [-560.360] (-560.841) -- 0:00:07
Average standard deviation of split frequencies: 0.006924
875500 -- (-561.281) (-561.871) [-560.790] (-562.023) * (-561.432) (-564.696) (-561.920) [-560.588] -- 0:00:07
876000 -- [-563.440] (-561.431) (-560.435) (-562.794) * (-561.549) (-562.319) [-563.226] (-561.749) -- 0:00:07
876500 -- (-563.260) [-561.487] (-563.282) (-562.887) * (-561.531) [-560.849] (-562.225) (-560.940) -- 0:00:07
877000 -- (-564.892) (-561.776) (-564.604) [-562.682] * (-562.411) (-562.687) [-567.371] (-562.041) -- 0:00:07
877500 -- (-562.680) (-563.095) (-567.480) [-561.689] * [-562.346] (-564.001) (-566.819) (-563.115) -- 0:00:07
878000 -- (-567.286) (-563.487) (-567.812) [-563.264] * (-564.359) (-564.604) (-568.217) [-561.586] -- 0:00:07
878500 -- (-565.567) [-565.863] (-567.167) (-561.598) * (-564.594) [-562.397] (-566.687) (-561.440) -- 0:00:07
879000 -- (-566.688) [-564.840] (-562.952) (-561.710) * [-565.549] (-565.941) (-566.573) (-566.510) -- 0:00:07
879500 -- [-560.544] (-563.123) (-564.314) (-563.261) * (-563.731) (-564.595) [-561.848] (-562.790) -- 0:00:07
880000 -- (-564.172) [-563.467] (-563.079) (-561.136) * (-565.107) (-563.985) [-560.818] (-563.435) -- 0:00:07
Average standard deviation of split frequencies: 0.006495
880500 -- (-563.973) (-565.676) [-561.855] (-563.889) * (-570.193) (-564.796) [-562.795] (-563.079) -- 0:00:07
881000 -- (-565.494) [-561.126] (-563.192) (-562.327) * (-566.591) (-563.188) (-562.447) [-562.895] -- 0:00:07
881500 -- [-562.791] (-562.227) (-563.749) (-561.555) * (-564.064) (-562.996) (-565.901) [-567.912] -- 0:00:07
882000 -- (-565.007) (-563.280) (-562.637) [-561.336] * [-563.848] (-564.835) (-562.221) (-562.606) -- 0:00:07
882500 -- (-566.476) [-560.612] (-564.418) (-561.400) * (-564.577) (-566.037) (-562.391) [-561.080] -- 0:00:07
883000 -- (-561.664) (-564.639) [-565.031] (-560.829) * (-561.266) [-561.760] (-561.001) (-562.423) -- 0:00:07
883500 -- (-560.715) [-560.793] (-565.513) (-561.137) * [-561.992] (-562.699) (-564.399) (-560.818) -- 0:00:07
884000 -- (-562.947) [-561.020] (-562.459) (-564.209) * [-563.800] (-561.999) (-564.505) (-564.305) -- 0:00:07
884500 -- (-564.120) [-561.020] (-561.783) (-560.631) * (-561.866) (-565.306) (-564.206) [-561.514] -- 0:00:07
885000 -- (-562.817) (-560.676) [-561.891] (-563.514) * [-562.912] (-564.547) (-562.952) (-564.160) -- 0:00:07
Average standard deviation of split frequencies: 0.006207
885500 -- (-561.748) [-563.741] (-562.866) (-563.676) * (-563.003) [-563.442] (-560.689) (-562.239) -- 0:00:07
886000 -- (-562.933) (-565.061) [-560.842] (-561.089) * [-560.929] (-562.181) (-560.472) (-561.475) -- 0:00:07
886500 -- [-562.574] (-562.191) (-563.595) (-562.094) * [-560.973] (-562.667) (-568.802) (-563.721) -- 0:00:07
887000 -- [-564.680] (-561.644) (-570.605) (-564.811) * (-562.375) (-562.034) [-563.449] (-561.113) -- 0:00:07
887500 -- (-564.467) (-566.671) (-565.994) [-561.789] * [-562.954] (-562.015) (-562.447) (-561.234) -- 0:00:06
888000 -- (-563.576) [-561.425] (-561.909) (-561.071) * (-565.313) (-562.682) [-560.866] (-562.471) -- 0:00:06
888500 -- (-564.097) (-560.573) [-561.856] (-563.698) * [-562.378] (-561.825) (-560.615) (-563.600) -- 0:00:06
889000 -- (-563.112) (-562.049) (-561.451) [-561.766] * (-560.836) [-561.832] (-562.579) (-561.281) -- 0:00:06
889500 -- (-562.907) [-560.409] (-561.415) (-562.441) * (-562.761) [-562.220] (-563.158) (-562.539) -- 0:00:06
890000 -- [-562.543] (-568.032) (-563.258) (-560.824) * (-562.172) [-561.795] (-561.515) (-561.379) -- 0:00:06
Average standard deviation of split frequencies: 0.006281
890500 -- (-562.584) [-565.997] (-561.542) (-560.635) * [-562.279] (-561.639) (-561.544) (-561.284) -- 0:00:06
891000 -- (-562.932) (-562.439) (-561.050) [-560.700] * [-567.783] (-562.337) (-561.379) (-560.625) -- 0:00:06
891500 -- (-562.165) (-562.616) [-563.142] (-562.067) * (-562.852) (-561.915) (-560.838) [-561.531] -- 0:00:06
892000 -- (-561.373) (-561.731) (-561.285) [-564.364] * (-562.013) [-562.169] (-562.264) (-562.201) -- 0:00:06
892500 -- (-563.551) [-561.522] (-564.599) (-561.042) * (-562.324) (-564.341) (-561.304) [-561.633] -- 0:00:06
893000 -- (-564.212) (-561.114) [-563.838] (-562.027) * (-565.314) (-566.907) (-562.015) [-561.155] -- 0:00:06
893500 -- (-564.112) (-560.372) [-561.856] (-560.328) * (-563.721) (-565.188) [-564.706] (-563.189) -- 0:00:06
894000 -- (-563.392) (-560.630) (-561.427) [-560.779] * (-563.577) (-562.102) (-561.836) [-563.804] -- 0:00:06
894500 -- (-560.924) [-562.983] (-560.781) (-562.316) * (-564.318) (-562.036) [-560.396] (-563.204) -- 0:00:06
895000 -- (-561.528) [-561.730] (-562.873) (-561.604) * (-561.118) [-563.092] (-560.974) (-563.598) -- 0:00:06
Average standard deviation of split frequencies: 0.006664
895500 -- (-562.608) (-560.913) (-560.600) [-562.386] * (-561.059) (-564.333) [-560.796] (-562.085) -- 0:00:06
896000 -- (-562.894) (-563.268) [-560.964] (-564.447) * [-561.724] (-563.681) (-562.740) (-561.827) -- 0:00:06
896500 -- (-561.239) (-562.513) [-562.065] (-562.432) * (-561.059) [-563.597] (-561.878) (-562.451) -- 0:00:06
897000 -- (-561.272) (-561.497) (-562.412) [-562.489] * (-564.561) (-561.711) (-569.444) [-563.387] -- 0:00:06
897500 -- (-562.048) (-565.893) [-562.817] (-564.342) * (-567.117) (-564.709) (-563.451) [-562.348] -- 0:00:06
898000 -- (-568.226) (-561.742) (-563.332) [-562.784] * (-565.088) [-562.357] (-561.980) (-563.009) -- 0:00:06
898500 -- (-566.290) (-562.536) (-562.671) [-565.178] * (-563.001) (-562.228) [-561.516] (-562.168) -- 0:00:06
899000 -- (-564.558) (-562.397) (-562.269) [-561.520] * (-564.085) (-562.708) (-562.005) [-562.089] -- 0:00:06
899500 -- (-563.212) (-561.502) (-569.446) [-561.495] * (-562.167) (-560.870) (-560.545) [-562.737] -- 0:00:06
900000 -- (-565.339) (-563.697) (-561.289) [-562.201] * (-560.681) [-561.620] (-563.588) (-563.079) -- 0:00:06
Average standard deviation of split frequencies: 0.006874
900500 -- (-562.965) (-566.406) (-562.741) [-562.304] * [-563.156] (-561.173) (-564.760) (-564.846) -- 0:00:06
901000 -- [-565.157] (-562.390) (-563.224) (-563.152) * (-560.714) (-563.412) (-563.917) [-565.979] -- 0:00:06
901500 -- (-561.611) [-560.867] (-565.350) (-563.744) * (-562.763) (-561.240) [-560.764] (-563.706) -- 0:00:06
902000 -- (-561.067) (-566.340) [-561.133] (-563.489) * [-563.530] (-562.118) (-561.395) (-561.447) -- 0:00:06
902500 -- (-560.854) (-563.071) [-561.302] (-563.401) * (-564.393) (-564.344) (-561.349) [-562.061] -- 0:00:06
903000 -- (-563.915) [-563.034] (-562.066) (-565.606) * (-561.444) (-563.563) [-562.647] (-561.652) -- 0:00:06
903500 -- (-560.920) (-565.225) (-562.174) [-562.092] * [-560.929] (-562.052) (-567.444) (-561.772) -- 0:00:05
904000 -- (-562.034) [-562.514] (-564.082) (-562.686) * (-560.513) [-563.259] (-561.163) (-564.845) -- 0:00:05
904500 -- (-561.301) [-563.654] (-563.188) (-562.890) * [-560.847] (-561.628) (-564.966) (-562.381) -- 0:00:05
905000 -- (-564.793) [-560.514] (-562.886) (-566.157) * (-562.253) (-564.110) [-560.596] (-562.347) -- 0:00:05
Average standard deviation of split frequencies: 0.007076
905500 -- [-561.087] (-563.273) (-564.093) (-566.076) * (-560.983) (-563.425) [-561.897] (-561.666) -- 0:00:05
906000 -- [-562.258] (-561.058) (-562.130) (-561.257) * [-561.925] (-561.042) (-562.333) (-561.320) -- 0:00:05
906500 -- (-560.925) (-564.446) (-562.689) [-562.261] * [-560.880] (-561.647) (-561.846) (-563.988) -- 0:00:05
907000 -- (-562.228) (-562.685) [-560.905] (-563.480) * (-562.906) (-561.928) (-563.312) [-562.353] -- 0:00:05
907500 -- (-563.630) [-560.649] (-564.019) (-564.317) * (-563.790) [-562.105] (-564.616) (-560.215) -- 0:00:05
908000 -- [-561.930] (-562.962) (-569.491) (-562.618) * (-567.962) (-565.467) (-563.841) [-563.426] -- 0:00:05
908500 -- (-560.889) [-564.842] (-568.400) (-564.051) * (-564.164) (-563.486) (-566.603) [-562.338] -- 0:00:05
909000 -- (-564.566) (-564.812) [-564.474] (-563.914) * (-561.947) (-563.673) [-562.279] (-561.317) -- 0:00:05
909500 -- [-561.912] (-564.436) (-562.635) (-566.222) * (-563.234) (-562.600) (-563.271) [-565.491] -- 0:00:05
910000 -- (-562.928) (-561.792) (-562.875) [-561.296] * (-563.339) (-562.198) [-561.530] (-561.692) -- 0:00:05
Average standard deviation of split frequencies: 0.007109
910500 -- (-561.502) [-562.143] (-562.190) (-563.982) * [-561.674] (-563.873) (-560.903) (-564.523) -- 0:00:05
911000 -- (-565.138) (-561.011) (-564.472) [-562.056] * [-562.225] (-561.372) (-561.439) (-560.935) -- 0:00:05
911500 -- [-562.414] (-563.495) (-562.145) (-564.246) * (-568.097) (-561.347) (-563.300) [-563.201] -- 0:00:05
912000 -- (-563.979) [-564.144] (-564.364) (-564.480) * (-562.930) [-562.795] (-564.444) (-563.082) -- 0:00:05
912500 -- (-563.102) [-562.509] (-561.783) (-563.680) * (-562.887) (-566.802) [-564.784] (-564.540) -- 0:00:05
913000 -- (-561.237) (-564.234) (-561.872) [-560.325] * (-564.335) (-562.110) [-564.319] (-560.756) -- 0:00:05
913500 -- (-562.044) (-562.390) (-563.311) [-560.454] * (-560.680) (-562.678) (-563.997) [-560.610] -- 0:00:05
914000 -- (-563.869) (-563.274) (-561.237) [-560.511] * (-560.865) (-561.101) (-564.851) [-561.371] -- 0:00:05
914500 -- [-563.091] (-562.290) (-566.325) (-561.086) * (-564.318) (-563.437) (-564.617) [-561.428] -- 0:00:05
915000 -- [-561.669] (-563.182) (-564.966) (-560.730) * [-562.232] (-563.206) (-567.405) (-561.326) -- 0:00:05
Average standard deviation of split frequencies: 0.006827
915500 -- (-565.722) (-560.503) (-562.147) [-564.201] * (-562.820) [-561.675] (-566.134) (-564.694) -- 0:00:05
916000 -- [-562.822] (-563.745) (-562.049) (-563.935) * (-564.975) (-562.867) [-564.529] (-562.554) -- 0:00:05
916500 -- (-565.038) [-560.944] (-560.657) (-564.979) * (-561.188) (-564.439) (-565.098) [-560.573] -- 0:00:05
917000 -- (-562.207) [-562.041] (-562.697) (-566.809) * (-562.480) [-561.666] (-564.379) (-563.911) -- 0:00:05
917500 -- [-561.790] (-562.200) (-561.794) (-561.854) * [-567.960] (-562.940) (-561.361) (-561.910) -- 0:00:05
918000 -- (-561.739) (-561.977) [-561.158] (-563.118) * (-565.049) (-561.094) (-563.058) [-560.791] -- 0:00:05
918500 -- (-560.668) (-564.815) [-561.492] (-566.787) * (-562.033) (-561.472) (-562.233) [-560.898] -- 0:00:05
919000 -- (-564.223) (-562.222) [-561.349] (-564.068) * (-562.851) [-563.127] (-564.300) (-565.366) -- 0:00:05
919500 -- (-564.610) (-561.532) [-562.287] (-563.345) * (-563.114) (-568.491) [-562.690] (-561.190) -- 0:00:04
920000 -- (-561.725) (-561.297) [-564.757] (-560.728) * (-563.329) (-562.160) (-562.628) [-563.182] -- 0:00:04
Average standard deviation of split frequencies: 0.006725
920500 -- [-561.858] (-561.275) (-565.439) (-561.728) * (-562.524) (-560.969) (-561.382) [-564.200] -- 0:00:04
921000 -- (-565.212) (-562.712) [-563.122] (-562.246) * (-561.735) (-561.981) [-565.285] (-563.386) -- 0:00:04
921500 -- (-563.280) (-560.793) (-562.777) [-561.111] * (-561.543) (-560.664) (-563.466) [-562.224] -- 0:00:04
922000 -- (-566.421) (-562.516) [-562.188] (-564.613) * [-560.276] (-564.817) (-564.720) (-567.322) -- 0:00:04
922500 -- (-564.414) [-564.489] (-561.951) (-563.301) * (-561.047) (-564.432) (-562.488) [-563.368] -- 0:00:04
923000 -- (-561.516) (-563.405) (-562.381) [-562.639] * (-562.139) (-562.124) (-562.223) [-560.843] -- 0:00:04
923500 -- (-561.841) (-567.335) [-561.160] (-566.267) * (-564.491) [-562.718] (-565.514) (-563.328) -- 0:00:04
924000 -- (-560.271) (-564.595) [-561.150] (-561.326) * (-562.604) (-561.994) [-564.167] (-564.387) -- 0:00:04
924500 -- (-562.849) (-560.856) (-560.887) [-562.589] * [-561.959] (-562.033) (-563.084) (-561.789) -- 0:00:04
925000 -- [-561.231] (-564.887) (-565.428) (-564.487) * [-561.225] (-563.579) (-561.841) (-562.245) -- 0:00:04
Average standard deviation of split frequencies: 0.006652
925500 -- [-561.922] (-561.891) (-566.123) (-567.377) * (-566.381) [-563.209] (-563.837) (-562.429) -- 0:00:04
926000 -- (-561.790) (-569.439) [-566.979] (-561.988) * (-565.110) (-562.170) (-563.585) [-560.403] -- 0:00:04
926500 -- [-561.362] (-562.018) (-562.116) (-563.008) * [-560.764] (-564.676) (-563.872) (-564.567) -- 0:00:04
927000 -- (-563.512) (-563.191) (-565.785) [-563.113] * (-560.753) (-561.799) (-562.984) [-561.743] -- 0:00:04
927500 -- [-563.392] (-564.178) (-564.344) (-561.688) * [-564.448] (-563.655) (-565.110) (-561.775) -- 0:00:04
928000 -- (-566.143) (-562.939) (-563.140) [-562.284] * (-562.830) (-560.356) [-564.247] (-561.884) -- 0:00:04
928500 -- [-562.624] (-561.907) (-561.126) (-561.895) * [-565.251] (-562.584) (-564.222) (-563.942) -- 0:00:04
929000 -- [-561.350] (-565.421) (-561.492) (-564.792) * (-568.633) (-561.977) [-563.307] (-561.079) -- 0:00:04
929500 -- [-563.284] (-562.769) (-562.434) (-565.131) * (-565.409) (-562.181) (-561.862) [-561.828] -- 0:00:04
930000 -- (-563.407) (-560.983) (-562.808) [-563.702] * (-562.451) [-561.409] (-561.798) (-564.878) -- 0:00:04
Average standard deviation of split frequencies: 0.006517
930500 -- (-562.245) [-561.135] (-563.291) (-562.814) * (-562.119) (-562.344) [-564.075] (-563.561) -- 0:00:04
931000 -- [-564.148] (-564.628) (-562.438) (-563.354) * (-562.564) (-561.061) [-564.229] (-562.726) -- 0:00:04
931500 -- (-563.015) (-564.363) (-561.075) [-560.959] * [-562.264] (-561.970) (-563.149) (-561.661) -- 0:00:04
932000 -- (-561.603) [-561.338] (-561.234) (-564.790) * (-565.265) [-561.135] (-561.799) (-562.071) -- 0:00:04
932500 -- (-564.121) [-564.457] (-562.337) (-562.602) * (-560.322) [-563.973] (-563.443) (-563.967) -- 0:00:04
933000 -- [-563.146] (-562.159) (-565.052) (-562.182) * (-560.647) (-561.822) (-560.911) [-562.126] -- 0:00:04
933500 -- [-561.864] (-562.512) (-562.885) (-563.288) * (-561.235) [-562.507] (-560.941) (-560.392) -- 0:00:04
934000 -- (-563.378) (-561.421) [-561.842] (-564.169) * (-562.658) (-563.581) [-561.967] (-563.567) -- 0:00:04
934500 -- (-564.573) [-561.414] (-562.428) (-562.978) * [-562.162] (-565.238) (-560.650) (-562.772) -- 0:00:04
935000 -- (-563.836) [-562.083] (-562.059) (-566.233) * (-562.720) (-561.606) (-562.473) [-565.522] -- 0:00:04
Average standard deviation of split frequencies: 0.006581
935500 -- [-563.181] (-560.685) (-562.461) (-565.473) * [-562.775] (-560.935) (-561.533) (-562.142) -- 0:00:03
936000 -- [-564.240] (-561.369) (-561.743) (-568.868) * (-562.263) (-560.689) [-561.415] (-566.609) -- 0:00:03
936500 -- (-567.918) (-560.711) (-562.019) [-563.911] * (-563.451) [-563.428] (-562.148) (-560.426) -- 0:00:03
937000 -- (-562.301) (-561.193) (-561.304) [-561.489] * (-562.784) (-563.802) [-562.169] (-560.995) -- 0:00:03
937500 -- (-561.651) (-561.941) [-562.415] (-566.351) * [-562.508] (-567.034) (-561.693) (-564.595) -- 0:00:03
938000 -- (-561.669) (-561.972) (-564.169) [-563.897] * [-561.900] (-563.914) (-563.001) (-562.068) -- 0:00:03
938500 -- [-563.446] (-562.500) (-561.526) (-562.191) * (-561.494) (-563.433) (-564.033) [-561.373] -- 0:00:03
939000 -- (-561.872) (-562.497) [-561.860] (-560.862) * (-563.558) (-562.199) (-560.688) [-564.365] -- 0:00:03
939500 -- (-561.663) (-566.668) (-560.388) [-563.726] * (-561.791) (-561.426) [-561.702] (-562.738) -- 0:00:03
940000 -- (-564.992) [-561.240] (-560.858) (-567.527) * (-560.511) (-564.796) [-561.318] (-567.490) -- 0:00:03
Average standard deviation of split frequencies: 0.006782
940500 -- (-563.278) (-561.718) (-560.835) [-564.865] * (-563.376) (-563.424) (-563.402) [-564.483] -- 0:00:03
941000 -- (-563.278) (-563.001) (-563.970) [-564.377] * (-561.324) (-561.772) (-565.821) [-565.885] -- 0:00:03
941500 -- (-563.231) (-561.775) [-564.755] (-562.017) * [-561.403] (-561.629) (-566.191) (-568.141) -- 0:00:03
942000 -- (-563.777) [-561.529] (-564.254) (-567.162) * (-562.590) (-563.134) (-563.357) [-560.446] -- 0:00:03
942500 -- (-563.597) (-562.562) [-561.784] (-564.602) * (-562.123) (-560.772) (-564.543) [-560.452] -- 0:00:03
943000 -- (-562.392) [-560.887] (-562.326) (-562.282) * (-563.214) (-560.135) [-564.584] (-563.243) -- 0:00:03
943500 -- (-565.789) (-561.964) [-560.768] (-563.121) * [-562.940] (-564.291) (-562.602) (-564.555) -- 0:00:03
944000 -- (-562.646) [-561.545] (-561.719) (-564.535) * (-566.151) (-561.182) [-562.196] (-562.889) -- 0:00:03
944500 -- (-560.942) (-561.962) [-563.475] (-564.848) * (-561.090) (-562.116) [-563.525] (-562.496) -- 0:00:03
945000 -- (-560.982) (-561.914) [-563.273] (-561.711) * (-563.359) [-564.417] (-565.661) (-562.035) -- 0:00:03
Average standard deviation of split frequencies: 0.006844
945500 -- [-560.255] (-561.513) (-562.447) (-561.866) * (-565.040) [-565.713] (-564.617) (-561.854) -- 0:00:03
946000 -- [-560.372] (-561.255) (-563.467) (-567.460) * [-561.832] (-562.453) (-563.168) (-561.235) -- 0:00:03
946500 -- [-564.910] (-560.628) (-563.407) (-561.100) * (-560.750) [-567.212] (-565.074) (-561.878) -- 0:00:03
947000 -- (-564.817) (-560.679) (-560.843) [-562.463] * (-560.609) (-561.095) [-563.659] (-560.984) -- 0:00:03
947500 -- (-562.572) [-560.568] (-569.981) (-561.525) * (-561.349) (-564.083) (-561.572) [-561.098] -- 0:00:03
948000 -- (-560.735) (-562.290) (-573.130) [-561.925] * (-562.454) [-564.682] (-560.266) (-563.112) -- 0:00:03
948500 -- [-562.342] (-560.871) (-564.306) (-561.903) * (-561.486) [-563.700] (-560.599) (-565.933) -- 0:00:03
949000 -- [-561.772] (-562.357) (-562.482) (-565.941) * (-566.895) [-562.301] (-563.729) (-561.393) -- 0:00:03
949500 -- (-561.515) (-563.929) [-566.288] (-562.244) * (-572.713) (-562.510) [-568.932] (-561.132) -- 0:00:03
950000 -- (-562.314) [-563.636] (-567.374) (-561.623) * (-565.602) [-562.410] (-565.848) (-563.910) -- 0:00:03
Average standard deviation of split frequencies: 0.006843
950500 -- (-562.047) (-561.684) [-564.136] (-562.892) * (-566.277) (-562.054) [-563.463] (-563.513) -- 0:00:03
951000 -- (-561.863) [-561.390] (-561.837) (-562.779) * (-562.898) (-565.552) (-570.889) [-563.401] -- 0:00:03
951500 -- (-565.792) (-563.214) (-565.214) [-561.325] * (-563.074) (-566.684) [-560.612] (-561.575) -- 0:00:03
952000 -- (-563.739) (-561.473) [-562.135] (-561.945) * (-561.151) (-563.865) (-562.759) [-562.726] -- 0:00:02
952500 -- (-562.194) (-562.336) (-561.593) [-561.409] * (-564.184) [-562.963] (-564.610) (-562.555) -- 0:00:02
953000 -- (-563.104) (-565.031) [-563.708] (-562.468) * (-563.775) (-560.319) (-566.240) [-562.389] -- 0:00:02
953500 -- [-565.205] (-565.314) (-561.863) (-560.809) * [-561.913] (-561.461) (-563.047) (-563.412) -- 0:00:02
954000 -- (-564.744) [-560.983] (-564.911) (-561.641) * (-563.267) [-565.297] (-571.462) (-562.099) -- 0:00:02
954500 -- (-561.666) (-567.067) (-562.145) [-561.691] * (-566.092) [-562.467] (-560.970) (-563.560) -- 0:00:02
955000 -- (-562.872) [-565.484] (-564.836) (-562.451) * (-562.480) [-568.473] (-564.165) (-561.638) -- 0:00:02
Average standard deviation of split frequencies: 0.006969
955500 -- [-561.949] (-564.890) (-562.303) (-561.198) * (-561.153) (-570.522) [-563.223] (-564.009) -- 0:00:02
956000 -- (-562.602) (-561.875) [-561.807] (-560.580) * [-563.217] (-561.435) (-566.350) (-563.171) -- 0:00:02
956500 -- (-567.930) [-563.976] (-561.809) (-560.582) * (-562.904) [-562.315] (-566.673) (-561.061) -- 0:00:02
957000 -- [-561.211] (-567.141) (-565.277) (-561.529) * (-562.498) [-562.365] (-562.830) (-561.247) -- 0:00:02
957500 -- [-566.930] (-562.114) (-561.014) (-565.196) * [-560.976] (-564.508) (-562.533) (-563.354) -- 0:00:02
958000 -- [-563.268] (-561.920) (-561.554) (-560.833) * (-561.971) (-561.271) (-561.618) [-562.198] -- 0:00:02
958500 -- (-563.508) [-562.351] (-568.357) (-564.957) * (-562.925) [-561.542] (-562.477) (-562.545) -- 0:00:02
959000 -- (-561.171) [-563.948] (-565.626) (-562.665) * (-560.953) (-560.542) (-565.223) [-562.264] -- 0:00:02
959500 -- (-564.550) (-568.267) (-564.383) [-561.525] * (-561.724) [-561.755] (-562.271) (-562.858) -- 0:00:02
960000 -- (-563.018) (-564.299) [-563.079] (-563.721) * (-564.873) (-561.398) [-560.732] (-573.551) -- 0:00:02
Average standard deviation of split frequencies: 0.007361
960500 -- (-563.722) (-562.632) (-562.894) [-561.639] * [-565.479] (-562.535) (-563.147) (-565.579) -- 0:00:02
961000 -- (-565.511) (-564.325) [-562.240] (-563.410) * (-565.852) [-561.606] (-563.944) (-561.833) -- 0:00:02
961500 -- (-562.411) (-561.905) (-561.143) [-561.889] * (-563.982) (-560.806) (-560.637) [-561.394] -- 0:00:02
962000 -- [-564.257] (-562.087) (-561.788) (-566.586) * (-562.283) (-560.547) (-560.936) [-563.814] -- 0:00:02
962500 -- (-563.814) (-560.972) [-564.566] (-560.586) * (-563.359) [-563.056] (-561.575) (-561.074) -- 0:00:02
963000 -- (-560.392) [-562.246] (-563.416) (-560.614) * (-564.716) (-563.334) (-567.528) [-562.080] -- 0:00:02
963500 -- (-566.327) (-562.481) (-562.772) [-563.598] * (-562.037) [-562.192] (-568.594) (-561.312) -- 0:00:02
964000 -- (-562.884) [-561.795] (-566.146) (-562.867) * (-561.857) (-561.970) (-564.790) [-562.701] -- 0:00:02
964500 -- (-564.738) (-562.197) (-565.502) [-563.949] * (-562.718) [-562.001] (-562.243) (-563.049) -- 0:00:02
965000 -- [-564.049] (-562.422) (-566.386) (-563.457) * [-560.896] (-561.825) (-561.472) (-562.888) -- 0:00:02
Average standard deviation of split frequencies: 0.007027
965500 -- [-567.866] (-562.594) (-563.390) (-563.089) * (-564.745) [-563.382] (-567.263) (-561.670) -- 0:00:02
966000 -- (-565.567) (-562.223) (-565.047) [-561.653] * (-561.016) (-562.889) [-563.612] (-562.126) -- 0:00:02
966500 -- (-565.734) [-561.578] (-566.144) (-563.162) * (-561.656) (-566.307) (-564.037) [-564.606] -- 0:00:02
967000 -- [-561.165] (-562.038) (-563.199) (-562.925) * (-561.430) (-564.361) (-564.687) [-562.927] -- 0:00:02
967500 -- (-561.133) (-561.460) (-564.169) [-562.998] * (-564.886) [-564.003] (-561.522) (-561.793) -- 0:00:02
968000 -- (-561.480) [-560.725] (-563.118) (-562.759) * [-561.329] (-563.710) (-561.494) (-563.005) -- 0:00:01
968500 -- (-562.898) (-561.561) [-562.135] (-563.719) * (-562.250) (-561.544) [-563.392] (-561.754) -- 0:00:01
969000 -- (-560.834) (-562.185) (-564.203) [-561.970] * (-564.019) (-563.173) [-561.666] (-564.149) -- 0:00:01
969500 -- (-561.257) [-561.965] (-562.004) (-560.735) * (-562.584) (-565.928) [-562.085] (-560.767) -- 0:00:01
970000 -- (-560.975) (-561.926) [-562.454] (-564.931) * (-561.198) [-565.458] (-561.979) (-561.519) -- 0:00:01
Average standard deviation of split frequencies: 0.006864
970500 -- (-560.683) [-561.853] (-560.498) (-564.246) * (-562.047) (-565.291) (-561.869) [-561.519] -- 0:00:01
971000 -- (-562.013) [-562.195] (-560.648) (-562.214) * (-564.106) [-564.536] (-563.102) (-564.609) -- 0:00:01
971500 -- (-561.582) (-561.615) (-565.521) [-561.054] * (-565.117) (-565.231) (-563.524) [-564.345] -- 0:00:01
972000 -- [-564.987] (-561.078) (-561.974) (-563.894) * (-561.126) (-560.586) [-561.305] (-563.759) -- 0:00:01
972500 -- [-562.328] (-562.081) (-564.047) (-563.063) * [-563.624] (-560.629) (-560.705) (-563.716) -- 0:00:01
973000 -- (-562.067) [-561.582] (-560.591) (-564.863) * (-563.451) (-560.313) [-562.390] (-561.939) -- 0:00:01
973500 -- (-563.141) [-563.082] (-565.586) (-564.059) * (-561.534) (-561.231) [-561.570] (-562.302) -- 0:00:01
974000 -- [-563.020] (-566.603) (-566.158) (-561.302) * (-562.147) (-562.681) [-560.731] (-563.409) -- 0:00:01
974500 -- (-561.115) [-562.528] (-562.586) (-561.371) * (-562.006) (-562.267) (-562.323) [-562.087] -- 0:00:01
975000 -- (-561.315) (-562.978) (-560.934) [-562.619] * [-561.981] (-563.003) (-561.520) (-561.584) -- 0:00:01
Average standard deviation of split frequencies: 0.006633
975500 -- (-561.949) [-561.556] (-561.435) (-560.874) * (-562.673) (-563.043) (-564.924) [-562.367] -- 0:00:01
976000 -- (-562.352) [-562.293] (-562.492) (-560.451) * (-562.555) (-563.986) (-563.612) [-560.854] -- 0:00:01
976500 -- (-563.153) (-562.243) (-565.171) [-563.286] * (-562.003) (-562.935) [-562.486] (-567.722) -- 0:00:01
977000 -- (-569.066) [-561.425] (-573.730) (-562.403) * [-561.738] (-561.582) (-562.820) (-565.672) -- 0:00:01
977500 -- (-565.492) [-565.595] (-563.968) (-562.641) * (-561.594) (-562.580) [-563.129] (-562.762) -- 0:00:01
978000 -- [-561.594] (-561.655) (-563.464) (-568.525) * (-561.938) (-562.490) (-562.073) [-563.857] -- 0:00:01
978500 -- (-563.054) (-563.889) [-563.445] (-561.821) * (-565.714) [-562.493] (-564.861) (-561.340) -- 0:00:01
979000 -- (-562.628) [-562.140] (-563.333) (-561.797) * [-561.692] (-562.529) (-562.691) (-562.717) -- 0:00:01
979500 -- (-561.992) (-561.776) (-565.555) [-562.170] * (-566.236) (-563.661) [-566.361] (-565.183) -- 0:00:01
980000 -- [-560.941] (-561.054) (-561.766) (-560.743) * (-569.262) (-563.117) (-563.475) [-561.253] -- 0:00:01
Average standard deviation of split frequencies: 0.006377
980500 -- [-562.700] (-561.680) (-560.754) (-566.082) * (-562.747) (-566.941) (-562.701) [-562.723] -- 0:00:01
981000 -- (-563.276) [-561.872] (-560.260) (-561.482) * [-563.769] (-568.152) (-561.343) (-562.515) -- 0:00:01
981500 -- (-562.235) (-561.910) [-560.475] (-561.527) * [-562.220] (-562.026) (-564.351) (-562.136) -- 0:00:01
982000 -- (-563.000) [-561.648] (-561.287) (-561.959) * (-563.045) (-564.566) [-565.294] (-561.551) -- 0:00:01
982500 -- (-561.482) [-560.743] (-561.357) (-563.321) * (-561.423) [-561.046] (-564.191) (-562.667) -- 0:00:01
983000 -- (-561.720) [-562.576] (-560.708) (-561.887) * [-563.594] (-561.330) (-563.855) (-560.931) -- 0:00:01
983500 -- (-563.323) [-563.304] (-563.275) (-561.029) * (-561.703) (-561.445) (-563.938) [-564.308] -- 0:00:01
984000 -- [-561.593] (-561.607) (-560.973) (-562.898) * [-561.134] (-562.347) (-563.712) (-563.502) -- 0:00:00
984500 -- (-561.955) (-565.157) [-561.331] (-561.624) * [-561.231] (-561.903) (-564.145) (-563.247) -- 0:00:00
985000 -- (-563.094) (-562.886) (-564.725) [-561.616] * (-562.910) (-561.444) [-564.194] (-564.370) -- 0:00:00
Average standard deviation of split frequencies: 0.006215
985500 -- (-562.025) (-560.664) (-560.867) [-563.488] * [-562.269] (-561.087) (-564.634) (-567.948) -- 0:00:00
986000 -- [-561.803] (-563.741) (-561.068) (-562.987) * [-563.115] (-561.430) (-571.131) (-564.035) -- 0:00:00
986500 -- (-563.490) (-563.769) [-560.555] (-561.738) * [-562.853] (-562.980) (-568.277) (-567.295) -- 0:00:00
987000 -- (-567.219) [-561.024] (-560.961) (-561.550) * (-563.299) (-561.297) [-562.183] (-562.354) -- 0:00:00
987500 -- (-562.223) (-560.884) (-561.995) [-561.044] * [-562.661] (-563.327) (-560.519) (-562.542) -- 0:00:00
988000 -- (-562.583) (-561.562) (-563.685) [-560.800] * (-565.181) [-561.870] (-563.523) (-561.138) -- 0:00:00
988500 -- (-562.812) [-561.113] (-561.985) (-561.671) * (-566.405) (-562.538) (-564.903) [-562.724] -- 0:00:00
989000 -- [-563.404] (-565.916) (-560.741) (-562.233) * (-562.732) [-562.575] (-563.323) (-562.916) -- 0:00:00
989500 -- (-562.582) (-565.969) [-567.702] (-560.371) * [-560.422] (-561.127) (-564.282) (-561.954) -- 0:00:00
990000 -- [-561.831] (-565.570) (-563.503) (-560.528) * (-566.307) [-562.192] (-561.795) (-562.208) -- 0:00:00
Average standard deviation of split frequencies: 0.006662
990500 -- [-562.876] (-567.118) (-561.487) (-562.517) * [-562.866] (-562.574) (-563.730) (-561.559) -- 0:00:00
991000 -- (-561.073) [-563.258] (-561.490) (-563.799) * (-563.511) (-562.525) [-561.270] (-562.526) -- 0:00:00
991500 -- (-561.281) (-562.831) (-561.836) [-564.578] * (-561.449) (-561.724) [-560.869] (-562.126) -- 0:00:00
992000 -- (-561.361) (-563.206) [-565.294] (-568.233) * [-560.403] (-561.366) (-562.771) (-566.302) -- 0:00:00
992500 -- [-564.450] (-563.000) (-561.928) (-564.113) * (-560.584) (-560.573) (-561.900) [-561.579] -- 0:00:00
993000 -- [-561.009] (-562.509) (-560.790) (-562.631) * (-560.298) [-560.225] (-562.863) (-561.185) -- 0:00:00
993500 -- (-561.777) [-562.285] (-563.742) (-567.606) * [-560.257] (-561.880) (-563.294) (-562.699) -- 0:00:00
994000 -- (-560.861) (-564.077) [-561.430] (-561.846) * [-560.736] (-562.191) (-562.750) (-562.059) -- 0:00:00
994500 -- (-560.689) (-566.855) (-560.891) [-562.984] * (-561.414) [-562.405] (-564.763) (-561.589) -- 0:00:00
995000 -- (-561.984) (-562.668) (-562.486) [-564.618] * (-563.310) [-561.944] (-562.925) (-561.820) -- 0:00:00
Average standard deviation of split frequencies: 0.006248
995500 -- (-562.303) (-562.205) [-561.469] (-565.458) * (-561.680) (-563.012) [-562.910] (-562.276) -- 0:00:00
996000 -- (-561.609) (-561.221) (-565.308) [-561.700] * [-561.225] (-563.680) (-561.323) (-564.674) -- 0:00:00
996500 -- (-561.639) (-563.001) (-562.820) [-561.707] * [-562.854] (-567.609) (-561.852) (-563.026) -- 0:00:00
997000 -- (-562.087) (-564.258) [-563.423] (-561.847) * (-560.522) (-566.358) (-564.539) [-561.955] -- 0:00:00
997500 -- (-562.307) [-562.791] (-561.550) (-561.602) * (-560.368) [-561.592] (-561.771) (-566.558) -- 0:00:00
998000 -- (-561.292) (-561.407) [-561.618] (-560.623) * (-560.360) [-562.243] (-560.489) (-564.900) -- 0:00:00
998500 -- (-562.063) (-561.446) (-562.306) [-563.034] * [-560.360] (-563.498) (-561.639) (-562.158) -- 0:00:00
999000 -- (-565.014) (-561.017) (-561.514) [-563.011] * (-565.837) [-563.533] (-562.325) (-562.992) -- 0:00:00
999500 -- (-562.397) (-561.219) (-563.470) [-563.126] * [-564.183] (-562.461) (-562.809) (-563.069) -- 0:00:00
1000000 -- (-562.226) (-561.071) (-568.070) [-560.600] * (-561.181) (-562.611) (-563.559) [-562.717] -- 0:00:00
Average standard deviation of split frequencies: 0.006156
Analysis completed in 1 mins 2 seconds
Analysis used 60.64 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -560.08
Likelihood of best state for "cold" chain of run 2 was -560.08
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
33.3 % ( 21 %) Dirichlet(Pi{all})
34.8 % ( 28 %) Slider(Pi{all})
78.8 % ( 62 %) Multiplier(Alpha{1,2})
77.8 % ( 53 %) Multiplier(Alpha{3})
24.6 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 93 %) ParsSPR(Tau{all},V{all})
28.2 % ( 19 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.2 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.5 % ( 19 %) Dirichlet(Pi{all})
34.0 % ( 26 %) Slider(Pi{all})
79.3 % ( 52 %) Multiplier(Alpha{1,2})
77.6 % ( 53 %) Multiplier(Alpha{3})
24.6 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 85 %) ParsSPR(Tau{all},V{all})
28.1 % ( 34 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.3 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166253 0.82 0.67
3 | 166623 166671 0.84
4 | 166086 167639 166728
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167127 0.82 0.67
3 | 166912 166041 0.84
4 | 166727 166288 166905
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -561.85
| 2 1 22 2|
| 2 2 2 * |
| 1 1 222 2 2 1 1 |
| 11 2 11 1 1 |
| 2 * 1 1 2 22 *12* 1 11 |
| 1112 2 1 1 2 2 1 1122 |
|1 2 1 1 2 1 1 1 1 2 1 |
|2 2 2 21 1 1 1 2 2 211 |
| 2 2 1 2 1 2222 1 2 2 2*21|
| 111 1 1 2 22 1 1 |
| 2 |
| 2 1 1 1 |
| |
| 12 2 2 2 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -563.41
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -561.79 -564.55
2 -561.80 -564.48
--------------------------------------
TOTAL -561.80 -564.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900469 0.091642 0.362885 1.505313 0.868586 1434.54 1467.77 1.000
r(A<->C){all} 0.154247 0.018992 0.000118 0.428590 0.115728 246.48 269.45 1.000
r(A<->G){all} 0.178361 0.022977 0.000142 0.475231 0.135672 108.38 141.92 1.001
r(A<->T){all} 0.163592 0.020634 0.000134 0.456268 0.122881 218.13 231.15 1.003
r(C<->G){all} 0.167818 0.020801 0.000026 0.463538 0.130353 164.87 170.11 1.000
r(C<->T){all} 0.160733 0.018906 0.000221 0.427914 0.123726 160.45 191.29 1.004
r(G<->T){all} 0.175249 0.021536 0.000010 0.467898 0.140266 220.50 243.88 1.001
pi(A){all} 0.234346 0.000410 0.196540 0.274301 0.234201 1059.22 1210.90 1.000
pi(C){all} 0.294037 0.000488 0.251645 0.338325 0.293779 1238.45 1246.98 1.000
pi(G){all} 0.315775 0.000488 0.272321 0.358050 0.315682 1278.26 1311.27 1.000
pi(T){all} 0.155842 0.000296 0.123502 0.190084 0.154929 1095.94 1239.19 1.000
alpha{1,2} 0.415954 0.225889 0.000114 1.396293 0.246486 1289.80 1297.84 1.000
alpha{3} 0.466469 0.246086 0.000302 1.437182 0.299127 1501.00 1501.00 1.000
pinvar{all} 0.996166 0.000022 0.987780 0.999999 0.997608 1062.92 1144.66 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..****
8 -- .*.*..
9 -- ..*..*
10 -- .***.*
11 -- .**...
12 -- ...**.
13 -- .****.
14 -- .*...*
15 -- ..**..
16 -- .*.***
17 -- ..*.*.
18 -- ....**
19 -- .*..*.
20 -- ...*.*
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.006124 0.150566 0.159227 2
8 446 0.148568 0.011306 0.140573 0.156562 2
9 442 0.147235 0.011306 0.139241 0.155230 2
10 440 0.146569 0.008480 0.140573 0.152565 2
11 438 0.145903 0.001884 0.144570 0.147235 2
12 434 0.144570 0.003769 0.141905 0.147235 2
13 432 0.143904 0.012248 0.135243 0.152565 2
14 430 0.143238 0.003769 0.140573 0.145903 2
15 430 0.143238 0.006595 0.138574 0.147901 2
16 428 0.142572 0.004711 0.139241 0.145903 2
17 427 0.142239 0.003298 0.139907 0.144570 2
18 427 0.142239 0.002355 0.140573 0.143904 2
19 413 0.137575 0.009893 0.130580 0.144570 2
20 405 0.134910 0.005182 0.131246 0.138574 2
21 401 0.133578 0.001413 0.132578 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100768 0.010704 0.000011 0.302377 0.067861 1.000 2
length{all}[2] 0.102571 0.010833 0.000037 0.306155 0.071644 1.000 2
length{all}[3] 0.102621 0.010984 0.000001 0.319501 0.071457 1.000 2
length{all}[4] 0.098690 0.009843 0.000007 0.299418 0.066559 1.000 2
length{all}[5] 0.098866 0.009787 0.000172 0.290237 0.067610 1.000 2
length{all}[6] 0.098765 0.009568 0.000009 0.292272 0.068258 1.000 2
length{all}[7] 0.100955 0.011128 0.000325 0.315791 0.070148 0.998 2
length{all}[8] 0.089886 0.007141 0.000051 0.244624 0.064913 0.998 2
length{all}[9] 0.095592 0.009311 0.000058 0.297781 0.060869 0.998 2
length{all}[10] 0.106909 0.010856 0.000431 0.300691 0.074168 1.005 2
length{all}[11] 0.103665 0.011307 0.000771 0.307909 0.071004 0.998 2
length{all}[12] 0.094470 0.010274 0.000492 0.276585 0.064034 0.998 2
length{all}[13] 0.098260 0.009742 0.000024 0.295579 0.069933 1.000 2
length{all}[14] 0.102241 0.010849 0.000422 0.322088 0.068689 0.998 2
length{all}[15] 0.094703 0.008983 0.000043 0.286724 0.065769 0.998 2
length{all}[16] 0.103994 0.009773 0.000017 0.293320 0.072065 1.003 2
length{all}[17] 0.100999 0.010321 0.000122 0.283437 0.076409 0.999 2
length{all}[18] 0.100275 0.011428 0.000420 0.308575 0.067413 0.998 2
length{all}[19] 0.102577 0.010451 0.000257 0.300494 0.068905 1.009 2
length{all}[20] 0.097636 0.009594 0.000682 0.295880 0.072009 1.003 2
length{all}[21] 0.098390 0.010190 0.001046 0.308166 0.067142 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006156
Maximum standard deviation of split frequencies = 0.012248
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 414
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 46 patterns at 138 / 138 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 46 patterns at 138 / 138 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
44896 bytes for conP
4048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.071794 0.051660 0.042177 0.059193 0.044396 0.073802 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -588.392409
Iterating by ming2
Initial: fx= 588.392409
x= 0.07179 0.05166 0.04218 0.05919 0.04440 0.07380 0.30000 1.30000
1 h-m-p 0.0000 0.0003 330.8778 +++ 554.175047 m 0.0003 14 | 1/8
2 h-m-p 0.0160 8.0000 16.1848 -------------.. | 1/8
3 h-m-p 0.0000 0.0000 304.1568 ++ 552.658960 m 0.0000 47 | 2/8
4 h-m-p 0.0160 8.0000 16.6012 -------------.. | 2/8
5 h-m-p 0.0000 0.0001 271.9621 ++ 548.682410 m 0.0001 80 | 3/8
6 h-m-p 0.0160 8.0000 13.9208 -------------.. | 3/8
7 h-m-p 0.0000 0.0001 235.6560 ++ 545.582165 m 0.0001 113 | 4/8
8 h-m-p 0.0160 8.0000 11.2998 -------------.. | 4/8
9 h-m-p 0.0000 0.0001 192.5146 ++ 542.111901 m 0.0001 146 | 5/8
10 h-m-p 0.0160 8.0000 8.2623 -------------.. | 5/8
11 h-m-p 0.0000 0.0000 136.4099 ++ 541.834370 m 0.0000 179 | 6/8
12 h-m-p 0.0258 8.0000 0.0000 N 541.834370 0 0.0129 190 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 C 541.834370 0 1.6000 203
Out..
lnL = -541.834370
204 lfun, 204 eigenQcodon, 1224 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.060799 0.020277 0.063626 0.108047 0.108064 0.089269 0.300025 0.521042 0.246071
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.815215
np = 9
lnL0 = -599.974982
Iterating by ming2
Initial: fx= 599.974982
x= 0.06080 0.02028 0.06363 0.10805 0.10806 0.08927 0.30003 0.52104 0.24607
1 h-m-p 0.0000 0.0002 299.7935 +++ 585.037320 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0007 236.3737 ++ 558.589455 m 0.0007 27 | 2/9
3 h-m-p 0.0000 0.0000 28209.1148 ++ 557.121370 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0002 466.5437 ++ 549.680158 m 0.0002 51 | 4/9
5 h-m-p 0.0019 0.0093 22.9752 ++ 549.400113 m 0.0093 63 | 5/9
6 h-m-p 0.0000 0.0000 67.8671 ++ 549.393487 m 0.0000 75 | 6/9
7 h-m-p 0.0001 0.0258 31.0123 +++++ 548.274905 m 0.0258 90 | 6/9
8 h-m-p 0.0200 0.0999 10.3649 -------------.. | 6/9
9 h-m-p 0.0000 0.0003 135.4231 +++ 541.834372 m 0.0003 126 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 541.834372 m 8.0000 138 | 7/9
11 h-m-p 0.0160 8.0000 0.0072 ------C 541.834372 0 0.0000 158 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 ------------C 541.834372 0 0.0000 184 | 7/9
13 h-m-p 0.0160 8.0000 0.0000 -C 541.834372 0 0.0010 199
Out..
lnL = -541.834372
200 lfun, 600 eigenQcodon, 2400 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.100658 0.041885 0.098606 0.037936 0.104048 0.080927 0.290155 1.348515 0.277563 0.191576 1.484750
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.295761
np = 11
lnL0 = -599.069803
Iterating by ming2
Initial: fx= 599.069803
x= 0.10066 0.04189 0.09861 0.03794 0.10405 0.08093 0.29015 1.34851 0.27756 0.19158 1.48475
1 h-m-p 0.0000 0.0003 274.7392 +++ 572.624838 m 0.0003 17 | 1/11
2 h-m-p 0.0000 0.0001 195.0108 ++ 570.066324 m 0.0001 31 | 2/11
3 h-m-p 0.0000 0.0001 968.9164 ++ 550.444580 m 0.0001 45 | 3/11
4 h-m-p 0.0001 0.0003 210.1739 ++ 546.176590 m 0.0003 59 | 4/11
5 h-m-p 0.0046 0.0601 4.7679 ------------.. | 4/11
6 h-m-p 0.0000 0.0001 229.9914 ++ 542.913022 m 0.0001 97 | 5/11
7 h-m-p 0.0059 0.7797 1.9420 ------------.. | 5/11
8 h-m-p 0.0000 0.0000 192.0558 ++ 542.323737 m 0.0000 135 | 6/11
9 h-m-p 0.0160 8.0000 0.7188 -------------.. | 6/11
10 h-m-p 0.0000 0.0000 136.3093 ++ 541.834380 m 0.0000 179 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 541.834380 m 8.0000 196 | 6/11
12 h-m-p -0.0000 -0.0000 0.0402
h-m-p: -2.41935026e-15 -1.20967513e-14 4.02488139e-02 541.834380
.. | 6/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 541.834380 m 8.0000 233 | 6/11
14 h-m-p 0.0022 1.0970 1.0814 +++++ 541.834367 m 1.0970 255 | 7/11
15 h-m-p 0.6631 8.0000 0.9627 ++ 541.834349 m 8.0000 269 | 7/11
16 h-m-p 1.6000 8.0000 0.4213 ++ 541.834349 m 8.0000 287 | 7/11
17 h-m-p 1.6000 8.0000 0.5465 ++ 541.834348 m 8.0000 305 | 7/11
18 h-m-p 0.2168 1.0838 15.3629 ---------C 541.834348 0 0.0000 332 | 7/11
19 h-m-p 0.2876 8.0000 0.0000 +++ 541.834348 m 8.0000 347 | 7/11
20 h-m-p 0.1128 8.0000 0.0008 ++++ 541.834348 m 8.0000 367 | 7/11
21 h-m-p 0.0160 8.0000 1.2574 +++++ 541.834347 m 8.0000 388 | 7/11
22 h-m-p 1.1074 8.0000 9.0830 ++ 541.834344 m 8.0000 402 | 7/11
23 h-m-p 0.2848 1.4241 29.9319 ++ 541.834344 m 1.4241 416 | 7/11
24 h-m-p -0.0000 -0.0000 59.7038
h-m-p: -0.00000000e+00 -0.00000000e+00 5.97038343e+01 541.834344
.. | 7/11
25 h-m-p 0.0160 8.0000 0.0000 Y 541.834344 0 0.0160 441 | 7/11
26 h-m-p 1.6000 8.0000 0.0000 Y 541.834344 0 0.4000 459
Out..
lnL = -541.834344
460 lfun, 1840 eigenQcodon, 8280 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -541.837888 S = -541.832094 -0.002214
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:03
did 20 / 46 patterns 0:03
did 30 / 46 patterns 0:03
did 40 / 46 patterns 0:04
did 46 / 46 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.086958 0.100081 0.094721 0.077155 0.053280 0.102523 77.075190 0.665335 1.224680
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.422509
np = 9
lnL0 = -607.598530
Iterating by ming2
Initial: fx= 607.598530
x= 0.08696 0.10008 0.09472 0.07716 0.05328 0.10252 77.07519 0.66534 1.22468
1 h-m-p 0.0000 0.0004 293.0673 +++ 568.526888 m 0.0004 15 | 1/9
2 h-m-p 0.0047 0.0270 24.9227 ++ 564.216736 m 0.0270 27 | 2/9
3 h-m-p 0.0143 0.0715 1.6115 -------------.. | 2/9
4 h-m-p 0.0000 0.0002 299.3109 +++ 546.608108 m 0.0002 63 | 3/9
5 h-m-p 0.0330 8.0000 1.5647 --------------.. | 3/9
6 h-m-p 0.0000 0.0000 276.4529 ++ 544.109831 m 0.0000 99 | 4/9
7 h-m-p 0.0160 8.0000 1.3286 -------------.. | 4/9
8 h-m-p 0.0000 0.0000 240.4064 ++ 542.649170 m 0.0000 134 | 5/9
9 h-m-p 0.0160 8.0000 1.0802 -------------.. | 5/9
10 h-m-p 0.0000 0.0000 196.9429 ++ 541.984772 m 0.0000 169 | 6/9
11 h-m-p 0.0160 8.0000 0.7640 -------------.. | 6/9
12 h-m-p 0.0000 0.0000 139.5965 ++ 541.834450 m 0.0000 207 | 7/9
13 h-m-p 0.0160 8.0000 0.0000 Y 541.834450 0 0.0160 219 | 6/9
14 h-m-p 0.0160 8.0000 0.0000 +++++ 541.834450 m 8.0000 236
QuantileBeta(0.15, 0.00496, 1.08829) = 2.035425e-161 2000 rounds
| 6/9
15 h-m-p 0.0086 0.0431 0.0012 -------------..
QuantileBeta(0.15, 0.00496, 1.08829) = 2.035425e-161 2000 rounds
| 6/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 541.834450 m 8.0000 280
QuantileBeta(0.15, 0.00498, 1.08829) = 1.015603e-160 2000 rounds
| 6/9
17 h-m-p 0.0131 0.0656 0.0006 ----Y 541.834450 0 0.0000 299
Out..
lnL = -541.834450
300 lfun, 3300 eigenQcodon, 18000 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052107 0.095563 0.089079 0.097008 0.089308 0.104487 77.075442 0.900000 0.284225 1.326289 1.300033
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.464932
np = 11
lnL0 = -605.522328
Iterating by ming2
Initial: fx= 605.522328
x= 0.05211 0.09556 0.08908 0.09701 0.08931 0.10449 77.07544 0.90000 0.28422 1.32629 1.30003
1 h-m-p 0.0000 0.0005 265.5934 +++ 570.492604 m 0.0005 17 | 1/11
2 h-m-p 0.0002 0.0009 192.2662 ++ 545.971324 m 0.0009 31 | 2/11
3 h-m-p 0.0000 0.0000 111.4892 ++ 545.851511 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0046 113.0782 ++++ 542.906156 m 0.0046 61 | 4/11
5 h-m-p 0.0000 0.0000 8745.0247 ++ 542.561310 m 0.0000 75 | 5/11
6 h-m-p 0.0000 0.0000 2073.9753 ++ 542.435022 m 0.0000 89 | 5/11
7 h-m-p 0.0000 0.0000 115.9064
h-m-p: 4.19041455e-21 2.09520728e-20 1.15906419e+02 542.435022
.. | 5/11
8 h-m-p 0.0000 0.0000 134.7254 ++ 541.834338 m 0.0000 114 | 6/11
9 h-m-p 0.0010 0.0048 0.0000 Y 541.834338 0 0.0010 128 | 6/11
10 h-m-p 0.0485 8.0000 0.0000 -------Y 541.834338 0 0.0000 154
Out..
lnL = -541.834338
155 lfun, 1860 eigenQcodon, 10230 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -541.838248 S = -541.831930 -0.002769
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:12
did 20 / 46 patterns 0:12
did 30 / 46 patterns 0:12
did 40 / 46 patterns 0:12
did 46 / 46 patterns 0:12
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=138
NC_011896_1_WP_010908645_1_2091_MLBR_RS09930 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
NC_002677_1_NP_302324_1_1196_rpsK MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
**************************************************
NC_011896_1_WP_010908645_1_2091_MLBR_RS09930 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
NC_002677_1_NP_302324_1_1196_rpsK IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055 IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
**************************************************
NC_011896_1_WP_010908645_1_2091_MLBR_RS09930 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
NC_002677_1_NP_302324_1_1196_rpsK GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055 GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
**************************************
>NC_011896_1_WP_010908645_1_2091_MLBR_RS09930 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA AGCGCAGAAGAGTC >NC_002677_1_NP_302324_1_1196_rpsK ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA AGCGCAGAAGAGTC >NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA AGCGCAGAAGAGTC >NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA AGCGCAGAAGAGTC >NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA AGCGCAGAAGAGTC >NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055 ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA AGCGCAGAAGAGTC
>NC_011896_1_WP_010908645_1_2091_MLBR_RS09930 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV >NC_002677_1_NP_302324_1_1196_rpsK MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV >NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV >NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV >NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV >NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055 MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
#NEXUS
[ID: 0114877130]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908645_1_2091_MLBR_RS09930
NC_002677_1_NP_302324_1_1196_rpsK
NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470
NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780
NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760
NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908645_1_2091_MLBR_RS09930,
2 NC_002677_1_NP_302324_1_1196_rpsK,
3 NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470,
4 NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780,
5 NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760,
6 NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06786062,2:0.07164407,3:0.07145718,4:0.06655887,5:0.06760951,6:0.0682578);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06786062,2:0.07164407,3:0.07145718,4:0.06655887,5:0.06760951,6:0.0682578);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -561.79 -564.55
2 -561.80 -564.48
--------------------------------------
TOTAL -561.80 -564.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900469 0.091642 0.362885 1.505313 0.868586 1434.54 1467.77 1.000
r(A<->C){all} 0.154247 0.018992 0.000118 0.428590 0.115728 246.48 269.45 1.000
r(A<->G){all} 0.178361 0.022977 0.000142 0.475231 0.135672 108.38 141.92 1.001
r(A<->T){all} 0.163592 0.020634 0.000134 0.456268 0.122881 218.13 231.15 1.003
r(C<->G){all} 0.167818 0.020801 0.000026 0.463538 0.130353 164.87 170.11 1.000
r(C<->T){all} 0.160733 0.018906 0.000221 0.427914 0.123726 160.45 191.29 1.004
r(G<->T){all} 0.175249 0.021536 0.000010 0.467898 0.140266 220.50 243.88 1.001
pi(A){all} 0.234346 0.000410 0.196540 0.274301 0.234201 1059.22 1210.90 1.000
pi(C){all} 0.294037 0.000488 0.251645 0.338325 0.293779 1238.45 1246.98 1.000
pi(G){all} 0.315775 0.000488 0.272321 0.358050 0.315682 1278.26 1311.27 1.000
pi(T){all} 0.155842 0.000296 0.123502 0.190084 0.154929 1095.94 1239.19 1.000
alpha{1,2} 0.415954 0.225889 0.000114 1.396293 0.246486 1289.80 1297.84 1.000
alpha{3} 0.466469 0.246086 0.000302 1.437182 0.299127 1501.00 1501.00 1.000
pinvar{all} 0.996166 0.000022 0.987780 0.999999 0.997608 1062.92 1144.66 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpsK/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 138
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 0 0 0 0 0 0 | CCC 3 3 3 3 3 3 | CAC 3 3 3 3 3 3 | CGC 3 3 3 3 3 3
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 5 5 5 5 5 5 | CAG 7 7 7 7 7 7 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 4 4 4 4 4 4 | AAC 4 4 4 4 4 4 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 2 2 2 2 2 2
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 12 12 12 12 12 12 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 6 6 6 6 6 6 | Asp GAT 0 0 0 0 0 0 | Gly GGT 3 3 3 3 3 3
GTC 5 5 5 5 5 5 | GCC 3 3 3 3 3 3 | GAC 3 3 3 3 3 3 | GGC 8 8 8 8 8 8
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 1 1 1 1 1 1 | GGA 2 2 2 2 2 2
GTG 3 3 3 3 3 3 | GCG 6 6 6 6 6 6 | GAG 4 4 4 4 4 4 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908645_1_2091_MLBR_RS09930
position 1: T:0.10870 C:0.23188 A:0.29710 G:0.36232
position 2: T:0.18841 C:0.31159 A:0.29710 G:0.20290
position 3: T:0.16667 C:0.34058 A:0.10870 G:0.38406
Average T:0.15459 C:0.29469 A:0.23430 G:0.31643
#2: NC_002677_1_NP_302324_1_1196_rpsK
position 1: T:0.10870 C:0.23188 A:0.29710 G:0.36232
position 2: T:0.18841 C:0.31159 A:0.29710 G:0.20290
position 3: T:0.16667 C:0.34058 A:0.10870 G:0.38406
Average T:0.15459 C:0.29469 A:0.23430 G:0.31643
#3: NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470
position 1: T:0.10870 C:0.23188 A:0.29710 G:0.36232
position 2: T:0.18841 C:0.31159 A:0.29710 G:0.20290
position 3: T:0.16667 C:0.34058 A:0.10870 G:0.38406
Average T:0.15459 C:0.29469 A:0.23430 G:0.31643
#4: NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780
position 1: T:0.10870 C:0.23188 A:0.29710 G:0.36232
position 2: T:0.18841 C:0.31159 A:0.29710 G:0.20290
position 3: T:0.16667 C:0.34058 A:0.10870 G:0.38406
Average T:0.15459 C:0.29469 A:0.23430 G:0.31643
#5: NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760
position 1: T:0.10870 C:0.23188 A:0.29710 G:0.36232
position 2: T:0.18841 C:0.31159 A:0.29710 G:0.20290
position 3: T:0.16667 C:0.34058 A:0.10870 G:0.38406
Average T:0.15459 C:0.29469 A:0.23430 G:0.31643
#6: NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055
position 1: T:0.10870 C:0.23188 A:0.29710 G:0.36232
position 2: T:0.18841 C:0.31159 A:0.29710 G:0.20290
position 3: T:0.16667 C:0.34058 A:0.10870 G:0.38406
Average T:0.15459 C:0.29469 A:0.23430 G:0.31643
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 24 | TCC 0 | TAC 6 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 30 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 12
CTC 0 | CCC 18 | CAC 18 | CGC 18
CTA 6 | CCA 12 | Gln Q CAA 0 | CGA 0
CTG 6 | CCG 30 | CAG 42 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 18 | Ser S AGT 0
ATC 24 | ACC 24 | AAC 24 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 12 | Arg R AGA 12
Met M ATG 12 | ACG 6 | AAG 72 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 36 | Asp D GAT 0 | Gly G GGT 18
GTC 30 | GCC 18 | GAC 18 | GGC 48
GTA 6 | GCA 18 | Glu E GAA 6 | GGA 12
GTG 18 | GCG 36 | GAG 24 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10870 C:0.23188 A:0.29710 G:0.36232
position 2: T:0.18841 C:0.31159 A:0.29710 G:0.20290
position 3: T:0.16667 C:0.34058 A:0.10870 G:0.38406
Average T:0.15459 C:0.29469 A:0.23430 G:0.31643
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -541.834370 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300025 1.300033
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908645_1_2091_MLBR_RS09930: 0.000004, NC_002677_1_NP_302324_1_1196_rpsK: 0.000004, NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470: 0.000004, NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780: 0.000004, NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760: 0.000004, NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30003
omega (dN/dS) = 1.30003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 329.1 84.9 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 329.1 84.9 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 329.1 84.9 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 329.1 84.9 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 329.1 84.9 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 329.1 84.9 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -541.834372 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.290155 0.000042 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908645_1_2091_MLBR_RS09930: 0.000004, NC_002677_1_NP_302324_1_1196_rpsK: 0.000004, NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470: 0.000004, NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780: 0.000004, NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760: 0.000004, NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29015
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00004 0.99996
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 329.2 84.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 329.2 84.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 329.2 84.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 329.2 84.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 329.2 84.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 329.2 84.8 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -541.834344 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 77.075190 0.000000 1.000000 1.000000 58.505088
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908645_1_2091_MLBR_RS09930: 0.000004, NC_002677_1_NP_302324_1_1196_rpsK: 0.000004, NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470: 0.000004, NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780: 0.000004, NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760: 0.000004, NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 77.07519
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 1.00000 0.00000
w: 1.00000 1.00000 58.50509
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 305.3 108.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 305.3 108.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 305.3 108.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 305.3 108.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 305.3 108.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 305.3 108.7 1.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908645_1_2091_MLBR_RS09930)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -541.834450 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 77.075442 0.005041 1.088288
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908645_1_2091_MLBR_RS09930: 0.000004, NC_002677_1_NP_302324_1_1196_rpsK: 0.000004, NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470: 0.000004, NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780: 0.000004, NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760: 0.000004, NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 77.07544
Parameters in M7 (beta):
p = 0.00504 q = 1.08829
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 305.3 108.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 305.3 108.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 305.3 108.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 305.3 108.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 305.3 108.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 305.3 108.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -541.834338 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 77.075471 0.168470 0.005000 1.345409 1.524541
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908645_1_2091_MLBR_RS09930: 0.000004, NC_002677_1_NP_302324_1_1196_rpsK: 0.000004, NZ_LVXE01000050_1_WP_010908645_1_2122_A3216_RS11470: 0.000004, NZ_LYPH01000079_1_WP_010908645_1_2655_A8144_RS12780: 0.000004, NZ_CP029543_1_WP_010908645_1_2113_DIJ64_RS10760: 0.000004, NZ_AP014567_1_WP_010908645_1_2172_JK2ML_RS11055: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 77.07547
Parameters in M8 (beta&w>1):
p0 = 0.16847 p = 0.00500 q = 1.34541
(p1 = 0.83153) w = 1.52454
MLEs of dN/dS (w) for site classes (K=11)
p: 0.01685 0.01685 0.01685 0.01685 0.01685 0.01685 0.01685 0.01685 0.01685 0.01685 0.83153
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.52454
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 305.3 108.7 1.2677 0.0000 0.0000 0.0 0.0
7..2 0.000 305.3 108.7 1.2677 0.0000 0.0000 0.0 0.0
7..3 0.000 305.3 108.7 1.2677 0.0000 0.0000 0.0 0.0
7..4 0.000 305.3 108.7 1.2677 0.0000 0.0000 0.0 0.0
7..5 0.000 305.3 108.7 1.2677 0.0000 0.0000 0.0 0.0
7..6 0.000 305.3 108.7 1.2677 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908645_1_2091_MLBR_RS09930)
Pr(w>1) post mean +- SE for w
1 M 0.832 1.268
2 P 0.832 1.268
3 P 0.832 1.268
4 K 0.832 1.268
5 K 0.832 1.268
6 A 0.832 1.268
7 N 0.832 1.268
8 A 0.832 1.268
9 A 0.832 1.268
10 G 0.832 1.268
11 P 0.832 1.268
12 K 0.832 1.268
13 K 0.832 1.268
14 G 0.832 1.268
15 Q 0.832 1.268
16 K 0.832 1.268
17 T 0.832 1.268
18 R 0.832 1.268
19 K 0.832 1.268
20 R 0.832 1.268
21 E 0.832 1.268
22 K 0.832 1.268
23 K 0.832 1.268
24 N 0.832 1.268
25 I 0.832 1.268
26 P 0.832 1.268
27 Y 0.832 1.268
28 G 0.832 1.268
29 A 0.832 1.268
30 A 0.832 1.268
31 H 0.832 1.268
32 I 0.832 1.268
33 K 0.832 1.268
34 S 0.832 1.268
35 T 0.832 1.268
36 F 0.832 1.268
37 N 0.832 1.268
38 N 0.832 1.268
39 T 0.832 1.268
40 I 0.832 1.268
41 V 0.832 1.268
42 T 0.832 1.268
43 I 0.832 1.268
44 T 0.832 1.268
45 D 0.832 1.268
46 Q 0.832 1.268
47 Q 0.832 1.268
48 G 0.832 1.268
49 N 0.832 1.268
50 V 0.832 1.268
51 I 0.832 1.268
52 A 0.832 1.268
53 W 0.832 1.268
54 A 0.832 1.268
55 S 0.832 1.268
56 S 0.832 1.268
57 G 0.832 1.268
58 H 0.832 1.268
59 V 0.832 1.268
60 G 0.832 1.268
61 F 0.832 1.268
62 K 0.832 1.268
63 G 0.832 1.268
64 S 0.832 1.268
65 R 0.832 1.268
66 K 0.832 1.268
67 S 0.832 1.268
68 T 0.832 1.268
69 P 0.832 1.268
70 F 0.832 1.268
71 A 0.832 1.268
72 A 0.832 1.268
73 Q 0.832 1.268
74 L 0.832 1.268
75 A 0.832 1.268
76 A 0.832 1.268
77 E 0.832 1.268
78 N 0.832 1.268
79 A 0.832 1.268
80 A 0.832 1.268
81 R 0.832 1.268
82 K 0.832 1.268
83 A 0.832 1.268
84 Q 0.832 1.268
85 E 0.832 1.268
86 H 0.832 1.268
87 G 0.832 1.268
88 V 0.832 1.268
89 R 0.832 1.268
90 K 0.832 1.268
91 V 0.832 1.268
92 D 0.832 1.268
93 V 0.832 1.268
94 F 0.832 1.268
95 V 0.832 1.268
96 M 0.832 1.268
97 G 0.832 1.268
98 P 0.832 1.268
99 G 0.832 1.268
100 S 0.832 1.268
101 G 0.832 1.268
102 R 0.832 1.268
103 E 0.832 1.268
104 T 0.832 1.268
105 A 0.832 1.268
106 I 0.832 1.268
107 R 0.832 1.268
108 S 0.832 1.268
109 L 0.832 1.268
110 Q 0.832 1.268
111 A 0.832 1.268
112 A 0.832 1.268
113 G 0.832 1.268
114 L 0.832 1.268
115 E 0.832 1.268
116 V 0.832 1.268
117 G 0.832 1.268
118 A 0.832 1.268
119 I 0.832 1.268
120 S 0.832 1.268
121 D 0.832 1.268
122 V 0.832 1.268
123 T 0.832 1.268
124 P 0.832 1.268
125 Q 0.832 1.268
126 P 0.832 1.268
127 H 0.832 1.268
128 N 0.832 1.268
129 G 0.832 1.268
130 C 0.832 1.268
131 R 0.832 1.268
132 P 0.832 1.268
133 P 0.832 1.268
134 K 0.832 1.268
135 R 0.832 1.268
136 R 0.832 1.268
137 R 0.832 1.268
138 V 0.832 1.268
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908645_1_2091_MLBR_RS09930)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -541.834372 Model 2: PositiveSelection -541.834344 Model 0: one-ratio -541.83437 Model 7: beta -541.83445 Model 8: beta&w>1 -541.834338 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 5.600000008598727E-5 Model 8 vs 7 2.2399999988920172E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
