--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:24:24 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsK/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -561.79          -564.55
2       -561.80          -564.48
--------------------------------------
TOTAL     -561.80          -564.51
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.900469    0.091642    0.362885    1.505313    0.868586   1434.54   1467.77    1.000
r(A<->C){all}   0.154247    0.018992    0.000118    0.428590    0.115728    246.48    269.45    1.000
r(A<->G){all}   0.178361    0.022977    0.000142    0.475231    0.135672    108.38    141.92    1.001
r(A<->T){all}   0.163592    0.020634    0.000134    0.456268    0.122881    218.13    231.15    1.003
r(C<->G){all}   0.167818    0.020801    0.000026    0.463538    0.130353    164.87    170.11    1.000
r(C<->T){all}   0.160733    0.018906    0.000221    0.427914    0.123726    160.45    191.29    1.004
r(G<->T){all}   0.175249    0.021536    0.000010    0.467898    0.140266    220.50    243.88    1.001
pi(A){all}      0.234346    0.000410    0.196540    0.274301    0.234201   1059.22   1210.90    1.000
pi(C){all}      0.294037    0.000488    0.251645    0.338325    0.293779   1238.45   1246.98    1.000
pi(G){all}      0.315775    0.000488    0.272321    0.358050    0.315682   1278.26   1311.27    1.000
pi(T){all}      0.155842    0.000296    0.123502    0.190084    0.154929   1095.94   1239.19    1.000
alpha{1,2}      0.415954    0.225889    0.000114    1.396293    0.246486   1289.80   1297.84    1.000
alpha{3}        0.466469    0.246086    0.000302    1.437182    0.299127   1501.00   1501.00    1.000
pinvar{all}     0.996166    0.000022    0.987780    0.999999    0.997608   1062.92   1144.66    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-541.834372
Model 2: PositiveSelection	-541.834344
Model 0: one-ratio	-541.83437
Model 7: beta	-541.83445
Model 8: beta&w>1	-541.834338


Model 0 vs 1	3.999999989900971E-6

Model 2 vs 1	5.600000008598727E-5

Model 8 vs 7	2.2399999988920172E-4
>C1
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C2
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C3
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C4
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C5
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C6
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=138 

C1              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C2              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C3              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C4              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C5              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C6              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
                **************************************************

C1              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C2              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C3              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C4              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C5              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C6              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
                **************************************************

C1              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C2              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C3              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C4              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C5              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C6              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
                **************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  138 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  138 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4140]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4140]--->[4140]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.464 Mb, Max= 30.670 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C2              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C3              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C4              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C5              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
C6              MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
                **************************************************

C1              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C2              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C3              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C4              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C5              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
C6              IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
                **************************************************

C1              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C2              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C3              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C4              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C5              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
C6              GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
                **************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
C2              ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
C3              ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
C4              ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
C5              ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
C6              ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
                **************************************************

C1              CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
C2              CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
C3              CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
C4              CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
C5              CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
C6              CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
                **************************************************

C1              GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
C2              GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
C3              GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
C4              GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
C5              GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
C6              GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
                **************************************************

C1              ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
C2              ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
C3              ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
C4              ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
C5              ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
C6              ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
                **************************************************

C1              GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
C2              GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
C3              GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
C4              GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
C5              GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
C6              GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
                **************************************************

C1              AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
C2              AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
C3              AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
C4              AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
C5              AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
C6              AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
                **************************************************

C1              GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
C2              GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
C3              GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
C4              GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
C5              GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
C6              GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
                **************************************************

C1              CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
C2              CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
C3              CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
C4              CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
C5              CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
C6              CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
                **************************************************

C1              AGCGCAGAAGAGTC
C2              AGCGCAGAAGAGTC
C3              AGCGCAGAAGAGTC
C4              AGCGCAGAAGAGTC
C5              AGCGCAGAAGAGTC
C6              AGCGCAGAAGAGTC
                **************



>C1
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C2
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C3
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C4
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C5
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C6
ATGCCGCCGAAGAAGGCAAACGCAGCGGGTCCCAAGAAGGGACAGAAGAC
CCGTAAGCGGGAAAAGAAGAATATCCCATACGGTGCTGCGCATATTAAGA
GCACCTTCAACAATACGATCGTGACCATTACTGACCAGCAGGGTAACGTC
ATTGCCTGGGCGTCATCGGGCCACGTTGGCTTCAAAGGATCGCGGAAATC
GACTCCGTTCGCCGCGCAGTTGGCTGCTGAGAACGCCGCACGCAAGGCTC
AGGAGCACGGGGTGCGCAAGGTCGACGTATTCGTGATGGGCCCGGGCTCG
GGCCGGGAGACTGCGATCCGGTCGCTGCAGGCTGCTGGCCTAGAGGTCGG
CGCGATCTCTGACGTCACCCCCCAGCCGCACAATGGCTGCCGTCCACCCA
AGCGCAGAAGAGTC
>C1
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C2
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C3
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C4
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C5
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
>C6
MPPKKANAAGPKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVMGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 414 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579792986
      Setting output file names to "/data/11res/rpsK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 621566746
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0114877130
      Seed = 2034274178
      Swapseed = 1579792986
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -926.551850 -- -24.965149
         Chain 2 -- -926.551797 -- -24.965149
         Chain 3 -- -926.551850 -- -24.965149
         Chain 4 -- -926.551850 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -926.551850 -- -24.965149
         Chain 2 -- -926.551850 -- -24.965149
         Chain 3 -- -926.551797 -- -24.965149
         Chain 4 -- -926.551850 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-926.552] (-926.552) (-926.552) (-926.552) * [-926.552] (-926.552) (-926.552) (-926.552) 
        500 -- [-574.538] (-573.644) (-582.016) (-577.976) * (-571.878) (-571.066) [-566.307] (-571.189) -- 0:00:00
       1000 -- (-578.151) (-567.192) (-568.767) [-572.563] * (-574.784) [-582.127] (-574.341) (-576.657) -- 0:00:00
       1500 -- (-572.036) [-571.653] (-566.849) (-572.694) * (-565.256) (-570.331) (-582.216) [-569.354] -- 0:00:00
       2000 -- (-568.206) (-570.697) (-572.441) [-571.469] * (-569.479) (-582.308) [-571.403] (-573.441) -- 0:00:00
       2500 -- (-572.693) (-567.070) (-571.556) [-569.291] * (-570.782) (-569.978) [-572.454] (-575.265) -- 0:00:00
       3000 -- (-575.558) (-570.922) [-575.586] (-571.800) * (-576.089) (-569.299) [-569.079] (-566.504) -- 0:00:00
       3500 -- (-573.775) (-571.069) [-577.926] (-572.387) * (-578.573) (-577.817) [-571.860] (-569.434) -- 0:00:00
       4000 -- (-574.503) (-583.182) [-574.795] (-573.776) * [-568.319] (-579.225) (-580.614) (-568.730) -- 0:00:00
       4500 -- (-575.684) (-574.389) (-569.752) [-570.129] * (-572.923) (-573.281) [-576.817] (-577.173) -- 0:00:00
       5000 -- (-575.281) [-569.217] (-577.262) (-570.922) * (-575.282) (-571.695) (-577.084) [-580.873] -- 0:00:00

      Average standard deviation of split frequencies: 0.119722

       5500 -- (-579.747) [-566.181] (-572.109) (-573.547) * (-567.551) (-577.852) (-571.219) [-571.892] -- 0:00:00
       6000 -- (-579.754) [-571.771] (-568.845) (-573.976) * [-563.496] (-573.983) (-566.899) (-572.291) -- 0:02:45
       6500 -- (-574.768) (-567.433) (-583.453) [-575.455] * [-568.189] (-578.003) (-578.990) (-569.885) -- 0:02:32
       7000 -- (-579.170) (-570.715) [-572.769] (-569.664) * [-568.091] (-573.608) (-572.418) (-579.906) -- 0:02:21
       7500 -- [-567.519] (-570.547) (-572.602) (-571.607) * (-581.036) (-569.075) (-576.636) [-573.624] -- 0:02:12
       8000 -- [-565.867] (-579.741) (-569.638) (-575.698) * (-570.310) (-570.556) [-573.221] (-575.097) -- 0:02:04
       8500 -- (-567.160) [-571.494] (-575.109) (-573.622) * [-570.117] (-575.883) (-578.540) (-579.737) -- 0:01:56
       9000 -- (-581.211) [-580.693] (-569.309) (-575.544) * [-566.570] (-568.394) (-571.680) (-573.853) -- 0:01:50
       9500 -- (-570.859) [-573.000] (-568.360) (-580.821) * (-570.523) [-572.151] (-574.604) (-574.478) -- 0:01:44
      10000 -- (-575.208) (-569.786) [-571.756] (-588.355) * (-568.439) (-573.803) [-571.928] (-574.777) -- 0:01:39

      Average standard deviation of split frequencies: 0.061872

      10500 -- [-569.307] (-570.747) (-572.208) (-564.294) * (-574.424) (-571.373) (-572.485) [-563.884] -- 0:01:34
      11000 -- (-568.805) (-568.973) [-573.513] (-568.068) * (-572.797) (-570.174) (-573.278) [-562.724] -- 0:01:29
      11500 -- [-567.419] (-571.228) (-571.441) (-563.302) * (-571.434) (-567.697) (-578.025) [-562.205] -- 0:01:25
      12000 -- (-566.364) (-575.534) [-571.068] (-561.543) * [-575.925] (-570.496) (-572.974) (-560.785) -- 0:01:22
      12500 -- (-565.578) (-567.371) [-573.253] (-567.157) * [-569.041] (-571.270) (-575.112) (-560.754) -- 0:01:19
      13000 -- (-563.508) [-572.917] (-565.793) (-568.983) * (-569.977) (-571.930) [-570.379] (-560.617) -- 0:01:15
      13500 -- (-563.252) (-574.938) (-577.771) [-561.405] * (-570.143) (-570.635) [-569.104] (-564.511) -- 0:01:13
      14000 -- (-562.807) (-576.135) [-571.638] (-561.489) * [-572.160] (-571.909) (-572.788) (-563.917) -- 0:01:10
      14500 -- (-561.081) (-572.116) (-568.865) [-562.740] * (-575.880) (-575.266) [-567.238] (-562.614) -- 0:01:07
      15000 -- (-564.862) [-573.756] (-565.324) (-561.709) * [-572.390] (-577.023) (-563.613) (-562.094) -- 0:01:05

      Average standard deviation of split frequencies: 0.057375

      15500 -- (-564.366) (-582.213) [-574.034] (-565.360) * (-577.005) [-577.290] (-563.193) (-561.847) -- 0:01:03
      16000 -- (-562.382) [-569.744] (-573.540) (-567.327) * (-575.466) (-576.941) (-561.779) [-564.138] -- 0:01:01
      16500 -- (-562.207) [-569.666] (-571.546) (-562.243) * (-574.815) [-571.784] (-562.463) (-563.859) -- 0:00:59
      17000 -- (-562.009) (-570.887) [-571.822] (-561.172) * [-568.837] (-572.752) (-562.806) (-561.452) -- 0:00:57
      17500 -- (-563.812) [-576.697] (-573.837) (-563.106) * (-571.036) (-575.642) [-565.150] (-562.222) -- 0:00:56
      18000 -- (-566.104) (-585.096) [-569.898] (-565.632) * [-572.606] (-572.893) (-565.200) (-562.360) -- 0:01:49
      18500 -- (-570.159) (-577.533) (-573.428) [-560.782] * (-564.536) (-565.029) [-561.845] (-562.145) -- 0:01:46
      19000 -- (-564.835) (-573.831) [-574.279] (-561.242) * (-578.746) (-563.297) (-561.488) [-561.473] -- 0:01:43
      19500 -- (-563.709) (-571.322) (-575.463) [-560.891] * [-567.087] (-561.934) (-561.724) (-562.426) -- 0:01:40
      20000 -- (-568.325) (-579.423) (-570.383) [-563.641] * (-574.570) (-563.919) (-561.883) [-562.500] -- 0:01:38

      Average standard deviation of split frequencies: 0.056424

      20500 -- (-563.429) (-582.792) [-575.769] (-562.072) * (-568.250) (-562.767) (-561.875) [-561.915] -- 0:01:35
      21000 -- (-569.582) (-569.830) [-575.209] (-564.450) * (-577.390) (-565.107) (-561.441) [-562.055] -- 0:01:33
      21500 -- (-565.124) (-579.802) (-574.044) [-563.768] * [-570.718] (-566.722) (-560.718) (-560.466) -- 0:01:31
      22000 -- (-564.246) (-577.459) (-571.557) [-563.526] * (-574.949) (-561.422) [-563.460] (-562.667) -- 0:01:28
      22500 -- (-562.142) [-572.970] (-577.144) (-560.734) * (-566.174) (-563.235) [-560.807] (-572.491) -- 0:01:26
      23000 -- [-561.317] (-575.549) (-573.560) (-563.481) * [-565.826] (-566.209) (-560.515) (-571.209) -- 0:01:24
      23500 -- [-561.466] (-561.770) (-573.989) (-561.738) * [-581.522] (-562.521) (-561.132) (-562.105) -- 0:01:23
      24000 -- (-565.848) (-564.072) (-568.434) [-561.685] * (-572.453) (-562.238) (-561.935) [-562.570] -- 0:01:21
      24500 -- (-562.795) (-564.347) [-562.454] (-562.389) * (-570.809) [-563.048] (-562.591) (-560.972) -- 0:01:19
      25000 -- (-565.490) (-562.754) (-562.171) [-560.861] * (-571.618) (-563.793) (-564.310) [-563.365] -- 0:01:18

      Average standard deviation of split frequencies: 0.049663

      25500 -- (-562.844) [-564.618] (-564.984) (-564.271) * [-569.410] (-566.110) (-561.698) (-562.976) -- 0:01:16
      26000 -- (-562.563) (-570.613) [-561.614] (-560.719) * (-579.179) (-565.922) (-561.957) [-563.360] -- 0:01:14
      26500 -- [-561.711] (-565.453) (-563.433) (-562.872) * (-575.968) [-564.864] (-561.720) (-562.106) -- 0:01:13
      27000 -- (-564.457) [-564.458] (-561.985) (-563.895) * (-583.651) [-562.590] (-562.059) (-562.346) -- 0:01:12
      27500 -- (-571.690) (-563.863) (-566.099) [-563.086] * (-582.110) (-562.483) [-560.627] (-564.588) -- 0:01:10
      28000 -- [-564.397] (-563.870) (-566.547) (-563.231) * (-581.295) [-561.105] (-560.594) (-562.943) -- 0:01:09
      28500 -- (-565.643) (-561.816) [-562.012] (-563.678) * (-577.146) (-564.514) [-560.515] (-566.206) -- 0:01:08
      29000 -- (-565.509) [-562.585] (-563.843) (-563.157) * (-560.926) [-563.679] (-563.936) (-562.403) -- 0:01:06
      29500 -- (-562.731) (-561.821) [-561.923] (-563.722) * (-561.871) (-563.959) [-561.013] (-563.775) -- 0:01:05
      30000 -- [-561.266] (-562.757) (-562.093) (-561.034) * (-561.634) (-564.999) [-561.472] (-562.396) -- 0:01:04

      Average standard deviation of split frequencies: 0.045307

      30500 -- (-561.418) (-563.382) [-563.456] (-562.150) * (-561.363) (-564.149) (-566.672) [-561.872] -- 0:01:03
      31000 -- (-563.773) [-562.994] (-561.369) (-564.937) * (-562.746) (-564.961) (-563.587) [-562.154] -- 0:01:02
      31500 -- (-563.457) [-560.732] (-560.762) (-561.759) * (-563.584) (-563.192) (-561.671) [-561.890] -- 0:01:32
      32000 -- (-561.220) (-562.362) (-564.063) [-562.929] * (-565.960) [-565.163] (-563.858) (-562.072) -- 0:01:30
      32500 -- (-562.691) [-562.999] (-563.537) (-561.142) * (-566.600) [-560.909] (-566.073) (-561.978) -- 0:01:29
      33000 -- (-565.870) (-561.937) (-562.667) [-561.858] * (-562.959) (-561.887) (-563.541) [-561.388] -- 0:01:27
      33500 -- (-561.043) [-561.950] (-563.452) (-560.981) * [-562.595] (-564.135) (-562.492) (-561.506) -- 0:01:26
      34000 -- [-560.535] (-564.240) (-561.485) (-565.331) * [-565.209] (-562.135) (-564.389) (-566.734) -- 0:01:25
      34500 -- [-561.664] (-566.488) (-563.128) (-564.194) * (-562.499) [-562.717] (-563.976) (-560.560) -- 0:01:23
      35000 -- (-563.226) (-561.949) (-562.861) [-561.729] * (-562.004) (-562.866) [-561.937] (-562.207) -- 0:01:22

      Average standard deviation of split frequencies: 0.033391

      35500 -- (-565.157) (-565.695) [-564.956] (-561.064) * (-564.269) (-565.948) (-563.319) [-562.054] -- 0:01:21
      36000 -- (-567.704) [-562.486] (-563.816) (-562.954) * (-564.070) (-564.650) [-563.052] (-561.438) -- 0:01:20
      36500 -- (-566.011) [-563.587] (-564.927) (-561.155) * (-562.884) [-564.819] (-560.901) (-560.579) -- 0:01:19
      37000 -- [-562.320] (-561.620) (-563.164) (-561.111) * (-562.876) (-563.970) [-561.828] (-560.657) -- 0:01:18
      37500 -- [-563.995] (-560.656) (-568.026) (-561.234) * (-563.469) (-562.382) (-561.772) [-562.475] -- 0:01:17
      38000 -- [-563.909] (-564.978) (-565.850) (-560.959) * (-562.958) (-562.378) (-560.739) [-562.972] -- 0:01:15
      38500 -- [-563.835] (-561.489) (-561.535) (-562.779) * (-562.953) (-560.800) [-561.830] (-560.561) -- 0:01:14
      39000 -- (-560.559) (-561.769) [-563.489] (-563.739) * [-566.778] (-562.998) (-564.258) (-561.602) -- 0:01:13
      39500 -- (-564.994) [-562.563] (-561.420) (-562.737) * (-565.053) [-562.384] (-563.663) (-563.001) -- 0:01:12
      40000 -- (-562.481) (-561.386) [-561.182] (-565.128) * (-564.333) (-561.090) [-561.287] (-562.288) -- 0:01:12

      Average standard deviation of split frequencies: 0.036606

      40500 -- (-563.364) [-561.761] (-566.320) (-563.873) * [-563.268] (-562.046) (-560.977) (-560.249) -- 0:01:11
      41000 -- [-564.841] (-563.235) (-563.022) (-562.023) * [-561.360] (-562.224) (-564.181) (-561.374) -- 0:01:10
      41500 -- (-560.828) (-564.374) (-561.820) [-562.027] * (-560.732) (-562.057) [-566.541] (-560.977) -- 0:01:09
      42000 -- (-560.264) (-562.902) [-563.085] (-562.003) * (-561.255) [-562.831] (-561.973) (-560.198) -- 0:01:08
      42500 -- (-560.770) [-562.953] (-564.290) (-562.559) * (-566.170) (-563.991) [-561.376] (-562.324) -- 0:01:07
      43000 -- [-560.415] (-561.712) (-560.901) (-563.438) * (-562.921) (-564.425) (-563.184) [-562.870] -- 0:01:06
      43500 -- [-560.582] (-560.863) (-561.651) (-561.802) * [-561.555] (-562.796) (-561.621) (-561.868) -- 0:01:05
      44000 -- (-560.445) (-560.386) [-561.946] (-561.952) * (-564.964) (-561.502) (-561.724) [-562.974] -- 0:01:05
      44500 -- (-561.823) (-563.934) [-562.553] (-563.136) * (-562.193) (-562.215) [-564.467] (-561.709) -- 0:01:04
      45000 -- (-562.321) (-564.062) [-562.014] (-565.780) * (-562.428) [-563.158] (-567.485) (-561.502) -- 0:01:03

      Average standard deviation of split frequencies: 0.036677

      45500 -- [-562.583] (-563.298) (-561.931) (-560.186) * (-565.550) (-561.174) (-563.746) [-560.380] -- 0:01:02
      46000 -- (-561.478) (-568.053) [-562.192] (-561.807) * (-563.643) (-566.344) [-564.490] (-561.758) -- 0:01:02
      46500 -- (-564.474) (-564.288) (-562.325) [-561.808] * (-562.387) (-560.545) [-564.264] (-562.141) -- 0:01:01
      47000 -- (-565.624) (-563.560) (-562.221) [-562.439] * (-563.375) [-560.736] (-564.127) (-563.187) -- 0:01:00
      47500 -- (-570.378) [-563.416] (-562.655) (-560.642) * (-561.697) (-560.731) [-564.119] (-565.606) -- 0:01:00
      48000 -- (-564.831) (-562.598) (-561.818) [-560.853] * (-563.024) [-563.684] (-565.304) (-566.239) -- 0:01:19
      48500 -- (-562.465) (-563.923) [-560.330] (-563.489) * (-567.228) [-562.614] (-568.699) (-562.391) -- 0:01:18
      49000 -- (-562.240) (-563.046) (-561.998) [-562.154] * (-562.146) (-561.126) (-562.341) [-560.469] -- 0:01:17
      49500 -- (-565.440) (-562.487) [-565.823] (-561.670) * [-560.423] (-560.707) (-565.609) (-562.775) -- 0:01:16
      50000 -- [-565.405] (-564.444) (-563.521) (-563.549) * (-560.642) (-561.153) (-565.613) [-564.685] -- 0:01:16

      Average standard deviation of split frequencies: 0.030238

      50500 -- (-561.910) (-562.910) [-563.058] (-561.834) * (-561.508) (-562.288) (-564.546) [-560.947] -- 0:01:15
      51000 -- [-562.302] (-563.616) (-569.311) (-562.497) * (-562.062) [-565.782] (-567.704) (-560.662) -- 0:01:14
      51500 -- (-564.521) [-562.610] (-564.528) (-563.965) * (-561.676) [-561.932] (-563.187) (-560.956) -- 0:01:13
      52000 -- (-561.483) [-560.483] (-564.473) (-561.009) * [-562.639] (-563.010) (-561.550) (-562.209) -- 0:01:12
      52500 -- (-561.419) [-564.285] (-562.224) (-562.238) * (-561.495) [-564.146] (-562.531) (-565.552) -- 0:01:12
      53000 -- (-565.068) (-560.773) [-561.278] (-560.650) * (-563.485) [-563.159] (-562.157) (-563.165) -- 0:01:11
      53500 -- (-564.713) [-561.140] (-561.306) (-560.349) * (-565.108) (-561.922) (-564.093) [-563.385] -- 0:01:10
      54000 -- (-565.621) (-564.854) [-561.674] (-562.278) * (-561.073) [-560.831] (-562.310) (-561.636) -- 0:01:10
      54500 -- [-562.299] (-562.372) (-562.634) (-562.026) * (-562.712) (-562.201) (-561.368) [-562.672] -- 0:01:09
      55000 -- (-562.538) [-564.753] (-562.462) (-561.342) * [-561.428] (-564.776) (-561.917) (-562.208) -- 0:01:08

      Average standard deviation of split frequencies: 0.031146

      55500 -- (-563.379) (-560.943) [-562.047] (-562.325) * [-560.924] (-562.472) (-563.690) (-563.811) -- 0:01:08
      56000 -- (-566.225) [-562.185] (-562.271) (-561.423) * [-562.305] (-560.443) (-561.683) (-570.731) -- 0:01:07
      56500 -- (-563.766) [-561.665] (-563.159) (-560.699) * (-565.067) [-561.270] (-565.215) (-564.851) -- 0:01:06
      57000 -- (-561.307) [-560.549] (-560.709) (-562.389) * (-564.842) (-563.680) (-564.704) [-566.734] -- 0:01:06
      57500 -- (-560.985) (-562.056) [-562.872] (-560.856) * (-565.798) [-562.838] (-562.461) (-561.644) -- 0:01:05
      58000 -- [-561.840] (-563.232) (-564.099) (-561.665) * (-560.891) [-562.784] (-560.760) (-561.493) -- 0:01:04
      58500 -- [-561.950] (-560.965) (-566.399) (-561.611) * (-563.052) [-561.910] (-562.842) (-566.401) -- 0:01:04
      59000 -- [-562.263] (-565.711) (-562.218) (-561.650) * [-562.955] (-561.229) (-561.458) (-561.957) -- 0:01:03
      59500 -- [-562.175] (-564.990) (-561.118) (-560.996) * (-562.894) (-561.262) (-565.011) [-561.063] -- 0:01:03
      60000 -- (-561.892) (-563.649) (-561.015) [-561.643] * (-564.876) (-560.748) [-561.346] (-562.524) -- 0:01:02

      Average standard deviation of split frequencies: 0.030264

      60500 -- (-561.564) (-562.357) [-560.800] (-560.939) * (-563.460) (-563.153) [-563.141] (-560.648) -- 0:01:02
      61000 -- (-566.653) (-563.005) [-568.825] (-565.788) * (-563.457) (-562.346) [-562.396] (-565.620) -- 0:01:01
      61500 -- [-566.389] (-563.413) (-564.646) (-562.933) * (-562.027) (-563.926) [-562.260] (-562.293) -- 0:01:01
      62000 -- (-566.629) (-567.001) (-562.664) [-561.371] * (-562.727) [-562.446] (-562.363) (-564.738) -- 0:01:00
      62500 -- (-564.235) (-562.008) [-561.486] (-561.483) * [-562.391] (-562.302) (-562.047) (-562.896) -- 0:01:00
      63000 -- [-562.946] (-561.879) (-565.384) (-562.138) * [-561.958] (-566.023) (-561.208) (-561.244) -- 0:00:59
      63500 -- [-561.585] (-564.354) (-560.717) (-562.464) * (-565.609) (-561.551) [-564.121] (-564.255) -- 0:00:58
      64000 -- [-561.734] (-563.055) (-562.209) (-562.748) * (-562.264) (-560.942) (-563.048) [-564.170] -- 0:00:58
      64500 -- (-561.681) (-562.368) (-565.001) [-564.720] * (-561.962) (-561.986) [-561.387] (-563.685) -- 0:01:12
      65000 -- (-561.254) (-562.137) (-562.138) [-564.157] * (-560.702) (-563.888) [-565.538] (-563.847) -- 0:01:11

      Average standard deviation of split frequencies: 0.032311

      65500 -- (-560.826) (-561.538) (-562.491) [-564.211] * (-560.390) (-566.096) (-568.096) [-563.638] -- 0:01:11
      66000 -- (-560.952) (-563.265) [-561.105] (-563.039) * (-560.932) [-561.741] (-561.491) (-565.354) -- 0:01:10
      66500 -- (-561.627) (-562.189) (-564.112) [-562.323] * (-566.247) (-562.550) [-560.897] (-563.353) -- 0:01:10
      67000 -- [-563.593] (-569.352) (-564.187) (-560.977) * (-561.917) [-560.294] (-561.284) (-560.434) -- 0:01:09
      67500 -- [-562.179] (-566.933) (-562.964) (-561.629) * (-561.479) (-565.309) [-562.046] (-561.477) -- 0:01:09
      68000 -- (-561.464) (-564.185) (-562.672) [-561.506] * (-562.562) (-564.216) (-560.598) [-562.700] -- 0:01:08
      68500 -- (-563.695) (-561.045) [-563.679] (-562.287) * [-562.625] (-566.645) (-561.874) (-562.229) -- 0:01:07
      69000 -- [-561.328] (-560.918) (-565.178) (-561.107) * (-561.700) (-566.616) [-560.506] (-562.475) -- 0:01:07
      69500 -- (-560.871) (-562.660) [-561.911] (-563.248) * (-563.344) (-560.671) [-561.117] (-562.301) -- 0:01:06
      70000 -- [-562.397] (-563.774) (-561.376) (-562.159) * (-564.754) (-561.794) [-560.822] (-565.310) -- 0:01:06

      Average standard deviation of split frequencies: 0.030813

      70500 -- [-563.201] (-564.002) (-561.389) (-562.381) * [-561.835] (-567.895) (-563.734) (-565.128) -- 0:01:05
      71000 -- (-562.398) (-562.719) (-560.546) [-563.938] * [-561.587] (-564.460) (-561.943) (-562.380) -- 0:01:05
      71500 -- [-562.804] (-561.557) (-560.760) (-563.443) * (-566.965) [-562.859] (-560.746) (-562.763) -- 0:01:04
      72000 -- (-561.283) [-560.245] (-561.945) (-562.645) * (-563.577) (-562.130) (-561.186) [-564.361] -- 0:01:04
      72500 -- [-563.552] (-562.651) (-562.495) (-563.561) * (-566.239) (-562.685) [-565.004] (-562.874) -- 0:01:03
      73000 -- (-563.368) (-560.854) (-562.154) [-561.807] * [-562.405] (-568.484) (-560.574) (-561.076) -- 0:01:03
      73500 -- (-563.363) [-562.405] (-565.343) (-563.627) * [-560.696] (-565.944) (-560.575) (-564.554) -- 0:01:03
      74000 -- (-563.619) (-561.660) (-562.294) [-562.579] * [-562.774] (-566.990) (-563.351) (-568.482) -- 0:01:02
      74500 -- (-566.174) [-570.424] (-567.730) (-563.412) * [-563.884] (-565.720) (-564.351) (-561.799) -- 0:01:02
      75000 -- (-563.833) (-562.640) [-564.783] (-565.599) * [-560.594] (-572.769) (-567.903) (-560.584) -- 0:01:01

      Average standard deviation of split frequencies: 0.031324

      75500 -- [-563.826] (-561.973) (-560.725) (-560.678) * [-561.367] (-563.342) (-561.700) (-562.994) -- 0:01:01
      76000 -- (-565.143) (-562.102) [-561.779] (-562.210) * (-562.677) (-562.986) (-562.399) [-561.986] -- 0:01:00
      76500 -- [-564.870] (-564.108) (-562.032) (-561.093) * (-562.399) (-563.492) [-560.889] (-566.237) -- 0:01:00
      77000 -- (-562.123) (-563.624) [-561.386] (-562.420) * (-562.504) [-563.127] (-566.715) (-562.122) -- 0:00:59
      77500 -- (-564.883) (-561.916) [-561.817] (-564.225) * (-561.365) (-562.241) (-566.118) [-560.735] -- 0:00:59
      78000 -- [-563.416] (-560.907) (-566.816) (-563.729) * (-565.258) (-564.445) [-563.407] (-560.481) -- 0:00:59
      78500 -- (-560.753) (-560.538) [-561.650] (-564.830) * (-566.564) (-564.659) (-563.010) [-561.047] -- 0:00:58
      79000 -- [-562.624] (-565.252) (-562.823) (-565.193) * (-565.323) [-560.923] (-564.940) (-561.019) -- 0:00:58
      79500 -- (-563.304) (-562.669) [-563.470] (-561.572) * [-565.076] (-561.823) (-561.791) (-562.395) -- 0:00:57
      80000 -- (-563.348) (-562.597) (-563.423) [-561.671] * (-561.734) [-562.608] (-564.361) (-562.354) -- 0:00:57

      Average standard deviation of split frequencies: 0.026297

      80500 -- (-566.204) (-562.073) (-562.713) [-560.717] * (-561.114) [-560.484] (-562.154) (-562.969) -- 0:00:57
      81000 -- (-562.622) (-561.328) (-563.845) [-560.925] * (-562.468) [-561.272] (-561.644) (-561.832) -- 0:01:08
      81500 -- (-561.744) (-566.103) [-561.828] (-562.753) * (-561.613) (-561.874) [-562.377] (-562.293) -- 0:01:07
      82000 -- (-561.206) (-567.849) [-561.317] (-563.118) * [-560.235] (-561.548) (-560.937) (-563.418) -- 0:01:07
      82500 -- (-562.253) (-564.066) (-560.873) [-561.860] * [-560.769] (-561.130) (-561.961) (-561.699) -- 0:01:06
      83000 -- (-566.999) [-562.263] (-561.072) (-561.877) * (-560.777) (-562.948) [-561.414] (-561.176) -- 0:01:06
      83500 -- (-564.258) (-563.231) (-569.444) [-563.158] * (-560.556) [-564.663] (-561.284) (-561.042) -- 0:01:05
      84000 -- [-562.136] (-564.783) (-562.376) (-561.578) * (-563.034) [-562.985] (-562.362) (-562.264) -- 0:01:05
      84500 -- [-563.050] (-562.292) (-560.796) (-562.062) * (-562.076) (-563.914) [-562.546] (-561.134) -- 0:01:05
      85000 -- (-566.286) [-560.843] (-565.357) (-563.510) * (-562.126) (-564.494) (-564.389) [-564.096] -- 0:01:04

      Average standard deviation of split frequencies: 0.024522

      85500 -- (-562.438) [-567.831] (-567.381) (-564.918) * [-561.592] (-562.234) (-562.490) (-561.122) -- 0:01:04
      86000 -- [-561.687] (-562.638) (-562.165) (-561.883) * (-561.523) (-562.363) [-564.750] (-563.780) -- 0:01:03
      86500 -- (-560.921) (-562.718) (-562.220) [-562.392] * (-563.777) (-561.584) (-566.805) [-563.051] -- 0:01:03
      87000 -- (-569.047) (-561.196) [-562.593] (-562.516) * [-562.081] (-564.445) (-567.143) (-561.762) -- 0:01:02
      87500 -- (-565.099) [-564.100] (-562.495) (-564.215) * [-561.421] (-563.909) (-561.771) (-562.314) -- 0:01:02
      88000 -- (-563.313) (-565.325) [-561.063] (-562.571) * (-561.600) (-561.141) (-561.111) [-564.734] -- 0:01:02
      88500 -- (-564.163) [-562.636] (-561.238) (-562.420) * (-562.216) (-561.053) [-566.040] (-565.179) -- 0:01:01
      89000 -- (-564.819) (-562.900) [-563.080] (-560.634) * (-563.351) [-560.460] (-561.693) (-570.535) -- 0:01:01
      89500 -- [-560.277] (-563.430) (-567.676) (-561.373) * [-561.518] (-563.165) (-560.756) (-564.790) -- 0:01:01
      90000 -- [-563.983] (-568.125) (-561.337) (-563.636) * [-562.551] (-560.868) (-563.439) (-562.551) -- 0:01:00

      Average standard deviation of split frequencies: 0.023917

      90500 -- (-561.238) (-567.746) [-561.438] (-566.474) * (-563.877) (-562.269) [-561.758] (-560.317) -- 0:01:00
      91000 -- (-562.363) (-562.075) (-561.216) [-562.542] * [-563.252] (-564.304) (-561.032) (-560.803) -- 0:00:59
      91500 -- [-566.304] (-568.240) (-563.033) (-560.748) * (-562.096) (-563.627) (-561.227) [-560.785] -- 0:00:59
      92000 -- [-563.319] (-562.076) (-561.780) (-560.743) * (-563.473) (-562.189) [-564.740] (-563.537) -- 0:00:59
      92500 -- (-565.589) (-568.694) [-561.601] (-565.618) * (-564.573) (-561.117) [-560.649] (-563.999) -- 0:00:58
      93000 -- [-562.298] (-563.467) (-562.084) (-561.799) * (-562.795) [-561.376] (-560.539) (-564.616) -- 0:00:58
      93500 -- [-562.241] (-565.380) (-564.330) (-565.050) * (-561.054) (-566.901) (-561.197) [-564.853] -- 0:00:58
      94000 -- (-562.552) [-562.379] (-565.735) (-562.604) * (-564.248) [-561.720] (-561.686) (-565.634) -- 0:00:57
      94500 -- (-561.733) (-561.332) (-563.760) [-563.470] * [-562.755] (-562.367) (-566.001) (-563.501) -- 0:00:57
      95000 -- (-562.757) [-564.852] (-561.768) (-566.610) * (-561.012) (-562.733) (-566.372) [-562.020] -- 0:00:57

      Average standard deviation of split frequencies: 0.023570

      95500 -- (-561.260) (-563.039) (-569.186) [-563.946] * (-561.058) [-561.853] (-560.628) (-561.037) -- 0:00:56
      96000 -- (-561.124) [-563.959] (-570.251) (-566.251) * [-561.931] (-562.729) (-561.916) (-560.896) -- 0:00:56
      96500 -- (-562.100) [-565.331] (-564.969) (-566.328) * (-561.198) (-566.312) [-561.095] (-560.713) -- 0:00:56
      97000 -- (-563.713) [-560.274] (-562.361) (-560.690) * (-561.403) (-564.035) [-565.369] (-563.631) -- 0:00:55
      97500 -- (-561.161) (-568.149) (-562.889) [-561.727] * (-564.241) (-563.579) (-562.092) [-564.474] -- 0:00:55
      98000 -- (-563.156) (-563.435) [-567.067] (-562.186) * (-563.320) [-560.968] (-563.317) (-563.093) -- 0:01:04
      98500 -- [-562.850] (-564.936) (-564.795) (-565.178) * [-562.611] (-560.435) (-569.012) (-563.853) -- 0:01:04
      99000 -- (-564.984) (-561.269) [-561.815] (-561.666) * [-562.127] (-568.695) (-561.756) (-565.444) -- 0:01:03
      99500 -- (-565.145) [-561.516] (-560.391) (-561.368) * [-567.805] (-562.503) (-561.207) (-560.882) -- 0:01:03
      100000 -- (-562.162) [-561.383] (-562.039) (-569.681) * (-561.861) [-564.159] (-561.528) (-560.998) -- 0:01:02

      Average standard deviation of split frequencies: 0.026224

      100500 -- (-564.678) [-561.747] (-562.838) (-563.308) * (-566.325) (-563.909) [-561.353] (-563.561) -- 0:01:02
      101000 -- [-560.322] (-561.383) (-561.923) (-561.071) * (-567.894) [-565.467] (-561.489) (-561.432) -- 0:01:02
      101500 -- (-560.379) [-561.083] (-561.133) (-561.296) * (-562.280) (-567.831) [-562.248] (-561.511) -- 0:01:01
      102000 -- (-561.586) (-562.524) [-563.558] (-560.135) * [-562.887] (-561.712) (-561.940) (-560.994) -- 0:01:01
      102500 -- (-561.113) [-562.413] (-563.020) (-561.582) * (-562.508) (-563.221) [-563.218] (-563.058) -- 0:01:01
      103000 -- (-561.181) (-561.631) (-565.137) [-561.922] * (-563.059) [-565.011] (-562.774) (-561.174) -- 0:01:00
      103500 -- (-561.285) (-563.379) [-563.205] (-561.077) * (-563.105) [-560.725] (-563.428) (-563.905) -- 0:01:00
      104000 -- (-563.101) [-562.620] (-561.200) (-561.272) * (-563.337) (-563.252) (-563.233) [-563.620] -- 0:01:00
      104500 -- [-565.481] (-561.237) (-560.998) (-562.055) * [-562.350] (-561.778) (-562.375) (-565.315) -- 0:00:59
      105000 -- (-566.350) (-565.877) [-561.250] (-566.502) * [-561.620] (-562.674) (-563.782) (-566.548) -- 0:00:59

      Average standard deviation of split frequencies: 0.025794

      105500 -- (-564.229) [-566.949] (-563.408) (-562.128) * (-564.692) (-561.019) (-562.131) [-561.425] -- 0:00:59
      106000 -- (-562.123) (-564.212) (-563.581) [-562.723] * (-562.813) (-561.093) [-563.581] (-562.367) -- 0:00:59
      106500 -- (-562.794) [-561.508] (-564.263) (-563.924) * (-561.443) (-560.435) (-564.284) [-564.319] -- 0:00:58
      107000 -- (-563.947) (-563.651) (-563.361) [-561.451] * (-563.022) (-561.567) [-562.449] (-562.434) -- 0:00:58
      107500 -- [-561.717] (-562.543) (-565.613) (-560.532) * (-561.116) (-563.987) [-561.219] (-561.828) -- 0:00:58
      108000 -- [-562.422] (-563.097) (-562.032) (-561.043) * (-562.047) (-560.731) (-560.990) [-560.295] -- 0:00:57
      108500 -- (-562.171) (-564.673) (-563.506) [-563.098] * (-562.744) (-561.069) (-561.261) [-563.448] -- 0:00:57
      109000 -- (-560.922) (-562.539) [-563.889] (-564.350) * (-561.305) [-560.376] (-564.770) (-565.016) -- 0:00:57
      109500 -- (-561.430) [-561.797] (-561.184) (-562.440) * [-561.359] (-560.638) (-565.798) (-562.028) -- 0:00:56
      110000 -- (-565.825) (-562.096) (-561.175) [-562.059] * (-562.880) (-560.891) (-562.475) [-564.691] -- 0:00:56

      Average standard deviation of split frequencies: 0.025558

      110500 -- (-566.940) (-563.997) [-563.859] (-560.704) * (-567.224) (-564.298) (-563.101) [-565.695] -- 0:00:56
      111000 -- (-570.591) [-563.995] (-563.059) (-564.056) * [-565.821] (-563.217) (-561.586) (-560.887) -- 0:00:56
      111500 -- [-562.669] (-561.547) (-562.238) (-560.718) * [-561.000] (-563.287) (-563.988) (-561.871) -- 0:00:55
      112000 -- (-561.839) [-561.198] (-563.326) (-560.789) * (-560.990) (-561.929) (-564.787) [-560.991] -- 0:00:55
      112500 -- (-562.381) [-561.370] (-561.955) (-562.857) * (-562.943) (-567.575) [-563.728] (-565.159) -- 0:00:55
      113000 -- (-563.246) (-560.403) (-561.064) [-562.052] * (-563.940) (-566.129) (-563.193) [-561.704] -- 0:00:54
      113500 -- (-564.746) [-560.489] (-562.756) (-564.085) * (-562.520) (-562.411) (-565.170) [-562.332] -- 0:00:54
      114000 -- (-561.186) (-560.783) [-561.632] (-562.379) * (-564.453) [-561.953] (-560.672) (-563.348) -- 0:00:54
      114500 -- (-561.338) (-561.618) [-562.245] (-563.077) * (-566.598) [-563.399] (-561.486) (-561.590) -- 0:01:01
      115000 -- (-560.826) [-564.608] (-565.078) (-563.994) * (-561.043) (-564.274) (-562.390) [-560.521] -- 0:01:01

      Average standard deviation of split frequencies: 0.024586

      115500 -- (-560.884) (-562.046) [-564.311] (-564.478) * (-567.830) (-562.405) (-561.854) [-564.824] -- 0:01:01
      116000 -- (-562.396) (-563.415) [-561.138] (-568.532) * (-564.856) (-561.808) (-566.282) [-562.717] -- 0:01:00
      116500 -- (-563.992) [-564.532] (-565.442) (-565.115) * (-562.018) (-563.479) (-561.783) [-565.108] -- 0:01:00
      117000 -- [-562.090] (-561.801) (-566.000) (-562.874) * (-563.389) (-563.502) [-562.341] (-565.047) -- 0:01:00
      117500 -- [-562.408] (-562.104) (-565.443) (-561.587) * (-561.196) (-562.833) [-566.392] (-563.953) -- 0:01:00
      118000 -- (-563.252) [-568.061] (-562.338) (-560.826) * (-560.430) (-563.443) [-564.631] (-560.282) -- 0:00:59
      118500 -- (-561.829) (-564.179) [-563.202] (-565.067) * (-562.447) (-563.949) (-565.771) [-561.072] -- 0:00:59
      119000 -- (-563.308) (-563.787) [-563.095] (-562.170) * [-562.098] (-560.909) (-562.632) (-562.621) -- 0:00:59
      119500 -- (-561.844) (-564.663) (-562.336) [-561.808] * (-560.911) [-563.307] (-565.226) (-561.039) -- 0:00:58
      120000 -- (-563.445) (-562.928) [-561.698] (-564.615) * [-561.544] (-566.395) (-569.337) (-564.145) -- 0:00:58

      Average standard deviation of split frequencies: 0.024026

      120500 -- (-561.237) (-564.354) [-565.214] (-567.458) * [-563.059] (-565.245) (-561.659) (-560.328) -- 0:00:58
      121000 -- (-562.308) [-565.096] (-562.471) (-565.817) * [-560.766] (-560.884) (-561.488) (-561.290) -- 0:00:58
      121500 -- (-561.233) [-563.637] (-563.885) (-563.139) * [-560.545] (-562.190) (-561.353) (-563.033) -- 0:00:57
      122000 -- (-562.209) (-561.637) [-562.173] (-567.835) * (-565.796) (-562.694) [-562.856] (-565.146) -- 0:00:57
      122500 -- (-564.578) [-562.026] (-560.452) (-564.596) * (-561.141) (-562.060) (-560.429) [-562.461] -- 0:00:57
      123000 -- (-562.468) (-563.404) [-561.993] (-562.163) * (-564.002) (-561.969) [-561.871] (-561.923) -- 0:00:57
      123500 -- (-564.426) (-562.082) [-560.552] (-560.806) * (-563.794) (-560.799) (-563.086) [-564.220] -- 0:00:56
      124000 -- (-563.584) (-562.374) [-560.899] (-565.284) * (-561.112) (-561.328) (-566.536) [-562.198] -- 0:00:56
      124500 -- (-560.290) [-561.998] (-567.709) (-562.703) * (-562.797) (-561.971) [-564.203] (-563.206) -- 0:00:56
      125000 -- (-560.449) [-561.041] (-561.858) (-562.628) * [-561.496] (-562.201) (-562.510) (-564.732) -- 0:00:56

      Average standard deviation of split frequencies: 0.023383

      125500 -- [-561.681] (-564.020) (-562.096) (-561.218) * (-562.867) (-567.492) [-562.116] (-561.584) -- 0:00:55
      126000 -- (-561.151) (-562.150) (-561.766) [-561.390] * [-564.681] (-565.144) (-563.279) (-562.141) -- 0:00:55
      126500 -- (-561.467) [-561.841] (-560.640) (-562.294) * (-565.133) [-563.049] (-565.642) (-560.858) -- 0:00:55
      127000 -- (-561.824) [-563.359] (-562.289) (-561.156) * (-562.665) (-562.939) [-565.826] (-567.481) -- 0:00:54
      127500 -- (-562.427) [-563.623] (-564.375) (-560.368) * (-568.200) (-565.004) [-564.812] (-566.434) -- 0:00:54
      128000 -- (-565.632) [-563.514] (-563.516) (-560.476) * (-564.043) (-560.310) (-562.922) [-562.864] -- 0:00:54
      128500 -- (-562.236) (-561.696) [-561.328] (-563.060) * (-561.433) (-560.310) [-563.561] (-561.484) -- 0:00:54
      129000 -- (-564.063) [-561.932] (-562.461) (-562.007) * (-564.487) (-560.598) (-562.082) [-563.970] -- 0:00:54
      129500 -- (-565.691) [-561.644] (-563.721) (-560.774) * (-564.420) [-561.743] (-562.674) (-563.582) -- 0:00:53
      130000 -- [-561.368] (-561.346) (-562.746) (-561.320) * (-562.463) (-562.808) [-562.041] (-561.257) -- 0:00:53

      Average standard deviation of split frequencies: 0.023735

      130500 -- (-561.960) (-561.415) (-562.538) [-561.418] * [-562.674] (-561.898) (-563.847) (-563.149) -- 0:00:59
      131000 -- (-564.952) (-561.174) (-562.536) [-564.445] * (-561.146) (-561.941) [-566.058] (-564.212) -- 0:00:59
      131500 -- (-564.676) [-562.999] (-560.859) (-562.251) * (-561.242) (-561.754) (-560.426) [-561.369] -- 0:00:59
      132000 -- (-563.367) (-564.114) [-561.155] (-561.921) * (-563.210) (-562.575) [-560.310] (-561.328) -- 0:00:59
      132500 -- [-566.062] (-564.896) (-561.402) (-562.441) * (-562.481) [-564.621] (-560.185) (-561.031) -- 0:00:58
      133000 -- [-560.508] (-564.694) (-562.149) (-562.817) * (-561.246) [-561.288] (-561.739) (-563.842) -- 0:00:58
      133500 -- (-562.272) [-563.321] (-561.858) (-564.702) * (-562.178) (-561.042) (-561.678) [-562.850] -- 0:00:58
      134000 -- (-565.069) (-567.409) [-562.440] (-563.673) * (-562.048) [-562.755] (-575.798) (-561.191) -- 0:00:58
      134500 -- (-564.701) [-564.887] (-563.565) (-561.717) * (-562.657) (-564.387) [-564.393] (-561.615) -- 0:00:57
      135000 -- (-565.158) [-562.357] (-561.617) (-561.236) * (-561.682) [-561.562] (-565.424) (-562.236) -- 0:00:57

      Average standard deviation of split frequencies: 0.022877

      135500 -- (-562.395) [-562.294] (-563.412) (-565.281) * (-563.386) [-561.935] (-561.415) (-571.881) -- 0:00:57
      136000 -- (-564.283) (-561.564) [-562.974] (-564.666) * (-563.346) (-561.375) (-564.865) [-564.105] -- 0:00:57
      136500 -- (-564.422) (-562.646) [-562.990] (-562.477) * (-563.255) [-560.606] (-562.781) (-566.311) -- 0:00:56
      137000 -- (-561.032) (-564.175) [-561.536] (-562.834) * (-561.477) [-562.076] (-561.750) (-562.083) -- 0:00:56
      137500 -- (-562.757) [-561.690] (-567.713) (-563.205) * [-561.181] (-562.865) (-560.694) (-562.184) -- 0:00:56
      138000 -- (-562.347) [-562.673] (-561.504) (-561.109) * (-561.540) (-561.407) (-562.152) [-562.222] -- 0:00:56
      138500 -- (-565.262) (-562.148) (-564.854) [-563.107] * (-562.705) (-562.620) (-561.335) [-563.437] -- 0:00:55
      139000 -- (-561.506) (-563.163) [-562.801] (-561.186) * (-564.922) [-560.702] (-563.974) (-563.124) -- 0:00:55
      139500 -- (-563.882) (-561.272) (-562.074) [-563.768] * [-562.505] (-561.916) (-565.236) (-566.016) -- 0:00:55
      140000 -- (-565.646) (-563.327) [-561.938] (-562.144) * [-561.506] (-560.977) (-560.434) (-568.834) -- 0:00:55

      Average standard deviation of split frequencies: 0.023988

      140500 -- (-561.727) [-561.159] (-563.685) (-562.347) * (-564.908) (-566.154) [-563.210] (-568.075) -- 0:00:55
      141000 -- [-561.931] (-560.523) (-562.333) (-562.085) * (-563.860) (-566.782) [-561.348] (-562.238) -- 0:00:54
      141500 -- [-561.974] (-562.934) (-560.883) (-564.958) * (-566.214) [-561.793] (-562.301) (-562.839) -- 0:00:54
      142000 -- (-563.446) (-562.568) [-561.978] (-564.789) * [-561.845] (-562.931) (-560.999) (-560.741) -- 0:00:54
      142500 -- (-560.964) (-565.027) (-560.652) [-562.568] * (-563.213) (-562.574) [-561.634] (-562.028) -- 0:00:54
      143000 -- (-560.507) (-561.255) [-561.754] (-566.509) * (-561.616) [-561.874] (-562.586) (-562.368) -- 0:00:53
      143500 -- (-568.456) [-560.595] (-563.401) (-565.831) * (-562.375) [-561.397] (-562.305) (-560.587) -- 0:00:53
      144000 -- (-566.350) (-565.619) (-564.893) [-560.803] * (-561.957) [-562.247] (-562.261) (-562.937) -- 0:00:53
      144500 -- (-565.346) (-560.644) [-561.219] (-563.634) * [-561.437] (-562.644) (-562.200) (-561.905) -- 0:00:53
      145000 -- [-561.084] (-565.739) (-562.312) (-563.703) * (-561.162) (-563.408) (-561.802) [-562.712] -- 0:00:53

      Average standard deviation of split frequencies: 0.023247

      145500 -- (-563.754) (-564.927) (-561.520) [-565.533] * (-563.011) [-562.006] (-565.157) (-561.747) -- 0:00:52
      146000 -- (-561.477) (-568.505) [-561.758] (-564.216) * (-562.460) (-561.525) (-562.229) [-562.632] -- 0:00:52
      146500 -- (-561.438) (-563.148) [-564.695] (-561.223) * (-563.273) (-560.628) [-561.904] (-563.437) -- 0:00:52
      147000 -- [-563.099] (-562.317) (-561.451) (-562.140) * (-563.031) (-561.047) [-561.568] (-565.957) -- 0:00:52
      147500 -- (-562.354) [-561.494] (-562.305) (-562.562) * [-560.666] (-561.925) (-560.487) (-560.441) -- 0:00:57
      148000 -- (-564.587) (-561.126) [-560.482] (-562.870) * (-561.443) (-564.487) [-561.017] (-561.371) -- 0:00:57
      148500 -- (-561.161) [-561.293] (-563.952) (-560.734) * (-563.380) (-566.044) (-561.279) [-561.881] -- 0:00:57
      149000 -- [-560.863] (-562.070) (-561.235) (-560.642) * [-562.635] (-560.355) (-561.128) (-563.732) -- 0:00:57
      149500 -- (-561.921) [-562.683] (-563.308) (-563.618) * (-564.943) (-561.391) [-560.720] (-564.514) -- 0:00:56
      150000 -- (-563.368) [-563.417] (-563.173) (-564.118) * [-564.120] (-562.783) (-561.054) (-561.932) -- 0:00:56

      Average standard deviation of split frequencies: 0.025500

      150500 -- (-561.117) (-563.832) [-565.577] (-565.123) * (-564.061) [-562.459] (-561.775) (-562.100) -- 0:00:56
      151000 -- (-560.587) [-564.528] (-565.049) (-562.955) * [-565.218] (-563.127) (-562.115) (-562.795) -- 0:00:56
      151500 -- (-565.493) (-563.621) (-564.144) [-561.701] * (-561.276) [-561.247] (-563.174) (-561.082) -- 0:00:56
      152000 -- (-562.213) [-562.067] (-568.513) (-565.566) * (-560.624) (-565.231) [-561.496] (-560.832) -- 0:00:55
      152500 -- (-561.504) [-560.842] (-565.598) (-565.782) * (-563.558) (-563.854) (-560.537) [-561.314] -- 0:00:55
      153000 -- (-563.634) (-563.035) (-562.543) [-560.995] * [-563.050] (-565.779) (-563.218) (-563.055) -- 0:00:55
      153500 -- (-562.541) (-562.329) (-564.308) [-562.537] * (-562.380) [-561.915] (-561.290) (-560.970) -- 0:00:55
      154000 -- (-563.304) (-561.601) (-563.364) [-561.729] * (-560.984) [-563.807] (-561.482) (-564.424) -- 0:00:54
      154500 -- (-568.862) [-562.773] (-565.447) (-562.606) * [-561.663] (-566.164) (-561.233) (-563.771) -- 0:00:54
      155000 -- (-564.283) (-564.288) (-562.790) [-560.764] * [-563.032] (-562.731) (-564.208) (-562.007) -- 0:00:54

      Average standard deviation of split frequencies: 0.025518

      155500 -- (-564.881) [-565.244] (-561.872) (-563.131) * (-561.139) (-561.732) [-563.447] (-567.237) -- 0:00:54
      156000 -- (-562.776) (-563.061) [-562.586] (-563.163) * (-562.409) (-561.975) [-560.873] (-566.710) -- 0:00:54
      156500 -- (-563.646) (-561.770) (-564.557) [-563.330] * [-563.065] (-562.099) (-560.388) (-568.898) -- 0:00:53
      157000 -- [-562.503] (-563.629) (-560.778) (-560.283) * (-567.801) (-562.262) [-561.312] (-561.670) -- 0:00:53
      157500 -- (-561.019) (-565.377) (-562.545) [-561.581] * (-562.917) (-561.998) [-564.664] (-563.344) -- 0:00:53
      158000 -- (-563.777) (-564.238) (-561.484) [-561.265] * [-561.210] (-562.265) (-563.148) (-563.736) -- 0:00:53
      158500 -- [-561.324] (-560.809) (-562.899) (-566.455) * (-561.415) [-561.266] (-563.044) (-564.442) -- 0:00:53
      159000 -- (-565.588) [-562.139] (-561.394) (-565.339) * [-562.061] (-567.915) (-560.387) (-561.128) -- 0:00:52
      159500 -- (-562.774) (-562.936) [-561.815] (-568.443) * (-561.131) (-560.722) [-562.346] (-561.472) -- 0:00:52
      160000 -- [-562.622] (-565.483) (-562.263) (-569.353) * [-561.990] (-560.838) (-560.921) (-562.266) -- 0:00:52

      Average standard deviation of split frequencies: 0.022546

      160500 -- (-564.649) [-561.829] (-563.750) (-563.173) * (-560.593) [-563.950] (-561.605) (-562.592) -- 0:00:52
      161000 -- (-564.126) (-562.474) (-566.284) [-561.861] * (-563.706) [-561.495] (-562.665) (-563.961) -- 0:00:52
      161500 -- (-563.044) [-561.227] (-562.997) (-561.863) * [-562.745] (-569.286) (-560.631) (-561.015) -- 0:00:51
      162000 -- (-561.671) (-561.969) (-563.338) [-561.939] * (-562.540) [-562.224] (-562.682) (-561.806) -- 0:00:51
      162500 -- (-560.438) (-562.938) (-561.304) [-562.284] * [-561.922] (-567.499) (-562.981) (-562.577) -- 0:00:51
      163000 -- [-562.663] (-563.738) (-560.848) (-562.826) * (-562.449) (-564.319) [-561.608] (-563.074) -- 0:00:51
      163500 -- (-562.143) [-563.017] (-561.170) (-562.633) * (-562.106) (-561.925) (-563.032) [-563.732] -- 0:00:51
      164000 -- [-560.969] (-560.961) (-561.040) (-562.454) * (-565.675) (-560.992) [-566.198] (-562.483) -- 0:00:56
      164500 -- (-564.376) [-561.293] (-563.099) (-562.891) * [-568.547] (-561.173) (-562.244) (-562.965) -- 0:00:55
      165000 -- [-561.585] (-563.585) (-564.679) (-562.925) * (-566.220) [-561.489] (-568.102) (-563.394) -- 0:00:55

      Average standard deviation of split frequencies: 0.022270

      165500 -- [-560.525] (-563.194) (-562.760) (-565.846) * [-563.186] (-561.843) (-566.541) (-563.124) -- 0:00:55
      166000 -- (-562.695) [-562.315] (-563.259) (-562.347) * (-562.091) (-564.110) (-561.247) [-564.111] -- 0:00:55
      166500 -- (-564.189) (-570.184) [-561.871] (-561.589) * [-562.083] (-561.705) (-561.518) (-565.443) -- 0:00:55
      167000 -- (-562.078) [-561.947] (-567.509) (-562.986) * (-561.504) (-563.680) [-560.925] (-562.875) -- 0:00:54
      167500 -- (-564.188) (-562.482) (-561.537) [-563.107] * [-562.352] (-563.370) (-562.075) (-563.474) -- 0:00:54
      168000 -- (-563.932) (-563.661) (-561.311) [-561.770] * (-562.291) (-562.164) (-561.489) [-562.995] -- 0:00:54
      168500 -- (-562.551) [-562.851] (-562.024) (-561.196) * [-561.930] (-562.744) (-565.071) (-563.211) -- 0:00:54
      169000 -- (-562.549) (-563.346) (-564.371) [-562.023] * [-561.560] (-561.134) (-563.030) (-565.959) -- 0:00:54
      169500 -- [-560.684] (-563.018) (-565.014) (-562.579) * (-561.216) [-563.017] (-562.243) (-561.322) -- 0:00:53
      170000 -- [-562.765] (-562.647) (-565.398) (-568.214) * (-560.538) (-562.976) [-561.196] (-568.322) -- 0:00:53

      Average standard deviation of split frequencies: 0.022711

      170500 -- (-560.780) (-563.663) [-562.879] (-563.621) * (-561.273) [-561.710] (-564.113) (-561.491) -- 0:00:53
      171000 -- (-561.627) (-562.069) (-563.879) [-561.255] * (-561.370) [-561.564] (-564.908) (-564.252) -- 0:00:53
      171500 -- [-562.361] (-566.602) (-563.321) (-563.210) * [-563.768] (-563.458) (-562.225) (-562.726) -- 0:00:53
      172000 -- (-565.991) (-566.770) [-562.697] (-563.774) * [-562.471] (-563.138) (-560.922) (-561.241) -- 0:00:52
      172500 -- (-565.601) [-562.138] (-565.802) (-565.171) * (-564.491) (-561.656) [-561.653] (-567.642) -- 0:00:52
      173000 -- (-564.750) (-563.650) [-569.029] (-563.364) * (-566.643) [-561.151] (-562.249) (-564.068) -- 0:00:52
      173500 -- (-562.924) [-561.487] (-562.234) (-561.072) * [-563.141] (-562.058) (-566.496) (-563.712) -- 0:00:52
      174000 -- (-560.588) [-562.056] (-564.310) (-561.469) * (-566.180) (-562.754) [-565.639] (-564.468) -- 0:00:52
      174500 -- [-560.426] (-561.049) (-561.527) (-560.807) * (-565.694) [-561.464] (-564.592) (-562.676) -- 0:00:52
      175000 -- (-560.832) [-561.032] (-565.261) (-562.407) * (-561.313) [-563.110] (-565.279) (-561.810) -- 0:00:51

      Average standard deviation of split frequencies: 0.022215

      175500 -- [-562.074] (-563.274) (-565.198) (-567.172) * (-564.095) [-562.655] (-561.731) (-564.085) -- 0:00:51
      176000 -- [-563.274] (-560.851) (-565.569) (-565.692) * (-562.210) [-562.202] (-561.424) (-562.452) -- 0:00:51
      176500 -- (-561.482) (-562.249) (-562.637) [-565.033] * [-565.994] (-565.089) (-562.332) (-565.192) -- 0:00:51
      177000 -- [-561.074] (-561.228) (-563.424) (-562.799) * [-569.348] (-561.275) (-560.940) (-561.197) -- 0:00:51
      177500 -- (-561.173) (-563.836) (-563.133) [-564.766] * (-565.136) (-562.770) [-561.106] (-560.311) -- 0:00:50
      178000 -- (-562.230) [-563.198] (-564.389) (-561.006) * (-561.758) (-563.782) [-560.612] (-560.573) -- 0:00:50
      178500 -- (-567.228) (-561.031) (-563.025) [-562.048] * (-564.727) [-563.451] (-562.027) (-562.199) -- 0:00:50
      179000 -- [-563.405] (-563.339) (-563.104) (-562.712) * (-564.131) [-561.755] (-562.559) (-562.075) -- 0:00:50
      179500 -- (-564.453) (-563.333) [-561.104] (-561.865) * (-564.038) (-562.103) [-562.083] (-563.044) -- 0:00:50
      180000 -- (-561.512) (-561.214) (-561.593) [-561.276] * (-561.928) (-561.538) [-563.530] (-562.690) -- 0:00:50

      Average standard deviation of split frequencies: 0.022562

      180500 -- (-563.433) [-561.794] (-561.175) (-561.676) * (-564.148) [-562.484] (-562.628) (-564.070) -- 0:00:54
      181000 -- [-561.726] (-560.691) (-562.116) (-565.869) * (-563.177) (-560.589) [-560.981] (-566.378) -- 0:00:54
      181500 -- (-563.253) (-562.244) (-560.985) [-562.998] * [-561.101] (-563.335) (-566.716) (-561.874) -- 0:00:54
      182000 -- (-563.943) (-560.841) [-561.014] (-562.342) * (-561.280) (-562.032) (-560.583) [-561.333] -- 0:00:53
      182500 -- (-563.693) (-562.045) (-565.095) [-562.609] * (-562.964) [-561.924] (-562.157) (-562.787) -- 0:00:53
      183000 -- (-563.762) (-561.254) (-561.353) [-562.819] * (-563.361) [-563.916] (-561.964) (-568.870) -- 0:00:53
      183500 -- (-561.136) (-562.388) (-562.201) [-560.844] * (-565.749) (-563.751) [-561.679] (-563.843) -- 0:00:53
      184000 -- (-561.087) (-562.490) [-567.470] (-563.580) * (-564.682) (-560.448) (-561.056) [-562.044] -- 0:00:53
      184500 -- (-563.990) (-563.326) (-565.521) [-562.625] * (-563.217) (-560.836) [-562.082] (-563.170) -- 0:00:53
      185000 -- [-563.914] (-561.732) (-564.415) (-560.537) * (-562.655) [-564.832] (-561.927) (-563.987) -- 0:00:52

      Average standard deviation of split frequencies: 0.023232

      185500 -- (-564.546) (-562.645) [-565.699] (-561.723) * (-564.027) [-560.963] (-561.041) (-562.712) -- 0:00:52
      186000 -- (-563.019) [-560.896] (-560.746) (-560.241) * [-563.489] (-563.490) (-560.930) (-561.455) -- 0:00:52
      186500 -- [-562.083] (-562.196) (-562.032) (-564.149) * (-560.715) (-564.086) (-564.827) [-565.609] -- 0:00:52
      187000 -- [-561.530] (-562.760) (-561.614) (-563.511) * [-563.217] (-560.999) (-563.574) (-564.951) -- 0:00:52
      187500 -- [-561.659] (-568.517) (-562.843) (-562.480) * (-567.077) (-560.950) [-561.372] (-562.258) -- 0:00:52
      188000 -- (-565.589) (-564.414) [-560.864] (-560.334) * (-566.656) (-561.247) [-561.112] (-562.372) -- 0:00:51
      188500 -- (-563.529) (-563.620) (-563.042) [-563.185] * [-565.905] (-563.050) (-562.597) (-562.698) -- 0:00:51
      189000 -- (-561.386) [-563.586] (-563.229) (-564.676) * (-562.115) (-566.045) (-562.462) [-565.935] -- 0:00:51
      189500 -- (-561.295) [-561.851] (-562.087) (-565.013) * (-561.964) (-563.314) [-561.270] (-562.998) -- 0:00:51
      190000 -- [-562.704] (-561.318) (-561.591) (-561.169) * (-567.416) (-562.596) [-560.627] (-562.709) -- 0:00:51

      Average standard deviation of split frequencies: 0.022252

      190500 -- [-562.224] (-562.894) (-561.229) (-564.029) * (-562.891) (-561.709) [-561.497] (-562.846) -- 0:00:50
      191000 -- (-563.898) [-567.130] (-563.334) (-565.996) * (-561.676) (-562.148) (-561.201) [-565.183] -- 0:00:50
      191500 -- [-560.284] (-561.372) (-560.734) (-563.128) * (-562.426) (-561.934) [-560.378] (-562.132) -- 0:00:50
      192000 -- [-560.528] (-561.214) (-565.467) (-560.648) * [-563.116] (-561.984) (-563.942) (-563.623) -- 0:00:50
      192500 -- (-562.834) (-561.165) [-562.988] (-562.162) * (-563.111) (-562.718) (-562.689) [-560.734] -- 0:00:50
      193000 -- (-562.655) (-562.265) [-561.574] (-560.966) * (-560.957) [-562.534] (-561.678) (-563.981) -- 0:00:50
      193500 -- (-561.328) [-561.780] (-562.974) (-564.318) * (-560.418) (-564.440) (-564.876) [-565.754] -- 0:00:54
      194000 -- (-564.387) (-562.166) (-564.106) [-563.019] * [-562.387] (-565.225) (-564.534) (-563.857) -- 0:00:54
      194500 -- [-561.465] (-567.045) (-563.114) (-563.579) * [-563.763] (-564.957) (-561.536) (-563.628) -- 0:00:53
      195000 -- (-561.142) (-563.456) [-566.437] (-564.821) * (-564.501) (-561.130) (-561.549) [-563.103] -- 0:00:53

      Average standard deviation of split frequencies: 0.022448

      195500 -- (-561.821) (-563.147) [-561.432] (-567.042) * (-563.759) [-562.059] (-560.933) (-562.912) -- 0:00:53
      196000 -- (-562.619) (-561.437) [-562.477] (-564.706) * [-564.563] (-566.675) (-561.350) (-565.114) -- 0:00:53
      196500 -- (-560.266) (-565.406) (-562.424) [-564.813] * [-561.710] (-561.840) (-564.091) (-561.318) -- 0:00:53
      197000 -- [-561.070] (-561.911) (-564.035) (-567.435) * [-562.105] (-563.149) (-562.256) (-563.664) -- 0:00:52
      197500 -- (-560.291) (-562.068) [-566.674] (-561.693) * (-563.683) (-562.986) [-561.856] (-563.263) -- 0:00:52
      198000 -- (-562.027) (-561.482) [-564.394] (-565.536) * [-562.365] (-561.182) (-563.410) (-563.939) -- 0:00:52
      198500 -- (-564.256) (-564.592) [-566.077] (-562.223) * [-563.851] (-560.615) (-563.254) (-561.675) -- 0:00:52
      199000 -- (-562.912) (-560.759) (-565.972) [-561.015] * (-563.396) [-561.793] (-566.136) (-561.775) -- 0:00:52
      199500 -- [-560.917] (-561.685) (-562.287) (-561.206) * (-561.240) (-561.640) (-561.570) [-563.354] -- 0:00:52
      200000 -- [-562.960] (-562.466) (-561.902) (-561.297) * (-562.829) (-561.870) (-561.767) [-562.862] -- 0:00:51

      Average standard deviation of split frequencies: 0.022970

      200500 -- (-562.047) (-563.483) (-568.462) [-560.779] * [-562.009] (-564.673) (-565.444) (-562.514) -- 0:00:51
      201000 -- (-561.551) (-562.062) [-564.596] (-562.050) * (-560.485) [-562.614] (-566.811) (-565.949) -- 0:00:51
      201500 -- (-561.041) [-563.773] (-563.231) (-561.932) * [-560.539] (-562.310) (-566.912) (-562.154) -- 0:00:51
      202000 -- [-561.188] (-561.469) (-560.800) (-563.090) * (-563.005) [-560.699] (-563.078) (-563.689) -- 0:00:51
      202500 -- (-561.251) (-568.284) [-564.687] (-564.034) * (-565.675) (-562.736) [-563.381] (-563.992) -- 0:00:51
      203000 -- (-563.889) [-563.469] (-563.753) (-563.877) * (-564.222) (-563.801) [-561.405] (-561.408) -- 0:00:51
      203500 -- [-561.452] (-565.767) (-564.095) (-566.214) * (-561.207) (-562.649) (-562.038) [-561.883] -- 0:00:50
      204000 -- (-560.908) (-562.780) (-563.711) [-561.821] * (-561.273) (-563.938) (-564.424) [-560.759] -- 0:00:50
      204500 -- (-561.327) [-564.879] (-563.578) (-562.512) * (-562.408) (-560.741) (-565.852) [-564.792] -- 0:00:50
      205000 -- [-561.327] (-564.459) (-563.344) (-562.358) * [-561.724] (-562.087) (-564.253) (-563.712) -- 0:00:50

      Average standard deviation of split frequencies: 0.023245

      205500 -- [-562.929] (-564.002) (-565.853) (-560.366) * [-563.233] (-562.180) (-564.310) (-563.554) -- 0:00:50
      206000 -- [-561.958] (-561.851) (-563.635) (-563.778) * (-562.092) (-563.565) (-560.673) [-567.234] -- 0:00:50
      206500 -- (-562.700) (-563.055) (-563.459) [-563.471] * [-562.436] (-567.223) (-562.982) (-561.085) -- 0:00:49
      207000 -- [-562.479] (-563.052) (-564.137) (-564.764) * (-564.553) (-563.248) (-562.677) [-560.508] -- 0:00:49
      207500 -- (-563.449) (-561.109) [-562.923] (-563.025) * (-562.651) (-562.975) (-566.652) [-561.596] -- 0:00:49
      208000 -- (-562.863) (-565.253) [-565.022] (-561.962) * [-561.154] (-569.959) (-562.745) (-560.494) -- 0:00:49
      208500 -- (-563.664) (-560.943) [-562.932] (-561.885) * (-560.920) (-563.571) [-560.988] (-562.026) -- 0:00:49
      209000 -- [-560.927] (-564.685) (-561.592) (-562.993) * (-561.874) (-563.327) [-563.585] (-560.746) -- 0:00:52
      209500 -- (-562.113) [-565.092] (-561.699) (-565.500) * (-567.194) (-564.086) (-562.342) [-562.143] -- 0:00:52
      210000 -- (-565.080) (-561.388) [-564.086] (-562.565) * [-560.903] (-561.379) (-563.815) (-562.172) -- 0:00:52

      Average standard deviation of split frequencies: 0.022750

      210500 -- (-563.000) [-562.672] (-564.242) (-566.316) * [-562.378] (-562.336) (-562.361) (-560.615) -- 0:00:52
      211000 -- [-561.775] (-560.811) (-566.467) (-564.161) * (-561.477) [-561.806] (-561.798) (-562.534) -- 0:00:52
      211500 -- (-561.429) (-560.909) (-562.354) [-560.886] * (-563.425) (-562.313) (-561.118) [-560.679] -- 0:00:52
      212000 -- [-561.105] (-562.529) (-566.600) (-561.903) * (-563.502) (-563.351) [-562.335] (-560.963) -- 0:00:52
      212500 -- (-563.019) [-563.421] (-562.614) (-563.749) * (-560.851) (-563.303) [-561.161] (-563.855) -- 0:00:51
      213000 -- [-561.319] (-560.908) (-564.263) (-562.667) * (-563.783) [-560.785] (-562.173) (-563.422) -- 0:00:51
      213500 -- (-561.662) (-561.337) [-562.116] (-562.948) * [-560.960] (-562.937) (-562.931) (-564.836) -- 0:00:51
      214000 -- (-563.160) (-563.379) (-564.737) [-560.870] * (-563.518) (-567.576) (-563.573) [-563.149] -- 0:00:51
      214500 -- (-562.019) (-561.559) [-561.258] (-562.033) * (-565.248) (-566.844) [-562.957] (-563.082) -- 0:00:51
      215000 -- [-561.878] (-567.373) (-566.180) (-564.585) * (-561.823) [-564.602] (-561.434) (-561.490) -- 0:00:51

      Average standard deviation of split frequencies: 0.020006

      215500 -- (-562.336) (-564.230) [-562.954] (-562.562) * [-563.445] (-562.740) (-562.048) (-562.414) -- 0:00:50
      216000 -- (-563.789) (-562.584) (-561.916) [-564.296] * [-560.655] (-565.145) (-564.345) (-566.037) -- 0:00:50
      216500 -- (-564.064) (-563.473) (-562.412) [-563.609] * (-561.484) [-562.169] (-564.470) (-562.102) -- 0:00:50
      217000 -- [-564.691] (-562.642) (-561.299) (-563.363) * (-563.382) (-562.448) (-563.130) [-561.601] -- 0:00:50
      217500 -- (-564.842) [-563.647] (-562.161) (-563.035) * (-563.019) (-562.667) [-562.449] (-564.145) -- 0:00:50
      218000 -- [-560.613] (-561.613) (-560.915) (-562.331) * [-565.408] (-564.783) (-564.536) (-563.772) -- 0:00:50
      218500 -- (-565.753) (-560.457) (-560.286) [-562.259] * (-564.776) (-564.121) [-567.948] (-562.601) -- 0:00:50
      219000 -- [-563.007] (-564.737) (-565.546) (-565.360) * (-560.657) (-562.711) (-564.654) [-562.302] -- 0:00:49
      219500 -- (-567.202) [-564.009] (-563.678) (-564.491) * (-561.349) (-561.157) [-561.854] (-561.744) -- 0:00:49
      220000 -- (-565.482) (-566.612) [-564.527] (-567.166) * (-560.309) (-566.326) (-561.903) [-560.602] -- 0:00:49

      Average standard deviation of split frequencies: 0.020413

      220500 -- (-562.629) (-564.884) (-562.744) [-562.668] * (-561.249) (-563.893) (-562.272) [-563.053] -- 0:00:49
      221000 -- (-561.321) (-565.858) [-565.324] (-561.450) * [-561.467] (-563.664) (-562.367) (-561.871) -- 0:00:49
      221500 -- (-560.902) (-565.294) [-563.059] (-563.853) * (-561.544) (-564.099) [-560.578] (-562.315) -- 0:00:49
      222000 -- (-564.741) [-563.778] (-562.703) (-561.042) * [-560.728] (-561.441) (-562.618) (-561.080) -- 0:00:49
      222500 -- [-562.947] (-565.119) (-565.746) (-566.122) * (-562.462) (-562.223) (-566.997) [-562.320] -- 0:00:48
      223000 -- (-561.209) (-571.884) (-566.374) [-563.282] * (-563.474) (-562.372) (-561.924) [-564.314] -- 0:00:48
      223500 -- (-561.216) (-564.806) [-563.145] (-561.234) * [-561.753] (-561.097) (-561.634) (-564.590) -- 0:00:48
      224000 -- [-561.757] (-565.081) (-561.179) (-563.940) * (-562.044) [-564.148] (-562.487) (-566.996) -- 0:00:48
      224500 -- [-560.695] (-560.485) (-561.192) (-561.278) * (-561.902) [-565.139] (-563.024) (-562.838) -- 0:00:48
      225000 -- (-561.607) (-560.417) (-563.387) [-561.052] * (-562.511) (-563.350) (-567.621) [-563.191] -- 0:00:48

      Average standard deviation of split frequencies: 0.019584

      225500 -- (-562.963) (-562.855) [-562.026] (-560.888) * [-563.746] (-562.190) (-568.858) (-561.881) -- 0:00:51
      226000 -- (-566.472) [-563.506] (-561.794) (-561.760) * (-566.543) (-561.260) (-565.455) [-562.248] -- 0:00:51
      226500 -- (-561.512) (-564.387) (-561.088) [-561.876] * (-562.917) (-560.735) [-565.468] (-563.106) -- 0:00:51
      227000 -- (-564.771) [-563.494] (-561.773) (-562.432) * (-562.234) [-562.288] (-564.763) (-562.587) -- 0:00:51
      227500 -- [-565.601] (-563.472) (-563.783) (-562.432) * (-562.710) [-561.235] (-561.898) (-561.617) -- 0:00:50
      228000 -- (-562.795) (-564.689) [-562.164] (-562.427) * [-562.967] (-562.241) (-562.283) (-561.723) -- 0:00:50
      228500 -- (-568.216) (-563.598) [-563.719] (-562.895) * (-562.154) [-564.187] (-563.727) (-563.519) -- 0:00:50
      229000 -- (-567.288) (-564.813) (-561.515) [-562.472] * (-563.403) [-561.729] (-560.716) (-561.228) -- 0:00:50
      229500 -- (-563.730) (-563.967) (-565.019) [-561.528] * [-560.827] (-567.741) (-560.908) (-562.000) -- 0:00:50
      230000 -- [-564.581] (-563.161) (-568.638) (-562.476) * (-566.196) [-560.981] (-561.558) (-563.044) -- 0:00:50

      Average standard deviation of split frequencies: 0.020437

      230500 -- (-561.614) (-561.759) (-567.679) [-564.908] * (-562.049) [-560.560] (-562.255) (-562.548) -- 0:00:50
      231000 -- (-562.157) (-563.189) [-563.437] (-560.750) * (-562.682) (-561.651) [-562.816] (-561.268) -- 0:00:49
      231500 -- (-561.350) [-562.304] (-567.776) (-562.015) * (-562.577) (-563.000) (-562.470) [-562.050] -- 0:00:49
      232000 -- (-561.099) [-563.351] (-564.174) (-561.953) * (-565.059) (-560.882) (-566.479) [-564.831] -- 0:00:49
      232500 -- (-560.875) (-560.793) [-563.366] (-561.107) * (-561.857) (-561.745) (-562.600) [-563.980] -- 0:00:49
      233000 -- [-562.632] (-561.386) (-562.213) (-561.107) * (-562.620) (-561.907) [-565.108] (-561.432) -- 0:00:49
      233500 -- (-561.735) [-562.855] (-562.040) (-565.582) * (-563.346) (-565.605) [-561.685] (-562.423) -- 0:00:49
      234000 -- (-561.500) (-562.435) [-561.808] (-565.848) * (-562.549) (-561.344) (-564.572) [-561.578] -- 0:00:49
      234500 -- (-562.904) (-564.058) (-561.585) [-562.551] * (-561.560) [-561.982] (-561.923) (-561.915) -- 0:00:48
      235000 -- (-562.523) (-562.151) (-563.263) [-565.944] * (-562.794) (-565.699) (-566.650) [-561.882] -- 0:00:48

      Average standard deviation of split frequencies: 0.020530

      235500 -- (-562.785) [-562.969] (-561.891) (-563.675) * (-563.221) (-564.096) [-561.531] (-563.054) -- 0:00:48
      236000 -- (-563.276) (-562.601) [-561.618] (-567.568) * [-563.960] (-564.589) (-560.798) (-564.691) -- 0:00:48
      236500 -- (-566.630) (-561.538) [-561.788] (-561.742) * (-562.918) (-562.961) (-565.660) [-560.624] -- 0:00:48
      237000 -- (-565.104) [-561.359] (-561.551) (-563.043) * (-562.174) (-562.474) [-563.864] (-563.591) -- 0:00:48
      237500 -- (-567.398) (-564.951) (-563.478) [-561.495] * (-562.582) (-563.119) [-561.023] (-564.535) -- 0:00:48
      238000 -- (-561.886) (-561.110) [-563.863] (-560.901) * (-563.396) (-563.452) (-560.807) [-560.685] -- 0:00:48
      238500 -- (-561.923) (-563.483) (-565.241) [-561.056] * [-562.791] (-564.781) (-560.570) (-562.292) -- 0:00:47
      239000 -- (-561.875) (-562.843) [-561.301] (-562.175) * [-561.758] (-560.913) (-563.704) (-561.754) -- 0:00:47
      239500 -- (-561.410) [-561.757] (-562.024) (-563.070) * (-563.189) (-560.726) (-564.629) [-562.899] -- 0:00:47
      240000 -- (-562.101) (-562.506) [-562.725] (-563.055) * (-562.346) (-561.639) (-563.223) [-563.707] -- 0:00:47

      Average standard deviation of split frequencies: 0.021111

      240500 -- [-561.824] (-562.763) (-561.272) (-562.616) * [-563.214] (-561.791) (-562.485) (-573.193) -- 0:00:47
      241000 -- (-564.367) (-562.058) [-565.072] (-561.755) * (-562.861) (-562.110) (-561.923) [-563.166] -- 0:00:47
      241500 -- (-562.362) [-565.622] (-562.962) (-561.406) * (-562.864) (-564.729) [-563.546] (-562.450) -- 0:00:47
      242000 -- (-569.925) (-562.752) (-565.770) [-562.766] * (-563.023) [-560.816] (-562.467) (-561.811) -- 0:00:46
      242500 -- (-565.621) (-562.103) [-560.803] (-563.094) * [-562.903] (-563.674) (-563.824) (-561.001) -- 0:00:49
      243000 -- [-563.545] (-562.874) (-560.918) (-566.269) * [-565.458] (-560.462) (-560.926) (-563.313) -- 0:00:49
      243500 -- (-562.037) (-561.757) (-561.078) [-565.591] * (-563.427) [-562.566] (-563.956) (-563.507) -- 0:00:49
      244000 -- (-561.836) [-561.506] (-564.285) (-564.513) * (-565.523) [-561.276] (-563.185) (-561.613) -- 0:00:49
      244500 -- (-563.864) (-561.833) [-561.352] (-563.481) * (-563.612) (-561.095) [-563.663] (-562.083) -- 0:00:49
      245000 -- (-562.559) (-561.572) [-560.829] (-563.915) * (-561.080) [-560.879] (-562.482) (-560.916) -- 0:00:49

      Average standard deviation of split frequencies: 0.019566

      245500 -- (-562.308) [-564.173] (-562.711) (-563.978) * (-561.891) [-561.134] (-568.411) (-563.684) -- 0:00:49
      246000 -- (-562.242) (-563.048) (-561.842) [-563.379] * (-564.470) [-561.241] (-565.535) (-566.413) -- 0:00:49
      246500 -- (-560.802) [-560.328] (-564.114) (-562.761) * (-562.819) (-562.748) (-562.359) [-561.666] -- 0:00:48
      247000 -- (-562.944) [-562.451] (-560.423) (-564.269) * (-563.086) (-567.116) (-567.533) [-562.019] -- 0:00:48
      247500 -- (-560.490) (-561.735) (-565.338) [-561.102] * (-562.045) (-565.835) [-563.362] (-561.685) -- 0:00:48
      248000 -- (-561.028) (-568.137) [-565.142] (-562.866) * (-565.569) (-563.033) [-561.845] (-562.376) -- 0:00:48
      248500 -- (-564.333) (-566.723) (-561.607) [-563.023] * (-562.899) (-561.235) [-561.351] (-562.793) -- 0:00:48
      249000 -- (-563.533) (-560.887) [-565.317] (-561.553) * [-560.703] (-562.635) (-561.990) (-563.917) -- 0:00:48
      249500 -- (-560.792) (-562.019) (-564.982) [-566.389] * (-562.877) (-561.431) (-563.981) [-560.809] -- 0:00:48
      250000 -- (-564.184) [-562.386] (-561.402) (-565.471) * (-561.250) [-563.506] (-562.288) (-563.722) -- 0:00:48

      Average standard deviation of split frequencies: 0.020060

      250500 -- (-560.862) (-562.173) (-563.147) [-561.637] * (-560.772) [-563.878] (-563.498) (-570.083) -- 0:00:47
      251000 -- [-560.792] (-561.781) (-560.578) (-564.524) * (-566.977) [-561.517] (-563.327) (-566.100) -- 0:00:47
      251500 -- [-561.719] (-562.941) (-561.156) (-565.685) * (-564.433) (-562.955) (-561.486) [-563.760] -- 0:00:47
      252000 -- (-562.438) [-562.843] (-564.414) (-564.269) * (-561.303) [-561.751] (-565.186) (-562.887) -- 0:00:47
      252500 -- [-562.924] (-563.048) (-562.526) (-562.643) * (-561.416) [-562.096] (-565.259) (-568.723) -- 0:00:47
      253000 -- [-560.771] (-562.546) (-564.274) (-563.850) * [-562.199] (-563.144) (-562.648) (-561.768) -- 0:00:47
      253500 -- (-561.813) (-563.026) (-561.818) [-561.033] * (-561.073) (-561.370) [-564.002] (-561.188) -- 0:00:47
      254000 -- (-561.698) (-561.276) (-562.220) [-562.993] * [-561.450] (-562.878) (-563.414) (-561.612) -- 0:00:46
      254500 -- (-563.275) [-563.584] (-563.014) (-561.629) * [-564.992] (-563.813) (-560.852) (-560.804) -- 0:00:46
      255000 -- (-563.401) (-565.161) (-562.554) [-561.796] * (-562.999) (-567.550) [-561.964] (-565.219) -- 0:00:46

      Average standard deviation of split frequencies: 0.019642

      255500 -- [-561.518] (-561.152) (-565.943) (-562.959) * (-564.876) (-564.521) [-562.327] (-560.521) -- 0:00:46
      256000 -- (-562.062) (-561.089) (-564.486) [-560.827] * [-562.999] (-562.548) (-560.786) (-563.671) -- 0:00:46
      256500 -- (-562.563) (-563.908) (-563.676) [-562.244] * (-561.748) [-560.922] (-560.786) (-565.452) -- 0:00:46
      257000 -- (-561.962) (-562.268) (-561.682) [-562.261] * (-561.567) (-560.342) [-561.769] (-563.361) -- 0:00:46
      257500 -- (-565.165) (-563.006) (-562.031) [-562.275] * (-561.367) (-562.405) [-560.871] (-563.757) -- 0:00:46
      258000 -- (-565.177) [-568.239] (-563.074) (-563.176) * (-563.574) (-561.033) (-565.309) [-562.790] -- 0:00:46
      258500 -- (-565.173) (-560.402) [-560.751] (-564.629) * (-560.708) (-561.770) (-563.351) [-562.028] -- 0:00:48
      259000 -- (-562.353) [-563.353] (-563.494) (-562.633) * [-563.733] (-560.844) (-561.417) (-562.478) -- 0:00:48
      259500 -- (-563.027) [-563.406] (-564.049) (-561.086) * (-563.632) (-561.874) [-565.158] (-561.808) -- 0:00:48
      260000 -- (-561.119) (-561.228) [-564.054] (-562.644) * [-561.264] (-560.266) (-562.349) (-560.798) -- 0:00:48

      Average standard deviation of split frequencies: 0.019391

      260500 -- (-566.336) (-561.146) (-565.827) [-562.705] * [-561.956] (-561.135) (-563.834) (-566.397) -- 0:00:48
      261000 -- [-562.077] (-560.784) (-561.390) (-562.155) * [-563.221] (-563.267) (-563.368) (-562.484) -- 0:00:48
      261500 -- (-562.652) (-563.554) [-561.337] (-564.340) * [-561.614] (-561.584) (-562.227) (-561.223) -- 0:00:48
      262000 -- (-560.893) (-561.525) (-562.099) [-566.465] * [-564.245] (-563.946) (-562.533) (-564.326) -- 0:00:47
      262500 -- (-560.507) (-561.244) (-561.685) [-563.035] * [-562.718] (-566.131) (-566.148) (-564.044) -- 0:00:47
      263000 -- (-561.801) [-562.224] (-562.638) (-563.731) * (-565.849) [-566.360] (-562.465) (-562.589) -- 0:00:47
      263500 -- (-563.662) [-563.594] (-562.973) (-562.136) * (-561.801) [-562.469] (-562.271) (-566.219) -- 0:00:47
      264000 -- (-561.232) [-567.553] (-566.440) (-562.107) * (-564.721) (-560.884) [-561.608] (-562.066) -- 0:00:47
      264500 -- (-562.098) (-563.538) [-561.944] (-561.762) * (-561.378) [-563.613] (-561.119) (-563.758) -- 0:00:47
      265000 -- (-561.367) [-562.242] (-560.686) (-563.552) * (-563.765) (-560.935) [-561.819] (-561.132) -- 0:00:47

      Average standard deviation of split frequencies: 0.019691

      265500 -- (-561.426) [-563.732] (-565.164) (-563.561) * [-566.939] (-562.026) (-561.167) (-564.481) -- 0:00:47
      266000 -- (-560.495) (-562.391) [-563.640] (-565.342) * (-568.544) (-561.024) [-561.410] (-565.251) -- 0:00:46
      266500 -- (-560.185) [-561.677] (-562.739) (-563.148) * (-560.894) [-563.195] (-562.005) (-562.000) -- 0:00:46
      267000 -- (-564.329) (-563.399) (-563.899) [-563.137] * (-562.264) [-561.748] (-560.744) (-560.686) -- 0:00:46
      267500 -- (-565.307) [-562.537] (-564.066) (-563.418) * (-560.738) [-563.151] (-562.915) (-560.266) -- 0:00:46
      268000 -- (-562.288) [-564.551] (-560.963) (-562.795) * (-560.943) (-563.676) (-562.685) [-561.309] -- 0:00:46
      268500 -- (-562.952) (-562.257) [-568.553] (-562.590) * (-566.803) (-562.103) (-563.701) [-561.479] -- 0:00:46
      269000 -- [-561.536] (-562.167) (-568.068) (-563.181) * (-563.464) (-563.273) [-562.915] (-561.539) -- 0:00:46
      269500 -- (-561.252) (-561.977) [-564.443] (-560.465) * (-563.533) (-562.653) [-562.549] (-561.201) -- 0:00:46
      270000 -- (-561.066) [-561.651] (-561.113) (-564.188) * (-562.757) (-563.631) (-565.734) [-561.252] -- 0:00:45

      Average standard deviation of split frequencies: 0.019352

      270500 -- (-560.584) [-561.453] (-561.240) (-563.892) * [-563.960] (-562.435) (-563.056) (-564.052) -- 0:00:45
      271000 -- (-560.525) (-561.572) (-562.626) [-562.190] * (-564.213) (-563.590) (-560.712) [-563.621] -- 0:00:45
      271500 -- [-566.138] (-562.672) (-562.900) (-564.795) * (-563.991) [-562.762] (-564.216) (-566.794) -- 0:00:45
      272000 -- (-562.783) (-564.123) (-561.635) [-562.378] * (-562.605) [-563.586] (-564.524) (-564.079) -- 0:00:45
      272500 -- (-562.278) (-560.489) (-565.654) [-560.680] * (-564.644) (-567.502) (-564.091) [-564.412] -- 0:00:45
      273000 -- (-563.872) [-564.396] (-567.833) (-561.622) * [-561.191] (-561.058) (-562.321) (-564.465) -- 0:00:45
      273500 -- [-562.285] (-566.414) (-564.788) (-565.629) * (-560.880) (-565.282) (-562.972) [-560.773] -- 0:00:47
      274000 -- (-560.901) (-563.880) [-564.165] (-561.898) * (-564.209) (-563.007) (-562.718) [-562.148] -- 0:00:47
      274500 -- [-562.854] (-571.693) (-564.440) (-561.982) * [-560.713] (-564.760) (-561.668) (-561.734) -- 0:00:47
      275000 -- [-564.471] (-561.437) (-563.219) (-562.206) * (-560.659) (-560.985) (-560.670) [-562.630] -- 0:00:47

      Average standard deviation of split frequencies: 0.018598

      275500 -- (-561.039) (-561.903) [-563.541] (-567.012) * [-561.049] (-562.217) (-561.225) (-563.675) -- 0:00:47
      276000 -- [-560.625] (-562.092) (-564.125) (-561.365) * (-565.266) (-563.407) [-561.710] (-563.191) -- 0:00:47
      276500 -- (-563.530) (-562.586) (-562.232) [-562.589] * [-563.516] (-563.304) (-561.174) (-565.813) -- 0:00:47
      277000 -- [-563.197] (-563.764) (-562.183) (-563.001) * (-561.594) (-568.996) (-563.730) [-566.395] -- 0:00:46
      277500 -- [-561.830] (-565.825) (-561.906) (-563.488) * (-561.724) [-561.252] (-562.544) (-563.254) -- 0:00:46
      278000 -- (-561.296) (-561.858) [-561.358] (-560.304) * (-563.836) (-562.029) [-563.886] (-563.282) -- 0:00:46
      278500 -- [-561.074] (-560.950) (-562.268) (-563.472) * [-560.525] (-564.426) (-560.685) (-562.960) -- 0:00:46
      279000 -- (-562.567) [-561.149] (-560.471) (-561.766) * [-567.168] (-562.530) (-564.952) (-561.997) -- 0:00:46
      279500 -- [-561.258] (-562.721) (-560.336) (-562.126) * [-561.964] (-561.495) (-562.365) (-562.291) -- 0:00:46
      280000 -- (-561.960) (-562.766) (-564.314) [-562.753] * (-563.504) (-562.023) (-562.664) [-561.595] -- 0:00:46

      Average standard deviation of split frequencies: 0.017822

      280500 -- (-567.085) [-565.296] (-563.034) (-563.381) * (-562.680) [-563.746] (-562.643) (-561.817) -- 0:00:46
      281000 -- (-564.855) [-562.676] (-563.750) (-562.631) * (-567.309) (-562.475) (-561.338) [-562.162] -- 0:00:46
      281500 -- (-563.028) (-563.980) [-561.479] (-564.122) * (-563.860) [-561.812] (-563.679) (-563.917) -- 0:00:45
      282000 -- (-563.131) (-562.166) [-560.838] (-562.114) * (-561.258) [-562.528] (-562.093) (-561.816) -- 0:00:45
      282500 -- (-563.203) (-562.886) (-564.932) [-563.021] * (-561.113) (-563.391) (-562.221) [-562.021] -- 0:00:45
      283000 -- (-563.457) (-561.457) (-561.815) [-561.283] * (-561.714) (-565.511) [-562.360] (-562.671) -- 0:00:45
      283500 -- (-564.906) (-563.872) (-563.125) [-562.415] * (-564.742) [-561.410] (-562.121) (-561.645) -- 0:00:45
      284000 -- (-563.906) (-562.543) [-562.530] (-561.155) * (-565.749) (-564.390) [-566.712] (-561.598) -- 0:00:45
      284500 -- (-562.225) (-563.137) [-565.227] (-561.570) * (-562.699) (-561.017) [-563.264] (-562.627) -- 0:00:45
      285000 -- [-561.048] (-563.408) (-566.243) (-563.401) * (-562.227) (-561.988) (-562.580) [-563.477] -- 0:00:45

      Average standard deviation of split frequencies: 0.017948

      285500 -- (-566.426) (-563.105) [-560.674] (-560.854) * (-562.963) (-562.155) [-566.292] (-569.472) -- 0:00:45
      286000 -- (-566.111) (-567.599) (-564.054) [-560.900] * (-566.416) (-564.608) (-565.939) [-562.831] -- 0:00:44
      286500 -- (-561.682) (-562.710) [-560.476] (-561.899) * [-564.401] (-560.926) (-565.079) (-560.432) -- 0:00:44
      287000 -- (-565.413) (-561.579) [-562.870] (-562.306) * [-565.567] (-562.429) (-563.605) (-560.650) -- 0:00:44
      287500 -- [-562.289] (-564.135) (-560.764) (-563.283) * (-562.335) [-561.693] (-564.154) (-561.792) -- 0:00:44
      288000 -- (-561.955) [-561.578] (-562.213) (-562.688) * [-562.228] (-565.753) (-563.971) (-563.934) -- 0:00:44
      288500 -- (-565.320) [-561.767] (-564.374) (-562.781) * [-560.787] (-573.523) (-562.246) (-562.479) -- 0:00:44
      289000 -- [-562.267] (-567.020) (-561.428) (-562.136) * (-561.613) [-561.980] (-561.211) (-565.722) -- 0:00:44
      289500 -- (-563.828) (-565.900) (-561.091) [-561.074] * (-562.336) (-560.494) (-565.763) [-562.892] -- 0:00:44
      290000 -- (-562.356) [-561.535] (-562.130) (-561.818) * (-562.876) [-561.401] (-563.503) (-566.057) -- 0:00:46

      Average standard deviation of split frequencies: 0.017299

      290500 -- (-563.128) (-563.858) [-562.459] (-563.129) * (-561.497) (-565.305) [-563.044] (-561.208) -- 0:00:46
      291000 -- [-563.611] (-561.118) (-561.764) (-561.159) * (-561.252) (-564.548) (-561.938) [-563.005] -- 0:00:46
      291500 -- (-560.582) [-561.256] (-562.943) (-567.874) * [-560.441] (-562.877) (-561.677) (-561.976) -- 0:00:46
      292000 -- (-562.533) (-566.027) [-560.856] (-567.677) * (-561.200) (-563.852) (-561.650) [-563.790] -- 0:00:46
      292500 -- (-561.008) (-563.384) (-560.368) [-562.309] * (-563.477) (-562.246) [-561.585] (-565.261) -- 0:00:45
      293000 -- (-560.736) (-562.533) (-562.647) [-563.976] * [-561.946] (-565.250) (-563.491) (-562.672) -- 0:00:45
      293500 -- [-563.020] (-562.154) (-563.212) (-561.282) * (-560.984) (-562.991) [-564.753] (-562.794) -- 0:00:45
      294000 -- (-565.788) (-563.036) [-561.163] (-563.548) * (-561.624) [-562.715] (-564.829) (-564.074) -- 0:00:45
      294500 -- [-562.990] (-563.069) (-565.035) (-562.981) * (-561.620) (-561.448) (-566.765) [-560.562] -- 0:00:45
      295000 -- (-560.428) [-560.788] (-562.607) (-565.178) * [-562.303] (-565.097) (-562.464) (-561.388) -- 0:00:45

      Average standard deviation of split frequencies: 0.016545

      295500 -- (-560.745) [-561.988] (-563.246) (-563.615) * (-564.486) (-561.195) (-562.424) [-562.717] -- 0:00:45
      296000 -- [-561.221] (-561.163) (-562.693) (-565.113) * (-562.284) [-562.142] (-564.630) (-560.649) -- 0:00:45
      296500 -- (-564.413) (-560.539) (-561.178) [-568.058] * [-563.045] (-561.070) (-563.929) (-561.985) -- 0:00:45
      297000 -- [-561.500] (-563.094) (-562.527) (-561.914) * (-562.955) [-564.985] (-561.946) (-560.694) -- 0:00:44
      297500 -- (-564.018) [-561.177] (-563.541) (-561.324) * [-562.298] (-563.998) (-563.371) (-561.605) -- 0:00:44
      298000 -- (-561.010) (-568.901) (-561.700) [-561.712] * [-563.460] (-562.169) (-563.723) (-561.368) -- 0:00:44
      298500 -- (-561.798) [-563.048] (-561.566) (-567.027) * (-562.401) [-563.755] (-562.240) (-561.774) -- 0:00:44
      299000 -- (-562.046) [-562.042] (-562.577) (-564.971) * [-562.702] (-561.241) (-562.559) (-561.419) -- 0:00:44
      299500 -- (-563.468) [-562.710] (-561.960) (-564.717) * (-562.803) [-563.821] (-565.022) (-562.053) -- 0:00:44
      300000 -- [-562.782] (-563.607) (-567.844) (-566.754) * (-562.944) (-562.795) (-562.464) [-561.687] -- 0:00:44

      Average standard deviation of split frequencies: 0.015679

      300500 -- (-563.896) (-562.119) [-564.789] (-561.495) * [-564.507] (-569.361) (-564.491) (-561.051) -- 0:00:44
      301000 -- (-562.953) (-562.225) (-561.968) [-563.811] * [-564.616] (-563.405) (-561.033) (-562.727) -- 0:00:44
      301500 -- [-566.118] (-562.368) (-565.581) (-565.062) * [-560.905] (-563.269) (-565.807) (-562.682) -- 0:00:44
      302000 -- (-560.940) (-568.103) [-560.828] (-565.431) * (-562.478) (-561.513) [-565.104] (-562.345) -- 0:00:43
      302500 -- (-565.829) [-563.849] (-563.691) (-561.667) * [-564.069] (-562.452) (-562.732) (-562.154) -- 0:00:43
      303000 -- (-561.421) [-562.274] (-562.125) (-563.950) * (-563.424) (-561.185) [-563.617] (-562.289) -- 0:00:43
      303500 -- (-562.414) (-560.967) (-562.628) [-560.572] * (-562.576) (-561.905) (-560.681) [-563.784] -- 0:00:43
      304000 -- (-565.234) [-561.616] (-564.460) (-561.663) * (-566.428) (-562.497) (-562.979) [-560.448] -- 0:00:43
      304500 -- (-562.091) [-567.144] (-561.060) (-561.183) * (-562.685) [-563.877] (-560.750) (-562.234) -- 0:00:43
      305000 -- [-561.927] (-566.033) (-563.005) (-565.476) * [-563.518] (-564.843) (-564.611) (-563.867) -- 0:00:43

      Average standard deviation of split frequencies: 0.015063

      305500 -- [-564.874] (-563.758) (-561.036) (-563.105) * (-563.477) (-561.824) [-564.068] (-565.298) -- 0:00:43
      306000 -- [-563.806] (-563.894) (-562.436) (-565.613) * (-562.325) (-563.223) (-563.339) [-561.812] -- 0:00:43
      306500 -- (-564.875) [-562.403] (-564.703) (-566.045) * (-568.662) [-562.007] (-562.512) (-561.974) -- 0:00:45
      307000 -- (-563.873) (-561.146) (-562.775) [-562.661] * (-563.799) (-561.580) (-564.517) [-562.221] -- 0:00:45
      307500 -- (-563.848) [-562.867] (-562.821) (-562.457) * (-565.874) (-561.432) (-560.712) [-563.060] -- 0:00:45
      308000 -- [-560.801] (-564.536) (-562.265) (-564.894) * (-564.135) (-561.291) [-564.318] (-563.224) -- 0:00:44
      308500 -- [-561.262] (-566.893) (-563.810) (-561.415) * (-562.290) (-565.339) (-561.629) [-562.389] -- 0:00:44
      309000 -- [-564.201] (-564.098) (-561.941) (-562.134) * [-561.667] (-563.100) (-564.870) (-561.908) -- 0:00:44
      309500 -- [-560.573] (-563.952) (-562.802) (-563.394) * (-561.570) (-561.114) [-561.789] (-563.389) -- 0:00:44
      310000 -- [-561.033] (-566.753) (-561.903) (-563.368) * (-563.754) [-562.816] (-564.522) (-561.839) -- 0:00:44

      Average standard deviation of split frequencies: 0.015005

      310500 -- [-563.815] (-566.042) (-561.754) (-561.631) * [-562.899] (-561.486) (-565.052) (-562.133) -- 0:00:44
      311000 -- (-561.417) [-563.144] (-562.002) (-560.380) * (-563.965) (-564.306) [-562.131] (-561.373) -- 0:00:44
      311500 -- [-563.743] (-562.010) (-561.258) (-560.849) * [-563.972] (-562.501) (-562.008) (-562.558) -- 0:00:44
      312000 -- (-561.210) (-561.432) (-566.930) [-560.559] * (-560.982) [-564.539] (-565.403) (-562.861) -- 0:00:44
      312500 -- (-562.279) (-561.484) [-562.017] (-563.080) * [-562.796] (-562.080) (-564.209) (-561.729) -- 0:00:44
      313000 -- (-562.553) [-560.756] (-562.259) (-562.452) * [-563.413] (-560.694) (-561.253) (-564.219) -- 0:00:43
      313500 -- (-564.135) (-563.838) [-561.906] (-563.724) * (-564.082) (-566.886) (-560.891) [-561.061] -- 0:00:43
      314000 -- (-563.544) (-561.993) [-561.141] (-561.811) * (-562.473) (-563.865) (-563.092) [-562.737] -- 0:00:43
      314500 -- (-562.911) [-562.940] (-566.930) (-566.604) * (-566.732) [-562.095] (-561.522) (-563.900) -- 0:00:43
      315000 -- (-564.704) [-561.897] (-565.702) (-563.173) * (-562.799) (-561.795) [-566.533] (-562.148) -- 0:00:43

      Average standard deviation of split frequencies: 0.015708

      315500 -- [-561.957] (-563.373) (-560.454) (-565.506) * (-562.332) [-562.576] (-565.222) (-568.534) -- 0:00:43
      316000 -- (-565.713) (-565.444) [-563.553] (-564.656) * (-563.298) (-565.340) (-565.183) [-563.622] -- 0:00:43
      316500 -- [-562.129] (-563.917) (-567.845) (-561.555) * (-561.926) [-561.891] (-565.203) (-561.117) -- 0:00:43
      317000 -- (-564.549) (-561.854) (-563.564) [-561.578] * (-566.056) (-562.444) (-562.525) [-560.421] -- 0:00:43
      317500 -- [-564.124] (-562.704) (-561.437) (-561.409) * (-563.312) (-565.016) [-561.662] (-561.097) -- 0:00:42
      318000 -- [-561.247] (-560.459) (-562.759) (-564.313) * (-562.466) [-560.643] (-562.617) (-566.765) -- 0:00:42
      318500 -- (-562.530) [-562.586] (-562.990) (-561.326) * [-562.814] (-560.660) (-561.467) (-565.947) -- 0:00:42
      319000 -- [-562.328] (-562.567) (-562.216) (-564.624) * (-563.651) (-561.166) (-562.926) [-562.051] -- 0:00:42
      319500 -- (-560.741) (-561.749) [-562.041] (-563.282) * (-560.132) [-560.906] (-561.771) (-565.038) -- 0:00:42
      320000 -- (-562.923) (-562.029) [-567.960] (-562.170) * [-564.154] (-562.367) (-562.767) (-564.184) -- 0:00:42

      Average standard deviation of split frequencies: 0.013874

      320500 -- [-564.255] (-563.688) (-563.634) (-561.665) * (-561.506) (-561.418) (-561.544) [-561.660] -- 0:00:42
      321000 -- (-561.591) (-563.425) [-563.549] (-560.763) * (-561.254) (-560.733) [-561.291] (-565.091) -- 0:00:42
      321500 -- (-562.256) (-563.284) [-563.757] (-565.364) * (-561.359) [-563.403] (-563.784) (-562.044) -- 0:00:42
      322000 -- (-560.925) [-564.818] (-561.969) (-561.748) * (-561.552) [-560.844] (-561.946) (-563.865) -- 0:00:42
      322500 -- (-562.316) [-563.198] (-561.213) (-564.433) * (-562.844) (-560.928) (-563.989) [-566.636] -- 0:00:42
      323000 -- [-562.067] (-561.281) (-568.869) (-562.486) * [-562.472] (-561.561) (-560.975) (-565.566) -- 0:00:44
      323500 -- (-561.040) (-561.661) (-569.289) [-565.628] * (-563.299) [-563.216] (-561.011) (-562.016) -- 0:00:43
      324000 -- [-563.167] (-563.092) (-569.951) (-563.072) * (-561.034) (-562.911) (-564.301) [-561.698] -- 0:00:43
      324500 -- (-561.639) (-563.969) (-567.145) [-560.608] * (-561.304) (-564.370) (-563.021) [-565.329] -- 0:00:43
      325000 -- (-561.330) (-560.743) (-561.089) [-560.865] * (-562.600) [-564.521] (-562.717) (-563.287) -- 0:00:43

      Average standard deviation of split frequencies: 0.014460

      325500 -- (-561.248) (-562.626) (-567.853) [-560.748] * (-560.226) (-564.447) [-562.187] (-560.265) -- 0:00:43
      326000 -- (-560.915) (-565.876) (-561.100) [-564.595] * (-562.745) (-569.370) (-563.104) [-562.415] -- 0:00:43
      326500 -- [-561.653] (-563.848) (-566.131) (-562.687) * (-561.168) (-565.002) [-561.261] (-564.914) -- 0:00:43
      327000 -- [-562.014] (-561.843) (-563.635) (-563.864) * (-562.312) (-561.780) (-562.926) [-564.544] -- 0:00:43
      327500 -- (-562.281) (-562.957) (-566.526) [-562.996] * (-566.299) (-564.802) [-562.088] (-561.715) -- 0:00:43
      328000 -- (-563.259) [-563.252] (-562.745) (-563.153) * (-562.460) (-560.545) [-561.988] (-562.074) -- 0:00:43
      328500 -- (-563.477) [-561.599] (-565.850) (-563.676) * (-561.806) (-560.709) [-561.450] (-561.977) -- 0:00:42
      329000 -- (-564.073) [-563.572] (-564.007) (-560.972) * (-565.891) (-562.037) (-563.515) [-563.812] -- 0:00:42
      329500 -- [-562.275] (-568.452) (-564.552) (-561.402) * [-561.588] (-566.117) (-566.472) (-564.570) -- 0:00:42
      330000 -- (-561.850) [-564.762] (-560.794) (-562.460) * [-562.427] (-561.660) (-562.588) (-567.040) -- 0:00:42

      Average standard deviation of split frequencies: 0.014340

      330500 -- (-563.314) (-564.662) [-564.346] (-564.461) * (-562.754) (-562.147) [-562.553] (-564.881) -- 0:00:42
      331000 -- [-567.982] (-565.446) (-565.447) (-561.349) * (-563.158) (-563.258) (-562.710) [-562.842] -- 0:00:42
      331500 -- (-562.197) (-566.463) (-565.711) [-562.571] * (-564.283) (-564.742) [-563.320] (-564.146) -- 0:00:42
      332000 -- (-560.954) (-560.607) (-562.408) [-563.223] * (-563.249) [-562.518] (-562.760) (-561.496) -- 0:00:42
      332500 -- (-561.853) (-560.874) [-561.771] (-561.942) * [-564.131] (-565.385) (-566.194) (-562.267) -- 0:00:42
      333000 -- [-561.645] (-562.831) (-567.156) (-561.252) * (-563.314) (-562.494) [-561.954] (-564.702) -- 0:00:42
      333500 -- (-565.166) (-560.986) [-562.201] (-565.333) * (-568.254) (-561.839) (-561.831) [-561.275] -- 0:00:41
      334000 -- [-563.639] (-563.441) (-564.233) (-562.498) * (-567.223) (-564.997) (-562.480) [-561.392] -- 0:00:41
      334500 -- (-562.733) [-562.030] (-565.665) (-562.623) * [-561.602] (-565.446) (-563.543) (-561.534) -- 0:00:41
      335000 -- (-561.926) (-560.663) (-563.171) [-564.784] * [-560.935] (-560.528) (-563.941) (-563.883) -- 0:00:41

      Average standard deviation of split frequencies: 0.013535

      335500 -- (-560.969) [-561.105] (-566.731) (-564.394) * (-562.002) [-561.453] (-564.302) (-562.039) -- 0:00:41
      336000 -- (-560.957) [-561.694] (-561.682) (-563.846) * (-564.547) (-566.739) (-563.405) [-561.595] -- 0:00:41
      336500 -- (-560.695) (-565.730) [-561.710] (-561.715) * (-564.730) [-562.629] (-561.444) (-561.876) -- 0:00:41
      337000 -- (-560.599) (-566.784) (-564.003) [-562.942] * (-562.951) [-561.941] (-560.246) (-561.926) -- 0:00:41
      337500 -- (-560.450) (-564.321) [-562.179] (-561.856) * (-561.461) [-561.136] (-562.571) (-563.729) -- 0:00:41
      338000 -- (-567.657) (-562.116) (-562.213) [-561.104] * (-562.274) [-560.774] (-563.474) (-560.822) -- 0:00:41
      338500 -- [-562.966] (-562.972) (-563.344) (-562.474) * (-560.900) (-566.191) (-560.305) [-560.899] -- 0:00:41
      339000 -- (-562.639) (-562.539) (-561.820) [-561.585] * [-560.337] (-567.314) (-560.620) (-560.752) -- 0:00:40
      339500 -- (-563.346) (-566.455) (-562.510) [-561.579] * (-561.359) (-561.791) [-561.999] (-564.593) -- 0:00:40
      340000 -- [-564.522] (-564.647) (-561.966) (-562.300) * (-560.889) [-561.035] (-561.925) (-563.011) -- 0:00:42

      Average standard deviation of split frequencies: 0.012540

      340500 -- [-562.445] (-563.562) (-561.910) (-560.827) * (-562.790) (-566.863) [-561.532] (-564.034) -- 0:00:42
      341000 -- [-562.234] (-563.402) (-563.698) (-564.145) * [-561.781] (-561.273) (-562.036) (-560.259) -- 0:00:42
      341500 -- [-561.023] (-562.971) (-564.323) (-560.574) * [-561.721] (-561.759) (-563.568) (-564.482) -- 0:00:42
      342000 -- (-563.294) (-567.750) (-564.526) [-564.693] * [-561.568] (-562.732) (-563.291) (-563.277) -- 0:00:42
      342500 -- (-563.621) (-567.009) [-562.551] (-561.635) * (-563.211) (-560.982) [-560.986] (-562.076) -- 0:00:42
      343000 -- (-564.819) (-561.966) (-564.295) [-560.660] * (-562.033) (-561.304) [-561.594] (-564.552) -- 0:00:42
      343500 -- (-561.477) (-560.863) (-561.376) [-561.590] * (-561.670) [-560.924] (-564.765) (-567.042) -- 0:00:42
      344000 -- (-562.423) (-563.380) [-562.309] (-563.713) * (-562.868) [-563.357] (-565.378) (-561.874) -- 0:00:41
      344500 -- (-565.300) (-561.832) (-562.662) [-567.670] * (-562.110) (-567.920) (-565.610) [-564.296] -- 0:00:41
      345000 -- (-563.201) (-562.183) [-563.179] (-565.518) * [-561.757] (-565.223) (-567.482) (-562.894) -- 0:00:41

      Average standard deviation of split frequencies: 0.014586

      345500 -- (-561.580) (-561.159) (-562.138) [-565.474] * (-561.479) (-561.048) (-568.107) [-563.051] -- 0:00:41
      346000 -- [-560.964] (-561.035) (-564.918) (-567.537) * (-563.629) (-563.118) (-562.871) [-562.032] -- 0:00:41
      346500 -- [-563.295] (-563.132) (-562.622) (-567.005) * [-561.080] (-566.783) (-561.361) (-561.681) -- 0:00:41
      347000 -- (-562.305) (-561.949) [-561.255] (-560.796) * (-560.940) (-566.944) [-563.016] (-563.734) -- 0:00:41
      347500 -- (-561.222) [-561.621] (-560.948) (-563.203) * (-562.520) (-562.497) [-563.423] (-568.410) -- 0:00:41
      348000 -- [-562.165] (-564.109) (-565.381) (-564.943) * [-560.641] (-563.554) (-560.933) (-567.304) -- 0:00:41
      348500 -- (-560.729) (-563.166) (-563.126) [-562.820] * [-563.387] (-562.783) (-562.412) (-563.029) -- 0:00:41
      349000 -- [-561.914] (-563.206) (-562.758) (-561.553) * (-565.418) [-563.124] (-561.616) (-565.648) -- 0:00:41
      349500 -- (-561.365) [-560.670] (-561.992) (-562.484) * (-562.752) (-562.912) [-562.683] (-563.589) -- 0:00:40
      350000 -- (-561.583) (-561.582) [-563.659] (-560.971) * [-562.432] (-563.200) (-564.479) (-567.159) -- 0:00:40

      Average standard deviation of split frequencies: 0.012939

      350500 -- (-562.021) (-562.298) (-561.956) [-562.064] * (-562.536) (-563.511) [-566.659] (-564.415) -- 0:00:40
      351000 -- (-562.321) (-563.546) [-562.022] (-563.905) * (-562.570) (-561.536) [-563.106] (-562.054) -- 0:00:40
      351500 -- [-561.567] (-563.794) (-561.838) (-564.073) * [-563.247] (-564.133) (-561.780) (-562.828) -- 0:00:40
      352000 -- (-563.452) (-566.337) (-564.660) [-562.284] * (-561.541) (-565.495) [-561.382] (-565.040) -- 0:00:40
      352500 -- (-561.280) [-562.839] (-563.409) (-563.566) * (-562.284) [-563.569] (-564.797) (-561.937) -- 0:00:40
      353000 -- (-561.868) (-562.244) (-564.245) [-562.681] * (-561.455) [-564.656] (-565.549) (-560.964) -- 0:00:40
      353500 -- (-561.400) (-562.888) (-563.254) [-560.305] * (-560.915) (-561.748) (-566.064) [-562.587] -- 0:00:40
      354000 -- (-564.725) (-563.921) [-563.838] (-566.454) * [-561.137] (-562.755) (-565.331) (-563.940) -- 0:00:40
      354500 -- [-562.946] (-563.025) (-563.936) (-562.947) * (-561.584) (-565.747) (-565.813) [-561.994] -- 0:00:40
      355000 -- [-562.839] (-561.499) (-564.125) (-564.456) * [-560.959] (-564.840) (-566.713) (-561.943) -- 0:00:39

      Average standard deviation of split frequencies: 0.014488

      355500 -- (-562.480) (-563.443) (-563.616) [-561.400] * [-569.659] (-563.455) (-562.830) (-563.701) -- 0:00:39
      356000 -- (-561.947) (-564.723) (-561.485) [-562.326] * (-563.635) (-564.910) (-566.339) [-564.688] -- 0:00:39
      356500 -- (-563.657) [-568.989] (-560.527) (-562.299) * (-563.157) (-561.207) (-564.366) [-561.574] -- 0:00:41
      357000 -- [-562.682] (-566.525) (-561.973) (-562.099) * (-565.445) [-562.262] (-563.828) (-560.657) -- 0:00:41
      357500 -- (-568.250) (-566.902) (-563.341) [-561.779] * (-563.208) (-562.303) (-561.512) [-562.856] -- 0:00:41
      358000 -- (-563.413) (-566.507) (-561.324) [-561.933] * [-563.331] (-562.623) (-561.600) (-564.490) -- 0:00:41
      358500 -- (-563.818) [-560.885] (-560.667) (-561.759) * (-561.301) (-561.028) [-561.383] (-564.825) -- 0:00:41
      359000 -- (-561.105) (-565.408) (-564.615) [-561.533] * (-561.589) (-562.319) [-561.382] (-565.789) -- 0:00:41
      359500 -- [-560.469] (-565.001) (-563.687) (-563.908) * (-562.649) (-562.506) [-562.350] (-563.980) -- 0:00:40
      360000 -- (-560.935) [-562.377] (-562.213) (-564.085) * (-561.033) (-560.652) [-560.707] (-562.777) -- 0:00:40

      Average standard deviation of split frequencies: 0.012008

      360500 -- (-564.344) (-564.464) [-562.709] (-564.762) * [-560.390] (-562.592) (-562.995) (-562.054) -- 0:00:40
      361000 -- (-561.822) [-562.943] (-563.999) (-562.030) * (-561.507) (-563.556) [-561.917] (-564.074) -- 0:00:40
      361500 -- [-561.038] (-568.478) (-565.273) (-562.798) * [-561.241] (-560.707) (-563.027) (-563.870) -- 0:00:40
      362000 -- (-564.061) (-563.570) (-563.167) [-562.047] * (-562.335) (-564.537) (-562.251) [-562.095] -- 0:00:40
      362500 -- (-563.993) (-561.588) [-561.917] (-561.772) * (-562.624) (-563.279) [-560.748] (-563.201) -- 0:00:40
      363000 -- (-568.055) (-561.873) (-570.238) [-562.320] * (-566.108) (-562.970) [-560.732] (-561.865) -- 0:00:40
      363500 -- (-563.400) [-562.569] (-561.864) (-561.641) * (-564.536) (-562.091) (-563.344) [-562.083] -- 0:00:40
      364000 -- (-564.402) (-561.437) [-561.176] (-560.280) * (-565.209) (-561.856) [-561.552] (-564.096) -- 0:00:40
      364500 -- [-564.838] (-564.069) (-564.109) (-561.004) * (-564.093) (-561.845) [-564.126] (-562.071) -- 0:00:40
      365000 -- (-562.488) (-566.487) (-562.932) [-561.596] * (-563.379) (-561.573) (-562.828) [-562.854] -- 0:00:40

      Average standard deviation of split frequencies: 0.011270

      365500 -- [-565.655] (-566.310) (-561.783) (-562.659) * (-563.713) (-561.942) [-565.800] (-561.475) -- 0:00:39
      366000 -- [-561.056] (-562.089) (-561.611) (-562.243) * (-562.502) [-561.358] (-564.361) (-562.263) -- 0:00:39
      366500 -- (-560.375) (-562.783) [-561.341] (-561.242) * (-562.197) (-563.399) (-563.075) [-561.654] -- 0:00:39
      367000 -- (-562.183) (-561.706) [-561.368] (-563.761) * [-561.582] (-561.396) (-563.129) (-562.301) -- 0:00:39
      367500 -- (-563.629) (-562.265) [-561.208] (-562.636) * (-563.688) (-561.608) [-566.424] (-561.290) -- 0:00:39
      368000 -- [-563.289] (-560.490) (-562.158) (-561.296) * (-565.317) (-565.898) (-562.406) [-566.247] -- 0:00:39
      368500 -- (-562.866) [-561.754] (-561.372) (-563.067) * (-562.549) (-564.264) (-560.664) [-566.476] -- 0:00:39
      369000 -- (-561.188) (-561.939) [-561.136] (-564.972) * (-564.762) (-561.255) [-561.247] (-564.000) -- 0:00:39
      369500 -- [-562.745] (-562.233) (-561.465) (-560.514) * (-561.529) (-562.390) (-563.742) [-562.582] -- 0:00:39
      370000 -- (-564.823) [-561.854] (-561.834) (-563.721) * [-562.952] (-563.292) (-562.148) (-567.344) -- 0:00:39

      Average standard deviation of split frequencies: 0.011128

      370500 -- (-566.599) (-561.711) [-563.471] (-566.561) * (-561.652) [-561.858] (-566.226) (-561.293) -- 0:00:39
      371000 -- (-560.847) [-561.400] (-565.301) (-562.270) * (-563.893) [-564.349] (-562.888) (-560.595) -- 0:00:38
      371500 -- (-562.851) (-563.218) (-561.333) [-563.108] * (-561.400) [-564.900] (-562.367) (-562.683) -- 0:00:38
      372000 -- [-569.165] (-561.812) (-563.032) (-560.497) * (-562.583) [-562.758] (-562.451) (-570.414) -- 0:00:38
      372500 -- (-563.821) (-564.868) [-562.108] (-564.118) * (-562.153) [-564.745] (-564.134) (-563.735) -- 0:00:38
      373000 -- (-563.908) [-561.103] (-563.076) (-563.151) * (-568.174) (-562.400) (-562.135) [-565.366] -- 0:00:38
      373500 -- (-563.167) [-562.608] (-562.264) (-565.195) * [-562.643] (-562.335) (-562.485) (-563.662) -- 0:00:40
      374000 -- [-561.684] (-562.820) (-563.806) (-563.556) * [-561.398] (-564.048) (-562.681) (-563.443) -- 0:00:40
      374500 -- (-563.297) (-561.666) (-563.127) [-560.398] * (-560.763) (-562.467) (-567.157) [-564.922] -- 0:00:40
      375000 -- (-561.747) [-561.543] (-561.122) (-563.044) * (-563.514) (-561.357) [-566.833] (-562.922) -- 0:00:40

      Average standard deviation of split frequencies: 0.010892

      375500 -- (-563.641) (-568.835) [-564.475] (-563.806) * (-565.206) (-561.504) (-560.530) [-561.930] -- 0:00:39
      376000 -- (-561.055) (-562.323) (-561.987) [-563.197] * (-562.093) [-564.253] (-560.491) (-561.680) -- 0:00:39
      376500 -- [-562.731] (-561.859) (-563.644) (-561.765) * (-563.879) (-568.497) [-560.389] (-564.474) -- 0:00:39
      377000 -- (-562.989) [-563.092] (-563.819) (-561.155) * (-560.840) [-563.835] (-560.639) (-562.279) -- 0:00:39
      377500 -- [-560.936] (-564.307) (-565.858) (-562.739) * [-562.225] (-560.383) (-560.828) (-563.109) -- 0:00:39
      378000 -- (-563.822) [-561.779] (-564.285) (-561.102) * (-566.918) (-563.189) [-565.192] (-564.050) -- 0:00:39
      378500 -- (-562.233) [-563.821] (-562.190) (-560.654) * (-560.618) [-562.994] (-564.776) (-561.487) -- 0:00:39
      379000 -- (-563.244) [-562.430] (-562.414) (-561.911) * (-561.217) (-564.445) [-563.080] (-561.745) -- 0:00:39
      379500 -- [-563.893] (-563.080) (-564.458) (-562.578) * (-564.461) [-562.192] (-560.828) (-562.098) -- 0:00:39
      380000 -- (-562.251) (-564.760) [-563.134] (-564.728) * (-562.394) [-564.427] (-561.091) (-562.984) -- 0:00:39

      Average standard deviation of split frequencies: 0.009984

      380500 -- [-564.083] (-561.006) (-565.505) (-565.375) * (-562.794) (-560.121) (-563.397) [-561.562] -- 0:00:39
      381000 -- [-562.161] (-563.451) (-564.369) (-561.919) * [-560.895] (-561.281) (-563.339) (-562.933) -- 0:00:38
      381500 -- [-563.347] (-563.520) (-563.227) (-563.701) * [-562.723] (-563.189) (-561.008) (-566.823) -- 0:00:38
      382000 -- (-561.408) [-561.727] (-563.182) (-565.536) * (-560.344) [-561.498] (-560.787) (-564.213) -- 0:00:38
      382500 -- (-562.342) (-564.153) [-562.737] (-562.949) * (-561.368) (-560.803) [-561.813] (-565.707) -- 0:00:38
      383000 -- (-563.277) [-560.529] (-561.374) (-562.902) * [-561.067] (-563.194) (-564.269) (-566.009) -- 0:00:38
      383500 -- [-562.408] (-561.010) (-563.103) (-560.531) * (-562.153) (-562.982) [-564.194] (-563.729) -- 0:00:38
      384000 -- (-562.538) (-561.777) (-563.324) [-561.123] * (-561.502) (-563.315) [-561.365] (-561.562) -- 0:00:38
      384500 -- (-565.696) (-561.032) [-562.306] (-566.115) * [-560.650] (-569.703) (-562.023) (-563.923) -- 0:00:38
      385000 -- (-562.457) (-560.866) [-561.742] (-562.588) * (-560.670) (-565.616) [-562.067] (-562.838) -- 0:00:38

      Average standard deviation of split frequencies: 0.010533

      385500 -- (-564.092) [-560.604] (-564.960) (-563.019) * (-562.639) (-565.285) [-563.554] (-562.817) -- 0:00:38
      386000 -- (-562.471) (-564.156) (-567.025) [-562.712] * [-563.087] (-567.537) (-561.751) (-561.903) -- 0:00:38
      386500 -- [-564.069] (-562.296) (-569.163) (-563.830) * (-561.140) (-567.424) (-562.892) [-563.276] -- 0:00:38
      387000 -- [-561.302] (-563.784) (-568.957) (-563.514) * [-561.151] (-562.736) (-561.612) (-560.897) -- 0:00:38
      387500 -- (-561.155) (-562.531) (-565.246) [-563.715] * (-563.707) [-563.143] (-561.347) (-561.003) -- 0:00:37
      388000 -- (-560.369) (-561.144) (-562.989) [-561.192] * [-560.785] (-561.066) (-560.305) (-561.919) -- 0:00:37
      388500 -- (-560.900) (-564.579) [-564.393] (-563.478) * (-563.695) [-562.092] (-562.108) (-563.011) -- 0:00:37
      389000 -- (-563.546) (-560.812) (-561.775) [-561.802] * (-562.942) [-561.721] (-562.567) (-562.541) -- 0:00:37
      389500 -- [-566.247] (-565.091) (-563.541) (-561.286) * (-562.770) (-561.227) [-562.362] (-561.164) -- 0:00:37
      390000 -- (-565.960) (-562.112) (-563.656) [-562.033] * (-564.078) (-564.368) (-562.676) [-564.775] -- 0:00:39

      Average standard deviation of split frequencies: 0.011313

      390500 -- [-560.724] (-564.609) (-562.410) (-562.288) * (-561.806) (-564.907) (-561.207) [-563.068] -- 0:00:39
      391000 -- (-563.874) (-561.072) [-562.395] (-560.536) * (-563.162) (-563.505) (-564.968) [-560.707] -- 0:00:38
      391500 -- [-562.554] (-562.380) (-563.895) (-563.102) * (-562.973) (-562.396) [-561.635] (-561.119) -- 0:00:38
      392000 -- (-561.265) (-564.308) [-563.370] (-564.703) * [-560.628] (-564.117) (-562.459) (-561.052) -- 0:00:38
      392500 -- (-561.492) (-563.379) [-563.283] (-566.562) * (-561.990) (-561.665) [-561.497] (-561.268) -- 0:00:38
      393000 -- [-564.459] (-563.219) (-563.554) (-567.571) * (-561.281) (-562.712) (-560.801) [-563.811] -- 0:00:38
      393500 -- (-563.334) (-563.644) (-562.606) [-562.908] * [-562.938] (-561.576) (-561.480) (-561.572) -- 0:00:38
      394000 -- (-561.076) (-562.487) [-562.204] (-562.307) * (-564.711) (-564.990) [-561.089] (-564.998) -- 0:00:38
      394500 -- [-561.955] (-561.747) (-562.347) (-562.991) * (-562.346) (-562.855) [-564.784] (-560.278) -- 0:00:38
      395000 -- (-565.763) (-560.502) (-562.481) [-561.736] * (-560.833) (-560.977) [-561.929] (-560.978) -- 0:00:38

      Average standard deviation of split frequencies: 0.011160

      395500 -- (-562.089) (-560.925) [-562.133] (-562.248) * [-562.742] (-563.681) (-562.222) (-561.327) -- 0:00:38
      396000 -- (-563.391) (-561.328) [-561.960] (-561.509) * [-561.872] (-562.305) (-563.373) (-561.867) -- 0:00:38
      396500 -- (-562.538) [-562.019] (-566.028) (-562.798) * (-563.424) (-561.105) (-562.274) [-565.309] -- 0:00:38
      397000 -- [-562.098] (-562.355) (-564.299) (-564.670) * (-563.856) (-560.325) (-565.846) [-562.283] -- 0:00:37
      397500 -- (-561.368) [-561.151] (-567.049) (-561.277) * (-561.785) (-560.426) [-561.851] (-561.473) -- 0:00:37
      398000 -- [-564.066] (-561.193) (-563.000) (-567.225) * [-562.487] (-563.718) (-562.598) (-563.059) -- 0:00:37
      398500 -- [-562.122] (-562.188) (-560.801) (-563.961) * (-565.839) [-562.422] (-564.534) (-562.262) -- 0:00:37
      399000 -- [-567.112] (-562.048) (-562.180) (-565.250) * (-562.520) [-561.178] (-561.800) (-563.462) -- 0:00:37
      399500 -- (-564.382) [-560.693] (-563.487) (-564.903) * [-562.446] (-560.383) (-566.263) (-560.417) -- 0:00:37
      400000 -- (-560.743) [-561.999] (-561.202) (-562.365) * (-562.155) (-564.813) [-563.611] (-561.015) -- 0:00:37

      Average standard deviation of split frequencies: 0.011398

      400500 -- (-560.518) (-563.452) (-563.508) [-562.071] * (-563.483) (-560.759) (-564.420) [-560.284] -- 0:00:37
      401000 -- (-562.138) [-561.685] (-568.902) (-562.706) * [-568.704] (-562.109) (-562.717) (-560.749) -- 0:00:37
      401500 -- [-563.406] (-563.984) (-562.966) (-562.336) * [-561.661] (-563.336) (-561.972) (-562.078) -- 0:00:37
      402000 -- (-562.557) (-565.991) (-563.414) [-561.421] * [-561.883] (-570.235) (-568.162) (-564.280) -- 0:00:37
      402500 -- (-561.506) [-564.442] (-564.775) (-564.243) * (-563.920) (-575.071) (-561.987) [-561.586] -- 0:00:37
      403000 -- (-562.649) (-565.793) [-562.651] (-562.021) * (-562.989) (-562.342) [-560.882] (-562.530) -- 0:00:37
      403500 -- [-561.732] (-562.113) (-565.537) (-564.974) * (-560.203) (-562.665) [-562.667] (-563.548) -- 0:00:36
      404000 -- [-561.650] (-564.418) (-563.279) (-563.355) * (-561.292) (-562.799) (-562.535) [-561.192] -- 0:00:36
      404500 -- (-564.374) [-561.802] (-561.897) (-566.878) * (-561.350) [-561.743] (-564.146) (-561.298) -- 0:00:36
      405000 -- [-561.285] (-561.847) (-560.887) (-562.273) * [-560.781] (-564.273) (-565.959) (-561.485) -- 0:00:36

      Average standard deviation of split frequencies: 0.011974

      405500 -- (-561.333) (-562.146) (-560.218) [-561.246] * [-560.444] (-566.328) (-563.905) (-562.662) -- 0:00:36
      406000 -- [-562.797] (-568.026) (-560.578) (-562.706) * (-561.953) [-563.069] (-565.566) (-563.345) -- 0:00:36
      406500 -- (-560.675) (-565.780) (-564.951) [-562.267] * (-562.262) (-561.966) [-565.651] (-562.789) -- 0:00:37
      407000 -- [-560.392] (-560.520) (-561.219) (-561.016) * (-563.379) [-560.429] (-563.095) (-562.681) -- 0:00:37
      407500 -- (-562.738) [-564.131] (-561.578) (-560.783) * (-565.211) [-561.882] (-565.671) (-566.335) -- 0:00:37
      408000 -- [-563.036] (-562.442) (-562.754) (-563.229) * [-562.906] (-562.891) (-563.566) (-563.821) -- 0:00:37
      408500 -- (-563.194) (-560.716) [-561.428] (-564.073) * (-562.003) (-564.678) (-561.151) [-561.021] -- 0:00:37
      409000 -- [-564.581] (-562.000) (-563.373) (-561.669) * (-561.501) (-562.021) [-561.008] (-562.564) -- 0:00:37
      409500 -- [-561.207] (-565.906) (-564.687) (-564.063) * (-563.482) (-564.094) [-564.258] (-563.470) -- 0:00:37
      410000 -- [-560.923] (-564.926) (-561.667) (-560.772) * (-563.321) (-562.017) [-561.792] (-561.122) -- 0:00:37

      Average standard deviation of split frequencies: 0.012268

      410500 -- (-561.563) (-565.685) [-563.122] (-564.206) * (-562.031) [-563.448] (-561.468) (-563.794) -- 0:00:37
      411000 -- (-560.697) (-568.356) (-565.407) [-561.267] * (-562.505) [-560.763] (-560.992) (-562.843) -- 0:00:37
      411500 -- (-561.207) [-561.391] (-566.169) (-564.683) * (-560.237) [-562.048] (-561.541) (-564.071) -- 0:00:37
      412000 -- (-563.989) (-561.785) [-560.976] (-565.358) * (-561.323) (-563.489) (-561.668) [-562.198] -- 0:00:37
      412500 -- (-561.362) (-561.531) [-561.391] (-561.846) * (-567.800) (-562.881) (-566.926) [-561.262] -- 0:00:37
      413000 -- (-562.808) [-561.425] (-562.225) (-561.784) * [-561.602] (-562.737) (-561.109) (-561.030) -- 0:00:36
      413500 -- (-563.561) [-561.512] (-562.248) (-561.727) * (-562.231) (-562.028) [-561.190] (-563.164) -- 0:00:36
      414000 -- (-569.889) (-561.332) [-561.760] (-564.721) * (-563.969) (-563.462) [-561.222] (-561.386) -- 0:00:36
      414500 -- (-566.249) (-563.307) [-562.115] (-562.570) * (-561.615) (-564.999) (-561.097) [-567.187] -- 0:00:36
      415000 -- (-566.554) (-561.853) (-565.345) [-562.505] * [-561.408] (-564.495) (-560.742) (-564.385) -- 0:00:36

      Average standard deviation of split frequencies: 0.013527

      415500 -- (-562.612) [-562.561] (-568.869) (-562.233) * (-565.746) (-564.450) [-565.400] (-566.925) -- 0:00:36
      416000 -- (-561.362) [-563.554] (-561.301) (-561.042) * (-565.974) (-566.100) (-564.027) [-563.640] -- 0:00:36
      416500 -- (-566.739) [-565.110] (-564.422) (-563.430) * (-561.558) (-564.762) (-561.959) [-561.418] -- 0:00:36
      417000 -- (-563.497) (-562.338) [-562.757] (-561.810) * (-563.833) [-560.957] (-562.726) (-563.490) -- 0:00:36
      417500 -- (-564.958) [-561.709] (-562.373) (-562.208) * [-561.312] (-563.336) (-562.146) (-564.237) -- 0:00:36
      418000 -- (-562.196) [-561.785] (-561.896) (-561.961) * (-561.402) [-561.922] (-562.105) (-562.786) -- 0:00:36
      418500 -- (-561.545) (-566.066) [-561.652] (-562.156) * (-563.336) (-560.900) [-562.761] (-561.468) -- 0:00:36
      419000 -- (-563.327) (-566.910) [-562.829] (-561.793) * [-562.948] (-562.184) (-567.382) (-560.804) -- 0:00:36
      419500 -- (-563.645) (-561.288) [-562.022] (-562.268) * (-560.530) [-561.126] (-563.591) (-560.958) -- 0:00:35
      420000 -- [-563.262] (-562.789) (-561.794) (-562.976) * [-562.200] (-563.543) (-566.194) (-564.646) -- 0:00:35

      Average standard deviation of split frequencies: 0.014078

      420500 -- (-563.155) (-566.956) (-562.216) [-563.366] * [-561.358] (-560.882) (-562.708) (-566.533) -- 0:00:35
      421000 -- (-563.696) (-563.139) (-561.221) [-562.266] * (-562.296) (-564.443) [-560.744] (-563.151) -- 0:00:35
      421500 -- (-561.477) [-561.551] (-567.310) (-567.953) * [-563.922] (-563.707) (-563.172) (-562.944) -- 0:00:35
      422000 -- (-560.784) (-561.385) (-568.133) [-560.798] * [-561.605] (-563.018) (-561.522) (-566.198) -- 0:00:35
      422500 -- (-561.733) (-561.710) [-560.882] (-564.390) * (-563.104) [-561.897] (-560.974) (-561.864) -- 0:00:35
      423000 -- (-562.771) (-562.356) [-564.347] (-562.366) * (-567.833) (-565.030) [-564.896] (-560.573) -- 0:00:36
      423500 -- (-562.980) (-560.913) (-561.980) [-563.463] * [-561.111] (-568.535) (-565.392) (-561.449) -- 0:00:36
      424000 -- (-564.338) (-560.660) [-561.129] (-563.622) * [-561.115] (-563.483) (-562.540) (-565.660) -- 0:00:36
      424500 -- (-563.257) [-561.402] (-561.040) (-561.200) * [-563.263] (-563.066) (-562.563) (-567.138) -- 0:00:36
      425000 -- (-564.119) [-562.042] (-563.068) (-561.619) * (-561.374) (-564.311) (-561.971) [-561.540] -- 0:00:36

      Average standard deviation of split frequencies: 0.014178

      425500 -- [-560.502] (-560.174) (-562.559) (-564.642) * (-561.291) [-562.367] (-563.350) (-560.239) -- 0:00:36
      426000 -- (-562.113) (-560.961) (-564.216) [-562.363] * (-561.309) (-561.455) [-562.455] (-560.764) -- 0:00:36
      426500 -- [-561.553] (-564.905) (-561.974) (-564.593) * (-562.496) [-563.351] (-563.221) (-561.629) -- 0:00:36
      427000 -- (-565.838) (-561.028) (-564.337) [-561.179] * [-560.606] (-565.252) (-561.700) (-563.891) -- 0:00:36
      427500 -- (-562.396) (-562.426) [-562.270] (-561.779) * (-560.992) [-561.943] (-560.826) (-562.571) -- 0:00:36
      428000 -- [-563.578] (-564.087) (-565.292) (-564.828) * (-562.125) (-561.867) [-562.201] (-561.160) -- 0:00:36
      428500 -- [-564.822] (-563.208) (-563.969) (-561.433) * (-563.034) [-563.436] (-563.810) (-561.551) -- 0:00:36
      429000 -- (-563.530) (-565.260) [-564.588] (-562.463) * (-564.795) [-567.467] (-560.699) (-561.942) -- 0:00:35
      429500 -- (-563.514) [-561.544] (-564.948) (-562.823) * (-561.810) (-563.606) [-563.976] (-565.204) -- 0:00:35
      430000 -- [-561.161] (-562.566) (-563.311) (-563.741) * (-561.890) (-561.773) [-560.927] (-567.688) -- 0:00:35

      Average standard deviation of split frequencies: 0.014938

      430500 -- (-560.334) (-561.252) (-564.624) [-565.807] * (-561.115) [-562.161] (-562.169) (-561.770) -- 0:00:35
      431000 -- (-561.772) (-561.359) (-561.214) [-560.812] * (-563.695) (-562.623) (-566.180) [-561.311] -- 0:00:35
      431500 -- (-563.254) (-562.501) [-563.962] (-562.431) * (-561.979) (-561.195) [-563.093] (-562.427) -- 0:00:35
      432000 -- [-560.437] (-560.842) (-565.602) (-562.686) * (-565.015) (-565.348) (-560.472) [-564.470] -- 0:00:35
      432500 -- (-562.486) [-562.978] (-565.652) (-562.871) * (-562.027) [-563.328] (-560.649) (-561.812) -- 0:00:35
      433000 -- (-562.722) (-564.002) [-563.311] (-563.551) * (-565.364) (-561.065) (-561.462) [-562.462] -- 0:00:35
      433500 -- [-561.426] (-561.122) (-561.198) (-567.349) * (-561.478) [-561.579] (-564.326) (-565.876) -- 0:00:35
      434000 -- (-564.157) (-563.151) [-561.596] (-565.148) * [-561.538] (-561.786) (-562.324) (-565.906) -- 0:00:35
      434500 -- (-561.807) (-563.103) [-562.859] (-564.693) * (-564.974) (-562.463) (-563.345) [-562.448] -- 0:00:35
      435000 -- (-562.427) (-561.804) [-564.715] (-562.514) * (-564.138) (-563.019) (-568.196) [-561.724] -- 0:00:35

      Average standard deviation of split frequencies: 0.013865

      435500 -- (-563.651) (-562.167) (-561.934) [-564.292] * (-562.444) (-562.337) [-564.452] (-562.779) -- 0:00:34
      436000 -- (-563.151) (-561.493) (-564.368) [-561.986] * [-562.648] (-562.146) (-561.177) (-561.412) -- 0:00:34
      436500 -- [-562.344] (-561.499) (-566.541) (-565.208) * (-566.354) (-567.364) [-560.960] (-564.912) -- 0:00:34
      437000 -- [-561.312] (-565.084) (-564.056) (-565.246) * (-563.120) [-562.917] (-563.860) (-562.066) -- 0:00:34
      437500 -- (-561.505) (-563.495) (-563.605) [-561.693] * (-561.289) (-563.665) [-563.874] (-562.361) -- 0:00:34
      438000 -- (-560.371) [-561.230] (-561.953) (-560.714) * (-561.336) [-562.156] (-567.116) (-561.561) -- 0:00:34
      438500 -- (-561.338) [-562.914] (-563.329) (-561.245) * (-561.867) (-561.207) (-564.203) [-563.155] -- 0:00:34
      439000 -- (-560.337) (-564.431) [-563.088] (-563.016) * (-562.780) (-562.365) [-562.234] (-561.631) -- 0:00:34
      439500 -- (-561.875) (-561.175) (-561.303) [-562.045] * (-561.098) [-561.239] (-563.140) (-565.608) -- 0:00:34
      440000 -- (-564.994) (-560.711) [-561.653] (-563.125) * (-560.802) [-562.198] (-561.355) (-565.376) -- 0:00:35

      Average standard deviation of split frequencies: 0.012636

      440500 -- (-562.690) (-562.667) (-561.016) [-561.519] * (-561.026) (-563.744) (-564.373) [-563.456] -- 0:00:35
      441000 -- (-562.835) [-561.354] (-562.250) (-567.972) * (-562.072) [-564.304] (-561.035) (-564.017) -- 0:00:35
      441500 -- (-562.320) (-566.060) (-563.742) [-567.702] * (-563.895) (-561.774) [-565.459] (-563.776) -- 0:00:35
      442000 -- (-561.383) (-562.566) [-560.965] (-564.218) * (-562.073) [-566.727] (-562.191) (-561.850) -- 0:00:35
      442500 -- [-560.929] (-563.397) (-561.419) (-560.371) * (-561.310) (-568.699) (-560.813) [-561.639] -- 0:00:35
      443000 -- (-562.899) (-562.504) [-565.524] (-561.645) * (-564.639) (-561.666) (-563.447) [-564.957] -- 0:00:35
      443500 -- (-561.743) (-562.231) [-565.153] (-563.167) * (-565.390) [-560.949] (-562.189) (-562.586) -- 0:00:35
      444000 -- [-562.271] (-562.385) (-564.987) (-561.461) * (-563.080) [-561.611] (-560.765) (-562.838) -- 0:00:35
      444500 -- [-562.717] (-562.624) (-562.624) (-563.377) * [-561.812] (-561.606) (-560.902) (-563.491) -- 0:00:34
      445000 -- (-562.912) (-564.291) [-561.935] (-563.179) * (-561.406) (-561.618) (-568.428) [-562.380] -- 0:00:34

      Average standard deviation of split frequencies: 0.012419

      445500 -- (-566.098) [-562.148] (-564.655) (-563.510) * (-563.149) (-561.397) [-561.424] (-562.785) -- 0:00:34
      446000 -- (-566.819) (-561.601) (-563.908) [-562.471] * (-561.264) (-561.663) (-562.182) [-562.822] -- 0:00:34
      446500 -- (-562.654) (-562.372) (-561.960) [-561.436] * [-561.840] (-561.088) (-561.439) (-561.374) -- 0:00:34
      447000 -- (-561.356) (-562.591) (-560.764) [-562.305] * (-563.155) (-569.590) [-561.941] (-562.623) -- 0:00:34
      447500 -- (-560.842) (-565.201) (-564.587) [-563.125] * [-563.251] (-564.772) (-560.816) (-561.119) -- 0:00:34
      448000 -- (-563.786) [-563.292] (-562.631) (-562.905) * (-562.073) (-564.856) [-563.245] (-563.098) -- 0:00:34
      448500 -- (-561.595) [-563.250] (-564.134) (-568.370) * [-561.168] (-566.965) (-562.210) (-564.301) -- 0:00:34
      449000 -- [-561.156] (-561.838) (-564.999) (-560.791) * (-562.046) (-561.706) [-562.458] (-562.947) -- 0:00:34
      449500 -- [-563.439] (-563.082) (-562.616) (-569.536) * (-562.264) [-562.294] (-560.964) (-561.902) -- 0:00:34
      450000 -- (-564.926) [-560.934] (-565.767) (-563.745) * (-564.004) [-560.997] (-561.353) (-565.776) -- 0:00:34

      Average standard deviation of split frequencies: 0.011855

      450500 -- (-564.263) [-561.575] (-561.822) (-561.801) * (-561.244) (-563.525) (-561.894) [-563.773] -- 0:00:34
      451000 -- (-563.635) [-561.386] (-564.807) (-560.831) * [-561.315] (-574.198) (-561.735) (-564.412) -- 0:00:34
      451500 -- (-565.616) (-562.105) (-564.571) [-562.438] * (-561.438) (-571.829) [-561.312] (-563.199) -- 0:00:34
      452000 -- (-569.161) (-560.544) [-563.677] (-562.953) * (-563.890) (-565.594) [-561.312] (-560.873) -- 0:00:33
      452500 -- (-565.283) (-561.169) [-561.390] (-564.705) * (-565.636) (-566.581) [-560.917] (-562.516) -- 0:00:33
      453000 -- (-563.814) [-560.613] (-560.667) (-566.298) * (-562.513) (-564.638) [-562.446] (-564.848) -- 0:00:33
      453500 -- (-562.099) (-560.811) (-564.324) [-561.235] * [-561.599] (-567.943) (-563.720) (-561.605) -- 0:00:33
      454000 -- (-561.515) (-565.046) [-562.355] (-561.211) * (-562.352) [-564.016] (-561.711) (-560.689) -- 0:00:33
      454500 -- (-563.712) (-564.023) (-563.370) [-562.156] * (-562.105) (-561.929) [-561.411] (-561.190) -- 0:00:33
      455000 -- [-562.507] (-566.773) (-562.171) (-561.346) * (-562.987) (-560.696) [-561.219] (-564.072) -- 0:00:33

      Average standard deviation of split frequencies: 0.011992

      455500 -- [-563.088] (-561.882) (-562.537) (-562.083) * (-562.971) [-560.573] (-561.185) (-561.292) -- 0:00:33
      456000 -- (-561.743) (-562.254) [-561.220] (-563.732) * [-563.357] (-560.664) (-561.016) (-561.847) -- 0:00:33
      456500 -- (-560.835) (-561.897) (-565.415) [-564.728] * (-565.826) [-561.394] (-561.262) (-560.566) -- 0:00:33
      457000 -- (-561.115) (-564.619) (-560.195) [-563.348] * (-565.360) (-561.495) (-562.538) [-561.074] -- 0:00:34
      457500 -- (-567.022) (-563.137) (-560.574) [-560.237] * (-563.016) (-562.503) [-562.715] (-563.790) -- 0:00:34
      458000 -- (-567.766) [-562.225] (-561.320) (-561.715) * (-562.614) (-562.642) (-561.658) [-561.558] -- 0:00:34
      458500 -- (-565.796) (-562.437) [-561.614] (-561.168) * (-562.781) [-562.169] (-560.663) (-561.879) -- 0:00:34
      459000 -- (-561.186) (-564.978) [-560.934] (-563.792) * (-561.157) (-562.411) (-563.296) [-560.810] -- 0:00:34
      459500 -- (-567.747) (-563.665) [-560.540] (-562.364) * [-562.642] (-562.715) (-565.695) (-561.458) -- 0:00:34
      460000 -- (-563.048) [-563.714] (-561.846) (-563.643) * (-562.892) (-562.399) (-568.369) [-561.367] -- 0:00:34

      Average standard deviation of split frequencies: 0.011666

      460500 -- [-560.575] (-562.722) (-563.125) (-561.545) * [-563.706] (-562.381) (-565.642) (-561.871) -- 0:00:33
      461000 -- (-564.275) (-564.636) (-563.482) [-562.405] * [-562.335] (-562.947) (-565.392) (-563.610) -- 0:00:33
      461500 -- (-563.526) (-566.764) [-560.747] (-563.710) * (-561.941) (-560.664) (-563.741) [-561.900] -- 0:00:33
      462000 -- (-561.453) (-565.163) [-560.647] (-561.550) * (-564.121) (-561.925) (-562.578) [-564.188] -- 0:00:33
      462500 -- [-562.103] (-563.006) (-562.335) (-562.681) * (-562.372) (-561.074) (-565.137) [-560.898] -- 0:00:33
      463000 -- (-562.588) [-564.134] (-563.111) (-560.787) * (-568.686) (-562.878) (-562.599) [-561.822] -- 0:00:33
      463500 -- (-563.693) (-562.603) [-561.673] (-563.594) * (-563.574) (-561.509) (-560.875) [-561.050] -- 0:00:33
      464000 -- (-561.608) (-561.968) [-565.593] (-560.948) * (-562.655) (-562.775) (-560.666) [-561.237] -- 0:00:33
      464500 -- (-561.262) (-561.991) (-564.847) [-561.244] * (-563.620) (-561.384) (-561.882) [-561.553] -- 0:00:33
      465000 -- [-561.106] (-563.949) (-561.441) (-563.149) * (-563.812) [-562.224] (-566.825) (-561.306) -- 0:00:33

      Average standard deviation of split frequencies: 0.011600

      465500 -- (-562.315) [-561.210] (-561.126) (-564.900) * [-563.793] (-564.903) (-563.689) (-561.619) -- 0:00:33
      466000 -- (-560.675) [-562.383] (-561.535) (-560.798) * [-561.382] (-562.443) (-562.759) (-560.848) -- 0:00:33
      466500 -- (-561.202) (-561.623) [-562.052] (-560.779) * (-565.054) [-562.802] (-562.740) (-561.017) -- 0:00:33
      467000 -- (-562.503) (-567.698) (-564.172) [-564.381] * (-563.277) [-562.189] (-562.303) (-565.458) -- 0:00:33
      467500 -- (-562.891) (-563.459) [-563.028] (-562.147) * (-561.962) (-562.467) (-560.977) [-564.541] -- 0:00:33
      468000 -- (-562.657) [-565.915] (-562.345) (-562.362) * (-561.441) (-566.035) (-563.953) [-563.859] -- 0:00:32
      468500 -- (-564.398) (-561.178) [-562.907] (-561.910) * (-561.899) (-565.150) [-566.101] (-561.113) -- 0:00:32
      469000 -- (-561.707) (-563.907) (-562.190) [-562.459] * (-565.382) (-568.163) (-562.169) [-562.356] -- 0:00:32
      469500 -- (-563.699) (-564.328) (-562.093) [-560.923] * (-562.674) (-562.801) (-564.826) [-560.767] -- 0:00:32
      470000 -- (-564.527) (-562.131) [-561.036] (-562.140) * (-562.724) (-562.884) [-568.396] (-562.923) -- 0:00:32

      Average standard deviation of split frequencies: 0.011485

      470500 -- (-561.640) [-562.074] (-563.033) (-564.730) * (-563.835) (-563.209) [-560.638] (-561.852) -- 0:00:32
      471000 -- (-563.765) (-560.648) (-562.629) [-561.428] * (-566.244) [-561.001] (-560.763) (-561.955) -- 0:00:32
      471500 -- [-563.406] (-564.368) (-567.417) (-561.403) * (-565.297) [-563.342] (-561.044) (-562.583) -- 0:00:32
      472000 -- [-560.885] (-562.029) (-564.171) (-563.806) * (-560.780) (-564.384) [-561.236] (-562.394) -- 0:00:32
      472500 -- [-560.739] (-561.482) (-564.390) (-566.214) * (-564.103) (-562.690) [-561.316] (-562.094) -- 0:00:32
      473000 -- (-562.097) (-561.978) (-561.908) [-565.105] * [-562.788] (-561.056) (-561.058) (-564.446) -- 0:00:32
      473500 -- (-564.157) (-561.311) (-563.457) [-562.594] * (-563.599) (-561.424) (-561.097) [-561.807] -- 0:00:32
      474000 -- [-569.188] (-561.547) (-563.289) (-562.908) * (-563.468) (-562.838) [-562.383] (-565.287) -- 0:00:33
      474500 -- (-564.884) [-561.889] (-561.768) (-562.607) * [-560.471] (-563.612) (-564.743) (-563.810) -- 0:00:33
      475000 -- (-561.820) (-562.271) [-562.157] (-566.410) * [-565.571] (-562.664) (-560.569) (-562.973) -- 0:00:33

      Average standard deviation of split frequencies: 0.011290

      475500 -- [-563.826] (-563.166) (-561.600) (-563.810) * (-564.526) (-563.769) (-568.610) [-562.999] -- 0:00:33
      476000 -- (-561.415) (-562.351) (-562.157) [-561.145] * (-561.696) (-566.283) (-562.453) [-563.037] -- 0:00:33
      476500 -- (-560.656) (-564.865) [-565.110] (-564.158) * (-561.903) (-563.597) [-562.981] (-565.549) -- 0:00:32
      477000 -- (-561.764) (-562.851) [-561.951] (-560.959) * [-564.262] (-562.965) (-561.814) (-563.032) -- 0:00:32
      477500 -- (-563.939) (-562.613) [-561.988] (-563.860) * (-561.568) (-561.162) [-562.904] (-561.187) -- 0:00:32
      478000 -- (-565.660) (-561.787) [-560.203] (-562.371) * [-566.073] (-560.546) (-562.291) (-562.742) -- 0:00:32
      478500 -- (-561.292) [-566.240] (-560.845) (-565.690) * [-563.554] (-563.348) (-561.866) (-565.303) -- 0:00:32
      479000 -- [-560.718] (-561.209) (-564.110) (-563.947) * (-560.816) (-562.604) [-562.379] (-561.924) -- 0:00:32
      479500 -- (-561.474) (-563.497) [-562.879] (-562.413) * (-562.750) (-563.458) (-566.381) [-564.864] -- 0:00:32
      480000 -- (-562.000) (-561.223) [-562.921] (-564.623) * (-567.627) [-563.293] (-565.421) (-563.041) -- 0:00:32

      Average standard deviation of split frequencies: 0.012030

      480500 -- (-562.190) (-563.373) [-566.663] (-563.457) * (-564.775) (-565.511) (-561.613) [-564.878] -- 0:00:32
      481000 -- (-560.729) (-561.018) [-565.025] (-563.156) * (-564.682) [-563.332] (-564.566) (-564.007) -- 0:00:32
      481500 -- [-563.540] (-561.106) (-564.835) (-560.619) * (-563.299) [-561.779] (-562.268) (-562.068) -- 0:00:32
      482000 -- (-565.712) (-561.134) [-562.598] (-562.427) * (-564.528) [-563.145] (-560.989) (-562.094) -- 0:00:32
      482500 -- (-567.198) (-563.627) (-562.674) [-562.354] * [-561.542] (-567.323) (-561.441) (-562.131) -- 0:00:32
      483000 -- (-566.873) (-561.446) [-561.171] (-560.733) * (-562.623) [-563.157] (-562.513) (-560.394) -- 0:00:32
      483500 -- [-561.144] (-564.434) (-565.253) (-560.967) * (-565.432) [-562.766] (-563.028) (-560.556) -- 0:00:32
      484000 -- (-565.531) (-562.905) [-563.755] (-560.756) * (-568.462) [-564.644] (-561.426) (-561.881) -- 0:00:31
      484500 -- (-561.225) (-564.059) (-561.616) [-562.417] * (-564.564) (-563.066) (-561.529) [-561.670] -- 0:00:31
      485000 -- (-561.033) (-565.154) [-560.987] (-563.319) * (-565.274) (-560.921) (-562.715) [-564.047] -- 0:00:31

      Average standard deviation of split frequencies: 0.011640

      485500 -- (-562.071) [-563.782] (-561.580) (-562.091) * (-563.274) (-562.196) (-562.431) [-561.694] -- 0:00:31
      486000 -- (-565.792) [-563.141] (-561.054) (-565.118) * [-562.405] (-564.450) (-562.695) (-562.875) -- 0:00:31
      486500 -- (-566.109) (-563.852) (-560.609) [-562.248] * (-562.080) [-561.085] (-563.101) (-565.997) -- 0:00:31
      487000 -- (-562.642) [-563.798] (-563.106) (-561.632) * (-561.265) (-561.606) (-562.471) [-564.288] -- 0:00:31
      487500 -- (-560.665) (-563.617) [-561.570] (-560.976) * (-562.628) (-565.723) [-563.223] (-561.563) -- 0:00:31
      488000 -- (-560.263) (-560.359) (-564.834) [-564.063] * [-562.732] (-562.665) (-561.481) (-561.043) -- 0:00:31
      488500 -- (-562.091) (-563.250) [-566.909] (-567.644) * [-561.210] (-564.228) (-561.070) (-563.294) -- 0:00:31
      489000 -- (-562.445) [-561.900] (-563.380) (-566.705) * (-562.088) (-560.616) (-560.986) [-562.026] -- 0:00:31
      489500 -- (-561.794) [-561.766] (-564.435) (-563.158) * (-563.839) (-563.483) (-561.581) [-562.138] -- 0:00:31
      490000 -- (-562.260) (-561.146) [-562.949] (-563.578) * (-566.639) (-562.247) [-560.917] (-564.827) -- 0:00:31

      Average standard deviation of split frequencies: 0.012129

      490500 -- (-565.878) [-561.935] (-564.326) (-561.938) * (-565.182) [-562.820] (-562.072) (-563.135) -- 0:00:32
      491000 -- (-563.833) (-562.306) (-562.142) [-560.933] * [-560.506] (-563.686) (-561.925) (-562.922) -- 0:00:32
      491500 -- (-560.587) (-568.004) (-562.237) [-562.665] * (-563.524) (-562.304) (-561.439) [-565.514] -- 0:00:32
      492000 -- [-561.459] (-562.919) (-561.146) (-563.668) * [-565.621] (-563.721) (-562.066) (-563.164) -- 0:00:32
      492500 -- (-565.729) (-563.648) (-562.381) [-563.338] * (-563.433) (-562.205) (-561.467) [-566.031] -- 0:00:31
      493000 -- (-561.415) (-563.317) (-562.474) [-566.464] * [-561.740] (-563.713) (-563.219) (-567.976) -- 0:00:31
      493500 -- [-561.231] (-563.089) (-561.781) (-566.525) * (-561.653) [-561.958] (-564.129) (-562.345) -- 0:00:31
      494000 -- [-560.714] (-565.195) (-561.705) (-563.733) * (-560.566) (-561.754) [-561.760] (-562.101) -- 0:00:31
      494500 -- [-562.698] (-561.613) (-561.799) (-563.607) * [-562.570] (-563.349) (-564.437) (-560.637) -- 0:00:31
      495000 -- (-561.808) [-562.702] (-564.057) (-565.454) * (-566.518) [-562.551] (-568.124) (-561.533) -- 0:00:31

      Average standard deviation of split frequencies: 0.011595

      495500 -- (-562.807) [-561.294] (-563.474) (-564.260) * (-566.321) (-564.547) [-563.750] (-562.130) -- 0:00:31
      496000 -- (-561.373) [-561.597] (-563.763) (-564.839) * (-564.500) (-562.228) (-562.076) [-564.106] -- 0:00:31
      496500 -- [-560.803] (-563.259) (-561.220) (-560.147) * [-561.448] (-560.454) (-566.184) (-563.916) -- 0:00:31
      497000 -- (-562.564) (-561.229) (-564.873) [-564.829] * (-561.148) (-561.550) [-561.421] (-563.056) -- 0:00:31
      497500 -- [-564.078] (-564.356) (-563.626) (-560.656) * [-561.302] (-561.543) (-561.376) (-562.032) -- 0:00:31
      498000 -- (-561.779) [-561.833] (-565.416) (-560.570) * (-560.608) [-560.355] (-563.049) (-562.719) -- 0:00:31
      498500 -- [-566.366] (-561.215) (-566.515) (-563.924) * (-565.797) [-560.721] (-562.374) (-561.534) -- 0:00:31
      499000 -- (-563.000) [-561.199] (-567.886) (-566.877) * (-561.330) (-561.886) [-565.812] (-564.389) -- 0:00:31
      499500 -- (-563.114) (-561.588) (-562.307) [-561.028] * (-564.741) (-564.687) [-561.703] (-562.182) -- 0:00:31
      500000 -- (-562.643) [-562.089] (-563.000) (-561.343) * (-561.835) (-563.010) [-562.165] (-564.807) -- 0:00:31

      Average standard deviation of split frequencies: 0.012064

      500500 -- (-565.089) (-565.148) [-560.312] (-565.100) * [-561.440] (-561.983) (-562.285) (-567.618) -- 0:00:30
      501000 -- (-562.595) (-563.021) [-561.773] (-568.263) * [-563.978] (-561.813) (-563.727) (-561.040) -- 0:00:30
      501500 -- (-562.017) (-564.248) (-562.614) [-561.257] * (-562.538) (-563.825) [-569.448] (-561.147) -- 0:00:30
      502000 -- (-561.045) (-561.743) (-562.457) [-561.201] * (-560.531) [-561.195] (-564.262) (-566.436) -- 0:00:30
      502500 -- [-560.595] (-563.223) (-565.436) (-561.548) * (-560.305) (-560.893) (-562.342) [-561.542] -- 0:00:30
      503000 -- [-563.951] (-566.681) (-562.097) (-563.216) * (-562.182) (-563.663) (-563.359) [-561.196] -- 0:00:30
      503500 -- (-562.869) (-565.515) [-563.640] (-563.790) * [-563.995] (-560.919) (-562.115) (-563.827) -- 0:00:30
      504000 -- (-561.309) (-561.278) (-561.613) [-560.725] * (-565.069) (-561.908) [-562.226] (-563.156) -- 0:00:30
      504500 -- (-570.049) (-561.116) [-563.640] (-560.820) * (-561.640) [-564.980] (-562.185) (-563.096) -- 0:00:30
      505000 -- (-567.615) [-561.226] (-561.360) (-561.319) * (-567.039) (-562.878) [-562.363] (-560.295) -- 0:00:30

      Average standard deviation of split frequencies: 0.011937

      505500 -- (-565.642) [-561.432] (-565.160) (-561.486) * [-562.306] (-562.929) (-561.054) (-563.365) -- 0:00:30
      506000 -- (-566.585) [-564.843] (-564.204) (-565.280) * (-563.829) (-560.559) (-564.040) [-564.667] -- 0:00:30
      506500 -- (-564.726) [-563.970] (-564.048) (-561.712) * (-561.637) [-561.125] (-562.091) (-561.730) -- 0:00:30
      507000 -- [-561.680] (-562.952) (-563.145) (-561.410) * (-562.012) [-560.935] (-562.824) (-567.356) -- 0:00:31
      507500 -- (-560.149) [-566.309] (-560.987) (-564.466) * [-565.376] (-563.904) (-565.207) (-561.713) -- 0:00:31
      508000 -- (-561.547) (-562.059) (-560.948) [-563.617] * (-562.565) (-563.468) [-563.956] (-563.044) -- 0:00:30
      508500 -- (-563.509) [-562.114] (-563.461) (-563.135) * (-561.549) (-563.004) [-563.389] (-564.551) -- 0:00:30
      509000 -- [-563.142] (-562.874) (-563.268) (-572.835) * (-560.446) (-562.350) (-563.841) [-561.783] -- 0:00:30
      509500 -- (-561.282) (-565.847) (-561.865) [-563.638] * (-561.686) [-561.987] (-563.873) (-564.640) -- 0:00:30
      510000 -- (-561.914) (-563.177) (-560.574) [-562.550] * [-561.660] (-564.711) (-565.114) (-562.528) -- 0:00:30

      Average standard deviation of split frequencies: 0.011654

      510500 -- [-561.977] (-568.151) (-561.051) (-562.650) * (-561.474) (-561.600) (-560.976) [-561.857] -- 0:00:30
      511000 -- (-562.081) (-563.376) [-561.916] (-563.263) * (-561.778) (-564.833) [-560.819] (-561.967) -- 0:00:30
      511500 -- (-563.531) (-564.960) (-560.740) [-560.942] * [-561.753] (-566.720) (-561.410) (-561.480) -- 0:00:30
      512000 -- (-565.096) (-562.565) (-561.422) [-561.402] * (-562.923) (-566.082) [-561.290] (-560.754) -- 0:00:30
      512500 -- [-561.893] (-561.119) (-565.063) (-560.901) * (-561.723) (-565.655) [-561.127] (-564.665) -- 0:00:30
      513000 -- [-561.057] (-563.416) (-566.995) (-561.105) * (-572.424) (-562.162) [-562.277] (-562.103) -- 0:00:30
      513500 -- (-561.175) [-566.643] (-566.393) (-565.128) * (-561.857) (-560.531) [-562.411] (-562.136) -- 0:00:30
      514000 -- (-562.988) (-563.322) (-563.047) [-563.959] * [-565.157] (-563.187) (-563.693) (-562.979) -- 0:00:30
      514500 -- (-563.063) [-561.306] (-567.775) (-563.964) * (-564.925) (-564.599) [-562.734] (-561.774) -- 0:00:30
      515000 -- (-565.864) (-563.511) [-561.633] (-563.207) * (-560.613) [-563.006] (-560.486) (-564.674) -- 0:00:30

      Average standard deviation of split frequencies: 0.011648

      515500 -- (-563.965) (-565.120) [-560.695] (-564.314) * (-562.671) [-561.469] (-561.599) (-566.222) -- 0:00:30
      516000 -- (-564.461) (-562.465) [-561.256] (-566.098) * (-562.553) (-565.218) [-562.276] (-565.065) -- 0:00:30
      516500 -- (-562.615) (-562.591) [-561.408] (-565.875) * (-567.267) (-566.252) [-562.067] (-562.097) -- 0:00:29
      517000 -- [-560.565] (-562.437) (-562.867) (-565.099) * (-562.271) (-564.914) [-563.843] (-566.273) -- 0:00:29
      517500 -- [-560.312] (-561.116) (-563.596) (-563.878) * (-561.922) (-561.923) (-563.269) [-566.384] -- 0:00:29
      518000 -- (-562.483) (-560.688) (-564.157) [-561.188] * [-561.293] (-564.384) (-561.632) (-561.429) -- 0:00:29
      518500 -- (-560.386) (-560.883) [-564.433] (-562.715) * [-562.279] (-564.699) (-563.459) (-563.963) -- 0:00:29
      519000 -- (-564.424) (-562.838) (-561.335) [-562.349] * (-563.648) (-561.765) (-561.271) [-565.289] -- 0:00:29
      519500 -- [-562.066] (-560.255) (-560.559) (-564.533) * (-560.730) (-561.676) [-560.779] (-563.117) -- 0:00:29
      520000 -- (-561.076) (-560.642) (-562.158) [-562.565] * (-563.334) (-560.516) (-560.739) [-561.242] -- 0:00:29

      Average standard deviation of split frequencies: 0.011996

      520500 -- (-561.402) (-561.856) (-563.013) [-561.855] * (-562.344) (-561.147) [-561.965] (-561.080) -- 0:00:29
      521000 -- (-561.365) (-561.629) (-564.901) [-562.104] * (-561.147) (-563.723) (-564.946) [-563.921] -- 0:00:29
      521500 -- [-564.364] (-566.874) (-566.521) (-565.044) * (-560.918) (-561.436) [-561.967] (-561.866) -- 0:00:29
      522000 -- [-561.535] (-562.214) (-564.919) (-567.414) * [-560.918] (-564.465) (-563.131) (-563.112) -- 0:00:29
      522500 -- [-566.227] (-564.709) (-561.785) (-562.508) * (-563.015) (-563.337) [-563.059] (-560.876) -- 0:00:29
      523000 -- (-564.623) [-560.572] (-562.099) (-563.033) * [-561.950] (-561.302) (-562.140) (-560.676) -- 0:00:29
      523500 -- (-564.135) (-563.701) [-561.537] (-563.821) * [-564.806] (-565.822) (-562.518) (-563.994) -- 0:00:29
      524000 -- (-563.427) [-561.111] (-563.577) (-564.395) * [-563.103] (-562.225) (-562.600) (-563.814) -- 0:00:29
      524500 -- [-561.187] (-563.689) (-562.796) (-562.565) * [-562.786] (-568.634) (-561.655) (-562.511) -- 0:00:29
      525000 -- (-563.581) [-562.165] (-564.805) (-563.017) * (-565.084) (-568.819) (-563.341) [-566.747] -- 0:00:29

      Average standard deviation of split frequencies: 0.011763

      525500 -- (-567.504) (-563.426) (-562.709) [-562.265] * (-563.216) [-562.243] (-561.030) (-562.322) -- 0:00:29
      526000 -- (-562.976) (-564.102) [-562.116] (-563.401) * (-565.872) (-562.033) [-562.014] (-563.545) -- 0:00:29
      526500 -- (-562.608) [-563.189] (-563.382) (-561.734) * (-563.435) (-565.009) (-560.674) [-562.956] -- 0:00:29
      527000 -- [-565.427] (-560.956) (-560.945) (-560.357) * (-562.638) [-563.694] (-562.596) (-562.786) -- 0:00:29
      527500 -- (-563.863) (-562.003) [-560.832] (-561.136) * [-561.741] (-562.095) (-561.998) (-563.012) -- 0:00:29
      528000 -- (-562.388) (-561.303) [-562.126] (-562.951) * (-561.921) (-562.346) [-561.221] (-561.927) -- 0:00:29
      528500 -- (-563.403) (-562.488) (-565.671) [-562.265] * (-562.046) (-561.588) [-561.720] (-560.407) -- 0:00:29
      529000 -- (-563.276) (-562.305) [-562.493] (-563.303) * [-561.014] (-565.074) (-561.035) (-562.626) -- 0:00:29
      529500 -- (-563.041) (-566.735) (-562.778) [-565.970] * (-565.239) [-567.590] (-561.209) (-570.340) -- 0:00:29
      530000 -- [-562.053] (-564.735) (-563.511) (-560.898) * [-565.069] (-569.126) (-562.149) (-561.906) -- 0:00:29

      Average standard deviation of split frequencies: 0.011430

      530500 -- [-564.645] (-563.738) (-565.067) (-562.948) * (-563.609) (-561.425) (-560.447) [-560.837] -- 0:00:29
      531000 -- [-561.479] (-562.139) (-563.977) (-563.438) * (-561.295) [-562.032] (-560.856) (-564.937) -- 0:00:29
      531500 -- (-561.748) (-565.191) [-564.802] (-564.381) * (-562.146) [-561.531] (-561.338) (-561.163) -- 0:00:29
      532000 -- (-562.125) [-561.064] (-563.037) (-561.777) * (-562.694) (-561.768) (-562.557) [-560.767] -- 0:00:29
      532500 -- (-561.448) (-561.114) [-562.719] (-567.004) * [-562.421] (-561.526) (-561.751) (-562.400) -- 0:00:28
      533000 -- [-561.143] (-562.252) (-561.453) (-562.774) * (-565.026) [-561.688] (-561.595) (-561.340) -- 0:00:28
      533500 -- (-561.921) (-562.133) (-563.365) [-563.190] * (-563.137) (-561.909) [-562.583] (-561.640) -- 0:00:28
      534000 -- [-563.082] (-561.558) (-560.689) (-560.934) * [-563.301] (-562.596) (-561.918) (-564.115) -- 0:00:28
      534500 -- (-562.891) [-560.996] (-563.344) (-560.993) * (-564.036) (-563.260) (-562.752) [-562.251] -- 0:00:28
      535000 -- (-561.273) [-561.192] (-563.740) (-561.599) * (-565.133) (-563.739) (-563.022) [-564.870] -- 0:00:28

      Average standard deviation of split frequencies: 0.011023

      535500 -- (-561.013) (-565.174) [-562.353] (-564.306) * [-561.416] (-561.702) (-562.899) (-564.529) -- 0:00:28
      536000 -- (-561.285) [-563.227] (-560.586) (-561.232) * (-561.972) (-561.064) [-563.030] (-561.943) -- 0:00:28
      536500 -- (-564.450) [-561.653] (-564.405) (-565.648) * (-562.094) [-560.730] (-562.426) (-561.940) -- 0:00:28
      537000 -- (-561.402) (-561.152) [-564.275] (-563.225) * (-561.702) (-562.749) [-565.948] (-561.338) -- 0:00:28
      537500 -- (-562.684) [-564.478] (-561.842) (-561.956) * (-561.163) (-563.033) (-565.518) [-560.878] -- 0:00:28
      538000 -- (-564.859) (-564.724) (-563.514) [-561.408] * (-560.707) [-563.952] (-562.674) (-563.441) -- 0:00:28
      538500 -- (-563.093) (-563.250) (-565.110) [-561.493] * (-560.624) (-564.058) [-562.634] (-562.332) -- 0:00:28
      539000 -- (-565.252) [-562.515] (-561.750) (-563.453) * [-562.952] (-561.725) (-563.423) (-562.339) -- 0:00:28
      539500 -- (-561.482) (-563.395) [-563.508] (-562.650) * [-561.895] (-571.713) (-563.501) (-562.880) -- 0:00:28
      540000 -- (-565.764) [-561.719] (-562.759) (-565.755) * [-562.810] (-564.224) (-562.624) (-560.642) -- 0:00:28

      Average standard deviation of split frequencies: 0.010637

      540500 -- (-564.269) (-563.236) [-562.056] (-569.972) * (-560.857) (-569.632) [-561.871] (-566.994) -- 0:00:28
      541000 -- (-565.390) (-564.394) [-564.228] (-571.611) * [-562.875] (-560.480) (-562.465) (-562.263) -- 0:00:28
      541500 -- (-566.497) (-561.863) [-561.625] (-566.135) * (-564.036) (-563.069) (-561.932) [-562.544] -- 0:00:28
      542000 -- (-561.718) (-561.771) [-560.878] (-562.659) * (-563.254) (-562.922) [-562.266] (-562.455) -- 0:00:28
      542500 -- (-562.076) [-562.311] (-561.529) (-562.438) * (-562.686) (-565.996) (-563.868) [-562.176] -- 0:00:28
      543000 -- (-568.718) [-562.291] (-566.287) (-561.017) * [-560.431] (-561.253) (-561.912) (-564.062) -- 0:00:28
      543500 -- (-565.076) (-562.476) [-564.557] (-562.026) * [-560.291] (-561.865) (-565.093) (-563.149) -- 0:00:28
      544000 -- (-566.140) [-560.813] (-564.222) (-565.726) * [-564.284] (-563.836) (-564.278) (-569.156) -- 0:00:28
      544500 -- (-564.878) [-560.459] (-564.155) (-562.963) * [-562.107] (-562.807) (-564.900) (-566.058) -- 0:00:28
      545000 -- (-566.819) [-561.549] (-563.059) (-560.567) * (-562.403) (-561.852) [-562.680] (-561.159) -- 0:00:28

      Average standard deviation of split frequencies: 0.010073

      545500 -- (-565.549) (-565.099) [-565.795] (-561.382) * (-563.486) (-560.615) (-562.785) [-564.665] -- 0:00:28
      546000 -- (-563.898) (-568.452) [-568.072] (-565.153) * (-565.126) (-560.615) [-561.232] (-561.723) -- 0:00:28
      546500 -- (-560.575) (-566.500) (-564.019) [-564.334] * (-564.037) (-563.483) [-564.421] (-561.491) -- 0:00:28
      547000 -- (-562.787) (-563.140) (-568.575) [-563.134] * (-561.675) (-563.552) [-562.344] (-565.391) -- 0:00:28
      547500 -- (-561.271) [-560.735] (-566.292) (-563.143) * (-563.419) (-566.382) (-561.072) [-564.052] -- 0:00:28
      548000 -- [-561.528] (-562.296) (-567.389) (-560.614) * (-560.543) (-564.841) (-561.819) [-562.356] -- 0:00:28
      548500 -- (-561.387) (-560.667) (-562.747) [-563.230] * (-561.112) (-564.282) [-566.853] (-561.635) -- 0:00:27
      549000 -- (-562.748) (-560.265) [-562.277] (-562.117) * [-563.613] (-563.083) (-563.256) (-564.634) -- 0:00:27
      549500 -- [-565.258] (-561.128) (-564.536) (-563.999) * (-561.171) [-562.500] (-562.042) (-565.696) -- 0:00:27
      550000 -- (-561.281) (-563.190) [-563.025] (-561.048) * (-562.209) [-562.626] (-565.131) (-563.909) -- 0:00:27

      Average standard deviation of split frequencies: 0.009702

      550500 -- [-565.755] (-561.533) (-561.794) (-562.514) * [-562.847] (-560.977) (-561.996) (-562.329) -- 0:00:27
      551000 -- [-563.241] (-562.327) (-562.426) (-560.795) * (-565.940) [-565.169] (-560.992) (-564.954) -- 0:00:27
      551500 -- (-560.739) (-562.127) (-561.856) [-560.811] * (-569.240) [-566.752] (-563.833) (-561.176) -- 0:00:27
      552000 -- (-566.358) (-562.988) (-561.312) [-563.523] * (-563.888) (-564.260) (-562.159) [-561.566] -- 0:00:27
      552500 -- (-565.469) (-562.147) (-563.942) [-561.443] * (-563.464) (-561.622) [-563.376] (-561.765) -- 0:00:27
      553000 -- (-563.006) (-560.865) [-561.316] (-563.492) * [-560.935] (-562.101) (-561.831) (-562.671) -- 0:00:27
      553500 -- (-561.530) [-562.515] (-562.361) (-563.488) * (-561.690) [-565.849] (-562.359) (-561.409) -- 0:00:27
      554000 -- (-561.375) [-561.655] (-564.161) (-562.589) * (-561.184) (-561.816) [-561.381] (-562.413) -- 0:00:27
      554500 -- (-562.588) [-562.564] (-562.162) (-561.293) * (-561.399) [-560.284] (-564.208) (-561.086) -- 0:00:27
      555000 -- (-562.524) (-561.966) [-560.533] (-564.557) * (-562.439) (-560.290) (-562.347) [-563.272] -- 0:00:27

      Average standard deviation of split frequencies: 0.009496

      555500 -- (-563.826) [-560.865] (-562.581) (-561.176) * (-561.119) (-561.651) [-561.417] (-562.687) -- 0:00:28
      556000 -- [-563.169] (-566.872) (-561.276) (-560.818) * (-562.194) (-563.272) (-564.360) [-563.944] -- 0:00:27
      556500 -- (-565.676) (-564.497) [-560.810] (-563.374) * (-564.666) (-565.216) [-563.011] (-562.497) -- 0:00:27
      557000 -- (-561.757) (-565.458) [-561.419] (-565.079) * (-562.121) (-562.031) (-561.282) [-563.332] -- 0:00:27
      557500 -- (-561.115) (-561.859) [-561.652] (-562.517) * (-561.398) (-564.975) [-561.996] (-562.206) -- 0:00:27
      558000 -- (-565.850) [-565.599] (-562.360) (-562.833) * (-560.618) (-562.176) (-565.243) [-563.017] -- 0:00:27
      558500 -- (-561.955) (-561.117) [-562.285] (-561.516) * (-560.393) (-561.573) (-561.339) [-561.477] -- 0:00:27
      559000 -- (-562.291) (-562.304) (-562.400) [-560.738] * (-561.951) [-560.516] (-562.232) (-561.465) -- 0:00:27
      559500 -- [-560.592] (-563.145) (-562.118) (-561.335) * (-561.825) [-561.964] (-561.189) (-561.314) -- 0:00:27
      560000 -- (-561.554) (-566.103) (-561.182) [-563.467] * (-561.332) (-562.601) (-569.933) [-561.135] -- 0:00:27

      Average standard deviation of split frequencies: 0.009753

      560500 -- (-560.605) (-562.172) (-560.977) [-561.671] * [-562.104] (-562.963) (-571.293) (-562.920) -- 0:00:27
      561000 -- [-561.856] (-564.417) (-560.340) (-560.601) * (-565.742) (-563.652) (-561.955) [-562.928] -- 0:00:27
      561500 -- [-563.518] (-562.059) (-566.042) (-564.978) * [-568.222] (-561.378) (-562.205) (-561.998) -- 0:00:27
      562000 -- [-562.417] (-563.086) (-565.791) (-561.749) * (-563.306) (-561.885) (-562.926) [-563.940] -- 0:00:27
      562500 -- (-564.843) (-563.921) [-563.245] (-561.376) * (-561.436) [-561.419] (-563.889) (-563.585) -- 0:00:27
      563000 -- [-562.132] (-561.861) (-564.160) (-562.677) * (-560.456) (-564.762) [-561.086] (-562.001) -- 0:00:27
      563500 -- (-563.959) [-562.624] (-562.960) (-565.130) * (-561.181) [-561.562] (-561.151) (-564.327) -- 0:00:27
      564000 -- (-568.079) (-563.809) (-562.520) [-563.169] * (-563.209) [-562.792] (-561.575) (-564.115) -- 0:00:27
      564500 -- [-561.730] (-562.980) (-564.506) (-566.700) * [-560.767] (-563.316) (-562.971) (-563.477) -- 0:00:27
      565000 -- [-560.850] (-563.115) (-561.342) (-563.236) * (-562.724) (-562.104) (-562.226) [-563.613] -- 0:00:26

      Average standard deviation of split frequencies: 0.009550

      565500 -- [-563.131] (-561.676) (-565.705) (-562.098) * (-564.443) [-561.392] (-565.159) (-567.742) -- 0:00:26
      566000 -- (-561.641) (-563.149) (-560.779) [-561.730] * (-565.788) [-561.489] (-562.043) (-563.918) -- 0:00:26
      566500 -- (-560.820) [-565.060] (-564.784) (-569.341) * (-565.114) (-562.022) [-561.751] (-560.742) -- 0:00:26
      567000 -- (-561.288) [-560.358] (-561.917) (-565.363) * (-563.079) [-561.903] (-561.106) (-561.648) -- 0:00:26
      567500 -- (-561.610) (-561.580) [-561.588] (-564.330) * [-563.850] (-561.599) (-562.595) (-564.545) -- 0:00:26
      568000 -- (-561.032) (-562.524) [-560.705] (-561.886) * (-566.036) (-562.654) (-561.120) [-564.330] -- 0:00:26
      568500 -- (-561.951) [-561.010] (-562.602) (-565.388) * (-561.718) (-570.706) (-561.367) [-562.681] -- 0:00:26
      569000 -- [-561.633] (-562.707) (-563.178) (-565.533) * [-561.203] (-564.220) (-561.421) (-561.748) -- 0:00:26
      569500 -- (-564.413) (-563.735) [-561.684] (-561.443) * [-566.422] (-561.142) (-566.970) (-562.068) -- 0:00:26
      570000 -- (-562.373) [-561.373] (-560.752) (-563.185) * (-565.336) [-562.617] (-562.790) (-562.795) -- 0:00:26

      Average standard deviation of split frequencies: 0.009362

      570500 -- (-561.808) [-564.823] (-560.313) (-562.588) * (-563.633) [-561.134] (-566.997) (-561.469) -- 0:00:26
      571000 -- (-565.475) (-561.078) [-561.999] (-562.033) * (-564.966) (-563.555) (-565.322) [-561.249] -- 0:00:26
      571500 -- (-569.425) [-562.512] (-561.831) (-562.049) * [-562.275] (-564.873) (-563.339) (-565.594) -- 0:00:26
      572000 -- (-562.408) (-563.729) [-562.966] (-569.515) * (-565.111) [-560.758] (-561.832) (-562.117) -- 0:00:26
      572500 -- [-561.779] (-563.758) (-565.785) (-563.525) * [-561.939] (-561.500) (-561.979) (-563.041) -- 0:00:26
      573000 -- (-561.902) [-564.470] (-569.175) (-567.854) * [-563.268] (-562.587) (-560.886) (-563.368) -- 0:00:26
      573500 -- [-563.348] (-564.453) (-562.621) (-565.181) * [-560.700] (-563.040) (-563.281) (-561.233) -- 0:00:26
      574000 -- (-565.385) [-561.761] (-561.513) (-561.461) * (-561.163) (-565.531) (-561.937) [-561.696] -- 0:00:26
      574500 -- [-560.424] (-563.590) (-560.611) (-560.825) * (-563.866) [-561.244] (-561.877) (-562.271) -- 0:00:26
      575000 -- (-560.442) [-561.116] (-562.232) (-562.157) * (-564.885) [-561.985] (-561.104) (-564.371) -- 0:00:26

      Average standard deviation of split frequencies: 0.009275

      575500 -- (-564.291) (-561.282) [-562.811] (-561.150) * (-565.892) (-564.835) (-564.253) [-561.491] -- 0:00:26
      576000 -- (-562.645) [-562.430] (-568.054) (-563.476) * [-561.418] (-565.105) (-563.707) (-561.614) -- 0:00:26
      576500 -- (-563.557) [-562.067] (-561.080) (-562.795) * (-561.621) (-563.815) [-562.046] (-561.483) -- 0:00:26
      577000 -- (-563.419) [-561.339] (-565.089) (-565.857) * (-562.190) [-560.331] (-567.907) (-565.361) -- 0:00:26
      577500 -- [-561.344] (-561.811) (-564.046) (-566.813) * (-569.135) (-560.841) (-565.126) [-566.639] -- 0:00:26
      578000 -- (-561.356) (-561.920) (-560.904) [-560.966] * (-566.601) [-560.339] (-560.639) (-574.676) -- 0:00:26
      578500 -- (-566.476) (-563.337) (-564.487) [-563.872] * [-560.427] (-561.361) (-566.710) (-565.552) -- 0:00:26
      579000 -- [-562.744] (-561.446) (-566.096) (-560.314) * (-562.393) (-560.603) [-563.372] (-561.888) -- 0:00:26
      579500 -- (-562.704) (-561.340) (-566.065) [-563.244] * [-561.732] (-560.524) (-562.133) (-562.236) -- 0:00:26
      580000 -- [-564.444] (-562.126) (-563.573) (-563.190) * (-560.300) (-567.443) [-563.435] (-568.657) -- 0:00:26

      Average standard deviation of split frequencies: 0.009363

      580500 -- (-565.489) [-561.920] (-569.196) (-565.657) * (-560.492) (-561.728) (-562.440) [-562.324] -- 0:00:26
      581000 -- (-565.586) (-561.537) (-563.775) [-561.481] * (-562.290) (-565.579) (-561.187) [-562.367] -- 0:00:25
      581500 -- (-564.445) (-562.994) (-562.499) [-563.421] * (-562.811) [-561.466] (-562.709) (-560.294) -- 0:00:25
      582000 -- (-564.001) (-562.893) (-560.785) [-564.970] * (-563.046) [-561.975] (-564.729) (-560.275) -- 0:00:25
      582500 -- [-563.129] (-564.129) (-562.013) (-565.636) * (-562.316) [-561.451] (-561.477) (-562.523) -- 0:00:25
      583000 -- (-560.920) (-563.133) (-561.044) [-563.512] * (-561.275) [-561.908] (-561.549) (-562.121) -- 0:00:25
      583500 -- (-562.430) [-561.267] (-562.822) (-563.160) * [-560.889] (-561.698) (-562.193) (-561.021) -- 0:00:25
      584000 -- (-561.152) (-562.527) (-561.968) [-562.901] * (-562.526) [-561.534] (-561.809) (-560.521) -- 0:00:25
      584500 -- (-561.876) (-565.382) (-567.247) [-561.686] * (-564.489) (-561.902) [-562.212] (-563.564) -- 0:00:25
      585000 -- (-563.162) (-561.126) (-567.313) [-563.241] * (-564.298) (-561.234) (-561.013) [-563.685] -- 0:00:25

      Average standard deviation of split frequencies: 0.009224

      585500 -- (-562.893) (-562.414) [-561.606] (-563.092) * (-563.241) (-561.502) [-562.943] (-563.271) -- 0:00:25
      586000 -- [-562.565] (-563.998) (-561.777) (-562.816) * (-561.781) (-561.553) [-561.753] (-562.499) -- 0:00:26
      586500 -- (-562.301) (-561.626) [-560.442] (-564.541) * (-563.068) (-563.014) [-561.969] (-563.778) -- 0:00:26
      587000 -- (-567.707) (-563.894) (-563.227) [-563.268] * (-564.886) (-563.162) (-561.217) [-563.276] -- 0:00:26
      587500 -- (-561.902) (-564.415) [-561.023] (-562.085) * (-566.368) (-563.212) (-561.976) [-565.460] -- 0:00:25
      588000 -- (-561.072) (-565.991) [-561.909] (-560.542) * (-566.250) [-561.129] (-563.651) (-565.309) -- 0:00:25
      588500 -- (-565.904) (-565.339) [-561.900] (-560.342) * [-561.413] (-566.202) (-563.481) (-565.479) -- 0:00:25
      589000 -- (-564.115) (-563.567) [-561.042] (-560.924) * (-563.077) (-565.205) [-560.890] (-563.871) -- 0:00:25
      589500 -- (-560.721) (-560.152) [-561.345] (-560.472) * (-562.220) (-562.250) [-560.775] (-564.622) -- 0:00:25
      590000 -- (-560.425) [-561.923] (-560.986) (-561.807) * (-562.850) (-560.723) [-561.639] (-561.312) -- 0:00:25

      Average standard deviation of split frequencies: 0.008513

      590500 -- (-562.485) [-561.322] (-561.290) (-565.513) * (-561.354) (-561.829) [-562.707] (-563.648) -- 0:00:25
      591000 -- (-564.049) (-561.187) [-563.407] (-561.670) * (-561.953) (-561.236) (-562.589) [-562.365] -- 0:00:25
      591500 -- (-562.034) (-565.912) (-563.989) [-560.885] * (-562.092) (-562.859) [-565.284] (-563.593) -- 0:00:25
      592000 -- (-560.657) (-561.781) (-565.014) [-561.995] * (-562.880) (-562.537) [-562.504] (-562.807) -- 0:00:25
      592500 -- (-564.676) (-560.594) (-567.498) [-563.986] * [-562.009] (-562.102) (-566.542) (-567.508) -- 0:00:25
      593000 -- (-561.390) (-564.031) (-568.292) [-563.325] * (-563.554) [-561.583] (-564.223) (-563.887) -- 0:00:25
      593500 -- [-560.475] (-561.740) (-564.982) (-561.558) * [-563.313] (-563.240) (-566.166) (-561.585) -- 0:00:25
      594000 -- (-561.790) (-568.927) [-562.623] (-560.678) * (-562.249) (-565.680) (-560.828) [-561.640] -- 0:00:25
      594500 -- (-563.715) [-560.550] (-561.369) (-562.422) * (-564.435) (-562.417) [-561.184] (-562.307) -- 0:00:25
      595000 -- (-563.224) (-562.614) [-564.100] (-561.753) * (-562.137) [-560.384] (-561.898) (-562.908) -- 0:00:25

      Average standard deviation of split frequencies: 0.008859

      595500 -- (-565.351) [-562.138] (-560.495) (-563.174) * (-561.566) [-560.411] (-565.159) (-563.574) -- 0:00:25
      596000 -- (-561.653) [-562.420] (-561.443) (-565.808) * (-562.807) (-561.775) (-561.921) [-561.172] -- 0:00:25
      596500 -- (-561.588) [-562.930] (-562.710) (-562.357) * [-561.330] (-563.009) (-562.945) (-561.222) -- 0:00:25
      597000 -- (-562.862) (-562.451) [-563.722] (-561.726) * (-563.529) (-562.932) [-562.544] (-563.667) -- 0:00:24
      597500 -- (-563.467) (-564.084) [-564.575] (-561.729) * (-561.593) [-561.724] (-564.762) (-563.618) -- 0:00:24
      598000 -- [-562.861] (-561.682) (-561.944) (-560.357) * (-561.850) (-564.523) (-561.683) [-561.233] -- 0:00:25
      598500 -- (-562.899) (-562.402) [-561.737] (-561.130) * (-565.127) (-562.032) [-561.707] (-563.915) -- 0:00:25
      599000 -- (-562.568) [-562.799] (-563.564) (-562.519) * (-563.721) (-563.030) (-561.181) [-563.178] -- 0:00:25
      599500 -- (-563.141) (-560.864) (-566.282) [-561.921] * (-562.065) [-563.936] (-560.869) (-560.766) -- 0:00:25
      600000 -- (-562.093) [-563.402] (-561.959) (-563.630) * [-562.762] (-563.496) (-560.954) (-562.337) -- 0:00:25

      Average standard deviation of split frequencies: 0.008528

      600500 -- (-561.601) [-564.919] (-562.063) (-563.573) * [-561.769] (-562.258) (-563.222) (-562.413) -- 0:00:25
      601000 -- (-560.678) (-562.539) [-561.714] (-562.590) * [-560.656] (-562.874) (-562.850) (-565.489) -- 0:00:25
      601500 -- [-560.931] (-562.170) (-562.240) (-562.615) * (-560.389) (-562.263) (-565.707) [-562.092] -- 0:00:25
      602000 -- [-560.512] (-562.705) (-562.618) (-562.540) * (-560.450) [-560.895] (-564.965) (-565.526) -- 0:00:25
      602500 -- [-561.679] (-560.616) (-567.017) (-562.410) * (-560.895) (-561.801) (-564.252) [-565.306] -- 0:00:25
      603000 -- (-561.349) (-561.190) (-561.518) [-561.559] * (-562.239) (-563.802) [-562.937] (-561.780) -- 0:00:25
      603500 -- [-561.585] (-562.659) (-561.489) (-562.025) * (-565.722) (-562.775) (-564.572) [-561.313] -- 0:00:24
      604000 -- (-563.851) [-561.111] (-562.160) (-564.744) * [-561.883] (-566.744) (-563.181) (-561.155) -- 0:00:24
      604500 -- (-561.947) (-563.611) [-561.864] (-564.069) * [-563.019] (-562.020) (-561.187) (-565.623) -- 0:00:24
      605000 -- [-561.795] (-565.018) (-562.026) (-561.575) * (-562.302) (-565.296) [-562.776] (-563.187) -- 0:00:24

      Average standard deviation of split frequencies: 0.009024

      605500 -- (-562.374) (-565.463) [-561.996] (-564.519) * (-563.430) [-560.666] (-563.238) (-563.255) -- 0:00:24
      606000 -- (-563.162) [-562.301] (-563.751) (-564.611) * (-571.709) (-567.360) (-563.114) [-561.407] -- 0:00:24
      606500 -- (-561.490) (-562.130) (-562.213) [-563.062] * (-565.037) (-572.151) (-561.360) [-563.455] -- 0:00:24
      607000 -- (-563.502) (-562.342) [-562.097] (-563.345) * (-567.138) (-566.303) [-564.541] (-563.851) -- 0:00:24
      607500 -- (-564.363) (-560.896) [-563.331] (-563.700) * (-566.668) [-561.565] (-563.491) (-564.187) -- 0:00:24
      608000 -- (-562.508) [-562.279] (-571.065) (-561.127) * (-564.406) [-562.298] (-563.174) (-564.899) -- 0:00:24
      608500 -- (-563.580) [-564.496] (-562.666) (-561.613) * (-563.476) [-562.153] (-565.072) (-564.760) -- 0:00:24
      609000 -- (-564.863) (-563.093) [-563.480] (-564.360) * (-560.990) (-561.524) [-561.654] (-560.631) -- 0:00:24
      609500 -- (-562.113) [-560.924] (-563.033) (-562.547) * (-562.756) (-566.649) (-564.979) [-560.098] -- 0:00:24
      610000 -- (-561.736) (-562.668) (-566.354) [-561.143] * [-561.331] (-565.728) (-563.254) (-560.742) -- 0:00:24

      Average standard deviation of split frequencies: 0.009263

      610500 -- [-560.978] (-563.065) (-563.332) (-560.902) * (-563.151) (-564.776) [-562.209] (-561.307) -- 0:00:24
      611000 -- (-564.787) (-561.482) [-563.594] (-560.629) * (-565.557) (-562.327) [-560.811] (-561.560) -- 0:00:24
      611500 -- [-562.278] (-563.384) (-562.793) (-564.788) * (-565.250) (-562.703) [-560.806] (-561.691) -- 0:00:24
      612000 -- (-560.613) (-561.854) [-561.355] (-564.098) * (-563.177) [-560.962] (-562.773) (-563.080) -- 0:00:24
      612500 -- [-561.567] (-563.280) (-565.540) (-561.206) * (-563.379) [-563.917] (-562.940) (-562.531) -- 0:00:24
      613000 -- [-561.934] (-561.747) (-566.399) (-562.122) * (-564.268) (-562.829) (-565.387) [-562.858] -- 0:00:24
      613500 -- [-562.081] (-565.521) (-562.135) (-565.017) * (-561.683) (-562.543) (-563.721) [-563.941] -- 0:00:24
      614000 -- (-561.945) (-563.629) (-564.493) [-561.105] * (-560.890) [-562.107] (-561.825) (-561.316) -- 0:00:24
      614500 -- (-562.529) [-568.819] (-560.809) (-562.103) * (-561.535) [-560.925] (-562.608) (-561.781) -- 0:00:24
      615000 -- [-561.907] (-566.006) (-562.051) (-566.132) * (-563.972) [-561.136] (-569.434) (-560.889) -- 0:00:24

      Average standard deviation of split frequencies: 0.008561

      615500 -- (-562.127) [-565.067] (-564.205) (-562.510) * (-561.664) [-563.731] (-563.349) (-563.208) -- 0:00:24
      616000 -- [-561.398] (-562.385) (-563.335) (-564.008) * (-562.916) (-564.778) [-562.544] (-562.554) -- 0:00:24
      616500 -- [-562.334] (-565.473) (-562.270) (-562.335) * (-566.271) (-560.727) [-561.828] (-563.478) -- 0:00:24
      617000 -- (-563.322) [-565.263] (-560.903) (-562.212) * [-562.931] (-560.590) (-564.071) (-565.335) -- 0:00:24
      617500 -- (-562.768) [-562.239] (-561.851) (-561.658) * (-561.077) (-561.316) [-562.445] (-562.922) -- 0:00:24
      618000 -- (-560.535) (-570.673) [-561.077] (-562.826) * (-561.671) [-560.639] (-562.771) (-563.992) -- 0:00:24
      618500 -- (-561.961) [-563.134] (-560.680) (-562.438) * (-560.412) [-561.837] (-561.523) (-563.863) -- 0:00:24
      619000 -- (-561.526) (-562.652) [-560.964] (-562.729) * [-564.942] (-562.953) (-561.861) (-568.818) -- 0:00:24
      619500 -- (-563.250) (-561.595) [-561.704] (-561.559) * (-562.798) (-561.866) [-561.861] (-562.699) -- 0:00:23
      620000 -- (-562.800) [-565.321] (-563.825) (-562.430) * (-570.183) (-562.751) (-563.142) [-560.451] -- 0:00:23

      Average standard deviation of split frequencies: 0.008212

      620500 -- (-561.354) (-561.863) (-560.314) [-562.726] * (-562.677) (-563.144) (-562.452) [-560.207] -- 0:00:23
      621000 -- (-560.368) [-561.288] (-561.202) (-562.433) * (-563.384) (-561.138) (-560.705) [-564.862] -- 0:00:23
      621500 -- (-560.798) (-562.594) (-560.863) [-564.207] * (-561.056) (-562.896) [-561.217] (-568.068) -- 0:00:23
      622000 -- [-562.072] (-563.813) (-563.811) (-561.715) * (-563.544) (-562.823) (-560.482) [-562.226] -- 0:00:23
      622500 -- (-561.527) (-562.463) [-561.825] (-561.906) * (-560.323) (-563.762) (-560.895) [-561.672] -- 0:00:23
      623000 -- (-561.455) (-565.789) (-563.070) [-561.364] * (-562.042) (-561.983) [-562.449] (-563.835) -- 0:00:23
      623500 -- (-561.477) [-560.699] (-562.605) (-562.967) * (-561.184) [-563.074] (-561.275) (-561.253) -- 0:00:23
      624000 -- (-563.423) (-564.025) [-566.262] (-562.931) * (-564.248) (-566.148) (-563.015) [-562.613] -- 0:00:23
      624500 -- (-562.814) [-562.645] (-563.585) (-561.930) * [-563.373] (-563.691) (-562.311) (-561.427) -- 0:00:23
      625000 -- [-561.801] (-563.619) (-562.806) (-561.534) * (-561.358) (-562.236) [-565.416] (-562.990) -- 0:00:23

      Average standard deviation of split frequencies: 0.009037

      625500 -- (-566.160) (-563.431) (-561.010) [-563.070] * (-562.759) [-562.327] (-565.955) (-563.260) -- 0:00:23
      626000 -- (-563.229) (-561.679) [-563.013] (-563.692) * [-564.441] (-562.275) (-561.301) (-564.022) -- 0:00:23
      626500 -- [-563.378] (-563.369) (-561.523) (-566.069) * (-562.845) (-562.790) (-562.474) [-561.017] -- 0:00:23
      627000 -- (-562.397) (-561.401) [-561.150] (-563.290) * [-562.094] (-561.910) (-563.886) (-563.276) -- 0:00:23
      627500 -- (-564.011) (-564.005) [-564.418] (-566.856) * (-561.549) [-563.299] (-561.804) (-563.264) -- 0:00:23
      628000 -- (-563.290) (-563.031) [-562.093] (-561.064) * [-564.767] (-562.472) (-562.275) (-560.893) -- 0:00:23
      628500 -- (-562.548) (-566.172) (-561.317) [-561.550] * (-564.408) [-566.198] (-560.810) (-561.518) -- 0:00:23
      629000 -- (-561.018) (-562.453) (-562.283) [-561.665] * [-563.832] (-561.527) (-563.106) (-562.394) -- 0:00:23
      629500 -- (-564.844) (-562.563) [-566.621] (-560.983) * (-561.764) [-560.636] (-563.765) (-570.852) -- 0:00:22
      630000 -- (-562.984) [-563.733] (-562.978) (-562.216) * [-561.832] (-563.528) (-562.785) (-563.907) -- 0:00:23

      Average standard deviation of split frequencies: 0.009518

      630500 -- [-562.236] (-561.797) (-564.215) (-561.983) * (-561.119) [-563.247] (-563.225) (-562.806) -- 0:00:23
      631000 -- (-561.537) (-561.601) (-567.869) [-565.725] * (-569.550) (-563.065) [-561.109] (-563.842) -- 0:00:23
      631500 -- [-561.244] (-562.632) (-564.873) (-560.869) * (-565.529) [-560.705] (-564.281) (-565.662) -- 0:00:23
      632000 -- [-563.589] (-561.619) (-564.279) (-564.338) * (-563.108) (-561.040) [-562.319] (-562.739) -- 0:00:23
      632500 -- (-564.310) (-560.849) [-563.149] (-561.399) * (-562.183) (-561.106) [-561.023] (-561.674) -- 0:00:23
      633000 -- (-561.720) (-560.888) [-560.527] (-561.610) * (-560.837) (-563.334) [-564.747] (-560.906) -- 0:00:23
      633500 -- (-560.801) (-561.889) [-561.036] (-561.221) * (-563.005) [-563.519] (-563.005) (-561.931) -- 0:00:23
      634000 -- [-560.796] (-561.163) (-561.122) (-562.317) * [-561.652] (-562.299) (-561.194) (-561.764) -- 0:00:23
      634500 -- (-565.626) [-561.157] (-561.628) (-561.583) * (-561.177) (-563.056) (-561.578) [-563.616] -- 0:00:23
      635000 -- (-570.654) [-561.112] (-561.871) (-562.366) * (-562.183) (-560.936) [-561.987] (-561.334) -- 0:00:22

      Average standard deviation of split frequencies: 0.009543

      635500 -- (-563.028) (-565.694) [-563.019] (-563.230) * [-564.975] (-560.729) (-562.932) (-563.125) -- 0:00:22
      636000 -- (-564.271) (-563.624) (-562.314) [-561.306] * (-562.771) (-563.425) (-565.010) [-562.645] -- 0:00:22
      636500 -- (-564.568) [-562.433] (-561.243) (-565.599) * (-565.084) (-562.314) [-562.481] (-565.768) -- 0:00:22
      637000 -- (-565.023) (-565.161) [-562.950] (-564.090) * (-562.920) (-563.522) [-561.122] (-562.390) -- 0:00:22
      637500 -- [-560.842] (-564.127) (-565.715) (-565.153) * [-562.048] (-563.762) (-564.746) (-561.842) -- 0:00:22
      638000 -- [-561.798] (-563.079) (-560.907) (-562.683) * [-564.698] (-565.934) (-564.349) (-566.707) -- 0:00:22
      638500 -- (-562.385) [-561.827] (-563.596) (-560.945) * [-563.244] (-562.840) (-562.152) (-561.583) -- 0:00:22
      639000 -- [-563.404] (-560.704) (-561.251) (-561.544) * (-561.801) (-564.074) [-561.154] (-562.771) -- 0:00:22
      639500 -- (-562.950) (-562.456) [-564.145] (-564.170) * [-563.213] (-561.939) (-564.183) (-567.527) -- 0:00:22
      640000 -- (-563.080) (-561.266) (-563.660) [-565.027] * (-562.388) [-562.062] (-565.378) (-561.906) -- 0:00:22

      Average standard deviation of split frequencies: 0.009795

      640500 -- (-563.258) [-562.931] (-563.076) (-564.392) * [-562.403] (-561.690) (-563.310) (-563.848) -- 0:00:22
      641000 -- (-566.234) (-560.950) [-563.325] (-560.925) * [-560.994] (-561.811) (-564.109) (-566.145) -- 0:00:22
      641500 -- (-565.423) (-562.883) [-565.063] (-562.250) * (-563.205) (-560.532) (-561.621) [-563.787] -- 0:00:22
      642000 -- (-563.000) [-562.219] (-566.102) (-562.063) * (-561.743) (-562.756) [-561.877] (-561.983) -- 0:00:22
      642500 -- [-565.385] (-561.470) (-564.336) (-560.968) * (-561.992) (-566.523) (-562.212) [-561.251] -- 0:00:22
      643000 -- [-560.308] (-561.624) (-563.613) (-564.449) * (-560.854) (-561.626) (-566.952) [-562.206] -- 0:00:22
      643500 -- [-562.653] (-564.439) (-564.547) (-563.355) * (-563.446) (-567.771) (-567.443) [-563.331] -- 0:00:22
      644000 -- (-565.029) (-561.493) (-563.318) [-561.677] * (-562.594) (-567.630) (-562.241) [-562.881] -- 0:00:22
      644500 -- [-563.639] (-562.080) (-561.158) (-565.320) * (-562.660) (-565.563) [-560.622] (-562.496) -- 0:00:22
      645000 -- [-562.725] (-564.648) (-561.962) (-563.221) * (-561.747) (-561.695) [-560.626] (-561.442) -- 0:00:22

      Average standard deviation of split frequencies: 0.010079

      645500 -- (-563.726) (-562.813) (-562.022) [-567.472] * (-562.143) [-562.409] (-561.480) (-566.969) -- 0:00:21
      646000 -- [-563.352] (-563.475) (-562.034) (-564.550) * (-562.046) [-562.107] (-560.781) (-561.331) -- 0:00:21
      646500 -- [-560.734] (-563.382) (-563.519) (-563.767) * (-561.174) (-562.779) [-562.019] (-566.769) -- 0:00:21
      647000 -- (-562.479) (-562.065) (-563.187) [-563.185] * (-562.008) [-562.418] (-565.480) (-564.087) -- 0:00:22
      647500 -- (-561.159) (-564.188) (-563.495) [-562.839] * (-561.629) (-561.513) [-562.913] (-562.041) -- 0:00:22
      648000 -- [-562.822] (-567.772) (-564.117) (-561.711) * (-561.753) (-565.136) (-562.136) [-561.060] -- 0:00:22
      648500 -- (-564.229) (-566.502) [-562.294] (-562.595) * (-563.947) [-564.654] (-563.134) (-562.477) -- 0:00:22
      649000 -- (-566.011) (-562.585) (-561.405) [-562.504] * (-562.128) (-568.487) [-564.748] (-562.028) -- 0:00:22
      649500 -- (-565.467) [-564.248] (-565.382) (-561.160) * (-572.487) (-565.538) [-561.723] (-561.198) -- 0:00:22
      650000 -- (-571.225) (-563.766) [-562.908] (-561.223) * [-561.921] (-562.817) (-560.456) (-560.612) -- 0:00:22

      Average standard deviation of split frequencies: 0.009600

      650500 -- (-564.166) (-560.135) [-560.403] (-561.833) * (-563.743) [-561.256] (-561.990) (-561.428) -- 0:00:22
      651000 -- [-561.920] (-560.938) (-561.550) (-566.689) * (-564.352) (-561.407) [-563.814] (-561.625) -- 0:00:21
      651500 -- (-562.132) (-562.543) (-562.074) [-561.849] * [-561.153] (-563.444) (-561.229) (-562.504) -- 0:00:21
      652000 -- (-563.161) (-563.403) (-561.196) [-560.401] * (-564.028) (-565.479) [-563.149] (-560.545) -- 0:00:21
      652500 -- (-563.079) (-562.787) [-561.524] (-562.188) * (-564.568) [-562.211] (-566.066) (-562.332) -- 0:00:21
      653000 -- (-562.995) [-563.702] (-560.837) (-562.739) * [-560.989] (-561.946) (-563.947) (-561.821) -- 0:00:21
      653500 -- (-563.484) (-563.113) (-562.824) [-560.595] * (-562.500) [-561.752] (-561.814) (-564.772) -- 0:00:21
      654000 -- (-562.509) (-563.033) (-561.430) [-562.123] * (-561.032) (-561.913) (-560.487) [-561.634] -- 0:00:21
      654500 -- (-562.424) [-562.500] (-566.257) (-561.625) * [-562.398] (-563.333) (-560.649) (-561.932) -- 0:00:21
      655000 -- (-563.131) [-563.760] (-562.595) (-564.169) * [-562.121] (-561.390) (-563.297) (-563.400) -- 0:00:21

      Average standard deviation of split frequencies: 0.008983

      655500 -- (-560.598) (-562.149) (-561.487) [-561.614] * (-563.558) [-561.143] (-560.849) (-561.245) -- 0:00:21
      656000 -- [-560.748] (-562.139) (-561.825) (-565.968) * (-562.064) (-564.878) (-562.227) [-561.835] -- 0:00:21
      656500 -- [-561.660] (-560.221) (-565.662) (-568.565) * (-566.071) [-562.832] (-563.858) (-562.195) -- 0:00:21
      657000 -- (-560.703) [-561.694] (-561.536) (-562.826) * (-562.391) (-561.632) (-561.809) [-563.318] -- 0:00:21
      657500 -- [-560.869] (-560.904) (-563.119) (-560.664) * (-563.237) (-564.231) (-563.832) [-563.133] -- 0:00:21
      658000 -- (-561.827) (-562.684) (-565.922) [-561.375] * [-560.892] (-561.100) (-562.970) (-562.708) -- 0:00:21
      658500 -- [-563.250] (-561.687) (-563.467) (-562.251) * [-561.605] (-562.065) (-568.806) (-563.201) -- 0:00:21
      659000 -- (-563.057) (-567.796) (-561.919) [-564.570] * [-562.561] (-569.327) (-564.208) (-562.455) -- 0:00:21
      659500 -- (-564.124) (-564.863) (-564.029) [-561.390] * (-561.775) (-566.845) (-562.875) [-562.114] -- 0:00:21
      660000 -- (-564.133) [-561.744] (-563.990) (-564.547) * (-561.732) (-562.565) (-563.165) [-561.732] -- 0:00:21

      Average standard deviation of split frequencies: 0.008964

      660500 -- [-563.170] (-562.674) (-565.523) (-561.636) * [-561.319] (-563.415) (-560.584) (-561.588) -- 0:00:21
      661000 -- [-566.767] (-560.891) (-567.215) (-561.033) * [-561.527] (-562.696) (-560.706) (-565.343) -- 0:00:21
      661500 -- (-563.794) (-563.396) [-563.514] (-563.827) * [-560.537] (-562.166) (-561.482) (-560.758) -- 0:00:20
      662000 -- [-560.743] (-563.568) (-562.675) (-562.289) * (-561.259) [-562.011] (-565.185) (-560.872) -- 0:00:20
      662500 -- (-562.112) (-563.738) [-561.355] (-562.189) * (-561.331) (-562.521) [-563.006] (-561.556) -- 0:00:20
      663000 -- [-562.505] (-562.447) (-562.208) (-562.242) * (-560.776) (-563.292) [-562.425] (-562.095) -- 0:00:20
      663500 -- (-562.929) (-563.545) [-561.475] (-563.873) * (-565.021) (-564.739) (-564.844) [-561.881] -- 0:00:20
      664000 -- (-568.995) (-562.751) (-564.707) [-561.408] * (-563.257) [-561.398] (-563.402) (-561.381) -- 0:00:21
      664500 -- (-564.533) (-561.771) (-563.324) [-562.431] * (-562.845) [-560.646] (-561.824) (-561.514) -- 0:00:21
      665000 -- (-564.796) (-561.815) [-561.889] (-563.850) * (-562.225) [-563.538] (-563.075) (-561.793) -- 0:00:21

      Average standard deviation of split frequencies: 0.009157

      665500 -- (-561.970) (-562.455) [-561.289] (-560.758) * (-566.875) (-566.615) [-560.494] (-563.974) -- 0:00:21
      666000 -- (-563.174) [-562.979] (-561.708) (-561.569) * [-561.503] (-564.144) (-562.631) (-562.115) -- 0:00:21
      666500 -- (-561.626) [-562.549] (-561.203) (-562.224) * [-561.123] (-562.540) (-561.141) (-568.850) -- 0:00:21
      667000 -- [-562.230] (-566.435) (-561.536) (-561.965) * [-563.035] (-564.180) (-565.713) (-568.165) -- 0:00:20
      667500 -- (-562.171) (-563.356) (-561.755) [-562.187] * (-563.530) [-563.310] (-563.943) (-564.982) -- 0:00:20
      668000 -- (-561.259) [-563.075] (-560.960) (-562.991) * (-563.682) [-561.417] (-564.126) (-562.282) -- 0:00:20
      668500 -- (-562.173) [-562.008] (-562.208) (-561.848) * (-564.344) (-562.980) [-563.254] (-561.681) -- 0:00:20
      669000 -- (-562.900) (-561.827) [-560.967] (-563.824) * (-564.935) (-562.525) (-564.969) [-561.715] -- 0:00:20
      669500 -- (-561.814) [-563.130] (-563.172) (-563.734) * (-567.642) [-562.258] (-562.860) (-562.149) -- 0:00:20
      670000 -- (-562.609) (-562.610) (-561.204) [-568.650] * (-560.672) [-561.143] (-566.781) (-562.253) -- 0:00:20

      Average standard deviation of split frequencies: 0.009357

      670500 -- (-561.930) [-560.498] (-561.756) (-564.262) * [-561.125] (-560.485) (-563.208) (-561.077) -- 0:00:20
      671000 -- (-561.289) (-566.748) (-560.612) [-564.401] * (-561.326) (-563.104) [-561.012] (-562.379) -- 0:00:20
      671500 -- [-563.818] (-561.625) (-564.583) (-563.123) * (-564.750) (-562.985) (-560.505) [-562.048] -- 0:00:20
      672000 -- (-562.670) (-564.442) (-562.366) [-561.195] * (-561.457) (-565.261) [-562.168] (-561.098) -- 0:00:20
      672500 -- (-564.725) (-562.800) (-560.449) [-561.649] * (-561.507) (-564.686) (-560.722) [-560.980] -- 0:00:20
      673000 -- (-565.742) [-563.925] (-561.347) (-564.995) * (-561.292) (-567.722) [-561.066] (-562.039) -- 0:00:20
      673500 -- (-564.763) (-564.985) [-564.356] (-563.498) * (-561.836) [-563.518] (-561.014) (-568.288) -- 0:00:20
      674000 -- (-562.348) (-561.407) [-561.049] (-564.469) * (-563.135) (-564.578) (-565.083) [-562.951] -- 0:00:20
      674500 -- (-563.239) (-563.017) (-562.982) [-561.810] * (-563.954) [-561.507] (-562.069) (-562.479) -- 0:00:20
      675000 -- [-560.751] (-561.255) (-563.141) (-561.038) * [-561.553] (-563.710) (-562.630) (-562.808) -- 0:00:20

      Average standard deviation of split frequencies: 0.008978

      675500 -- (-567.389) (-561.196) [-563.383] (-568.360) * (-560.584) (-564.303) [-561.261] (-563.985) -- 0:00:20
      676000 -- (-567.582) (-561.994) [-562.822] (-563.341) * (-566.590) (-563.068) (-561.400) [-560.600] -- 0:00:20
      676500 -- (-563.506) [-561.788] (-560.927) (-564.072) * [-563.498] (-564.160) (-563.885) (-561.102) -- 0:00:20
      677000 -- (-565.180) (-561.776) [-563.745] (-560.167) * (-560.602) [-561.474] (-568.473) (-561.024) -- 0:00:20
      677500 -- (-562.425) (-566.007) [-562.394] (-561.778) * (-563.795) (-565.047) (-565.647) [-561.743] -- 0:00:19
      678000 -- (-562.352) (-561.811) [-560.904] (-561.223) * (-561.169) (-562.611) [-560.980] (-568.334) -- 0:00:19
      678500 -- (-560.935) [-563.422] (-560.890) (-564.526) * [-560.723] (-562.888) (-561.426) (-567.529) -- 0:00:19
      679000 -- [-562.086] (-562.031) (-562.893) (-560.682) * [-560.473] (-562.880) (-561.063) (-563.760) -- 0:00:19
      679500 -- (-561.690) [-561.738] (-561.610) (-562.172) * (-561.796) (-561.940) (-562.188) [-563.644] -- 0:00:19
      680000 -- (-564.337) [-561.758] (-566.663) (-562.117) * (-565.145) [-561.618] (-561.056) (-561.641) -- 0:00:19

      Average standard deviation of split frequencies: 0.008960

      680500 -- [-564.095] (-562.434) (-563.043) (-563.289) * (-563.501) (-563.162) [-562.073] (-567.081) -- 0:00:20
      681000 -- [-563.053] (-562.675) (-563.905) (-560.990) * [-561.997] (-565.648) (-561.896) (-563.273) -- 0:00:20
      681500 -- (-560.736) (-563.607) [-562.722] (-561.545) * (-563.425) (-561.474) [-561.042] (-569.150) -- 0:00:20
      682000 -- (-561.800) [-562.037] (-562.301) (-562.889) * [-562.203] (-561.076) (-562.502) (-561.782) -- 0:00:20
      682500 -- (-562.417) [-563.695] (-563.185) (-563.922) * (-562.663) (-561.490) (-564.117) [-564.278] -- 0:00:20
      683000 -- (-564.013) (-561.597) (-560.582) [-563.093] * (-561.491) (-560.945) (-561.685) [-564.243] -- 0:00:19
      683500 -- (-561.677) (-561.199) [-563.077] (-562.630) * (-561.209) [-560.794] (-563.459) (-561.522) -- 0:00:19
      684000 -- (-561.019) (-565.564) [-564.719] (-560.849) * (-561.512) (-561.958) (-564.020) [-562.499] -- 0:00:19
      684500 -- [-560.748] (-561.853) (-563.312) (-562.196) * (-560.952) (-561.865) [-561.018] (-563.656) -- 0:00:19
      685000 -- [-560.980] (-561.332) (-565.074) (-564.211) * [-561.419] (-563.767) (-561.708) (-560.520) -- 0:00:19

      Average standard deviation of split frequencies: 0.008976

      685500 -- [-560.992] (-562.721) (-562.734) (-562.775) * [-560.456] (-562.196) (-564.212) (-564.688) -- 0:00:19
      686000 -- [-562.482] (-561.416) (-562.175) (-565.962) * [-560.936] (-561.980) (-568.887) (-566.090) -- 0:00:19
      686500 -- (-563.214) (-563.157) (-563.259) [-561.792] * (-561.951) (-562.538) (-562.594) [-565.176] -- 0:00:19
      687000 -- (-562.368) [-560.422] (-564.623) (-561.071) * (-560.716) [-562.612] (-561.562) (-562.845) -- 0:00:19
      687500 -- (-561.994) (-563.633) [-564.578] (-566.511) * (-560.565) [-561.007] (-562.765) (-562.976) -- 0:00:19
      688000 -- (-562.394) (-566.603) (-564.756) [-563.890] * (-560.489) (-561.999) (-568.846) [-561.284] -- 0:00:19
      688500 -- (-562.834) (-564.849) (-562.516) [-561.303] * [-563.063] (-563.365) (-560.428) (-560.507) -- 0:00:19
      689000 -- (-564.603) (-565.800) (-561.228) [-561.651] * (-566.176) (-562.402) (-560.708) [-563.846] -- 0:00:19
      689500 -- (-565.074) [-565.805] (-562.916) (-562.776) * (-562.129) (-564.883) (-563.060) [-562.168] -- 0:00:19
      690000 -- [-562.323] (-564.180) (-562.311) (-560.732) * (-560.749) (-566.160) [-561.897] (-563.292) -- 0:00:19

      Average standard deviation of split frequencies: 0.009172

      690500 -- [-562.707] (-566.980) (-562.220) (-561.837) * [-560.900] (-567.559) (-564.456) (-565.191) -- 0:00:19
      691000 -- [-562.319] (-562.617) (-561.908) (-563.451) * (-562.239) (-562.235) [-561.897] (-563.857) -- 0:00:19
      691500 -- (-562.597) (-564.472) [-561.126] (-562.977) * (-561.207) (-562.757) [-561.317] (-562.586) -- 0:00:19
      692000 -- [-560.736] (-560.433) (-562.710) (-562.241) * (-566.845) [-563.372] (-562.270) (-561.116) -- 0:00:19
      692500 -- (-562.920) [-562.174] (-561.470) (-560.805) * (-562.229) (-561.938) (-562.745) [-562.782] -- 0:00:19
      693000 -- (-562.832) (-560.983) (-562.175) [-560.449] * (-564.443) [-564.528] (-561.919) (-563.705) -- 0:00:19
      693500 -- (-565.895) (-561.671) [-562.647] (-561.035) * (-563.847) [-562.594] (-561.468) (-562.214) -- 0:00:19
      694000 -- (-566.672) (-561.317) [-562.885] (-563.283) * (-565.466) (-560.718) [-563.574] (-563.746) -- 0:00:18
      694500 -- (-565.587) (-563.194) (-565.294) [-562.141] * (-563.247) (-562.856) (-562.557) [-562.101] -- 0:00:18
      695000 -- (-563.375) (-562.317) (-563.656) [-561.177] * (-561.352) [-563.459] (-562.275) (-562.901) -- 0:00:18

      Average standard deviation of split frequencies: 0.009144

      695500 -- [-563.021] (-562.331) (-562.124) (-561.284) * (-564.251) [-562.965] (-561.260) (-566.595) -- 0:00:18
      696000 -- (-563.167) (-562.780) [-561.222] (-561.294) * (-562.313) (-562.550) [-563.629] (-562.156) -- 0:00:18
      696500 -- [-563.107] (-563.239) (-564.867) (-561.840) * (-562.872) [-562.232] (-561.782) (-561.732) -- 0:00:18
      697000 -- (-569.620) (-566.052) [-563.986] (-562.959) * [-561.985] (-561.548) (-562.234) (-562.348) -- 0:00:19
      697500 -- (-563.297) (-563.920) [-562.934] (-560.965) * [-564.911] (-563.193) (-562.755) (-562.578) -- 0:00:19
      698000 -- (-561.980) [-560.733] (-562.497) (-562.100) * [-561.827] (-560.714) (-563.164) (-565.226) -- 0:00:19
      698500 -- [-565.060] (-562.248) (-562.124) (-562.287) * [-562.830] (-562.131) (-562.674) (-564.052) -- 0:00:18
      699000 -- (-564.084) [-560.443] (-564.261) (-564.809) * (-562.772) (-562.029) (-563.091) [-566.398] -- 0:00:18
      699500 -- [-565.001] (-560.561) (-563.509) (-562.577) * (-561.630) (-566.273) (-561.569) [-564.109] -- 0:00:18
      700000 -- [-560.860] (-561.997) (-563.151) (-561.519) * [-564.748] (-562.815) (-562.118) (-563.270) -- 0:00:18

      Average standard deviation of split frequencies: 0.009083

      700500 -- (-561.612) (-562.431) [-564.667] (-562.272) * (-561.353) (-561.957) (-562.265) [-566.348] -- 0:00:18
      701000 -- [-560.917] (-562.861) (-562.717) (-561.844) * (-562.944) (-561.108) [-564.146] (-564.741) -- 0:00:18
      701500 -- (-564.951) (-562.094) (-560.915) [-562.764] * (-562.493) [-560.999] (-563.004) (-562.228) -- 0:00:18
      702000 -- (-561.416) [-562.003] (-562.790) (-567.123) * (-563.215) (-560.870) [-562.453] (-562.145) -- 0:00:18
      702500 -- (-561.049) (-561.934) [-562.413] (-563.580) * (-562.060) (-561.611) [-563.469] (-563.180) -- 0:00:18
      703000 -- (-563.964) [-562.572] (-569.149) (-562.854) * (-561.409) (-569.241) (-562.072) [-564.013] -- 0:00:18
      703500 -- [-568.201] (-562.644) (-563.904) (-562.395) * [-565.751] (-562.523) (-563.378) (-565.577) -- 0:00:18
      704000 -- [-561.162] (-560.760) (-565.773) (-565.501) * (-561.171) (-562.482) (-562.935) [-564.577] -- 0:00:18
      704500 -- [-561.963] (-562.555) (-564.440) (-563.239) * (-562.857) (-565.309) [-561.772] (-563.412) -- 0:00:18
      705000 -- (-565.360) [-565.289] (-564.108) (-561.027) * [-561.748] (-563.502) (-563.778) (-562.581) -- 0:00:18

      Average standard deviation of split frequencies: 0.008972

      705500 -- [-562.069] (-562.773) (-564.506) (-561.717) * [-560.646] (-561.488) (-565.544) (-561.937) -- 0:00:18
      706000 -- (-564.063) [-565.109] (-563.907) (-562.278) * [-565.105] (-561.790) (-564.773) (-561.241) -- 0:00:18
      706500 -- (-563.759) [-562.349] (-566.101) (-560.646) * (-563.915) [-564.391] (-562.057) (-561.061) -- 0:00:18
      707000 -- (-563.694) [-566.783] (-564.688) (-563.103) * (-564.628) (-564.564) [-560.954] (-562.897) -- 0:00:18
      707500 -- (-562.022) [-564.166] (-566.084) (-560.711) * (-564.214) (-561.603) [-563.292] (-564.133) -- 0:00:18
      708000 -- (-561.771) (-561.811) (-561.841) [-561.070] * (-566.544) (-561.257) [-560.798] (-562.726) -- 0:00:18
      708500 -- (-562.821) (-563.094) (-565.094) [-563.403] * (-565.304) (-564.644) [-561.375] (-563.325) -- 0:00:18
      709000 -- (-562.125) [-563.312] (-562.282) (-564.201) * (-561.610) (-562.111) [-561.399] (-560.775) -- 0:00:18
      709500 -- (-561.465) (-565.645) [-563.121] (-563.466) * (-562.233) (-565.459) [-562.624] (-563.308) -- 0:00:18
      710000 -- [-564.449] (-564.274) (-562.266) (-565.560) * (-562.522) [-561.304] (-562.207) (-564.214) -- 0:00:17

      Average standard deviation of split frequencies: 0.008582

      710500 -- (-565.291) (-561.833) (-561.478) [-564.327] * [-560.531] (-566.176) (-560.918) (-564.596) -- 0:00:17
      711000 -- (-566.330) (-560.725) (-566.022) [-564.589] * (-561.289) (-566.849) [-562.624] (-565.822) -- 0:00:17
      711500 -- (-560.588) [-564.232] (-563.635) (-562.558) * (-562.185) (-562.853) (-563.019) [-561.781] -- 0:00:17
      712000 -- [-561.737] (-562.571) (-563.339) (-560.474) * (-561.650) (-562.793) [-562.911] (-562.060) -- 0:00:17
      712500 -- (-562.426) (-562.962) (-561.560) [-560.763] * [-561.519] (-562.352) (-563.386) (-561.014) -- 0:00:17
      713000 -- (-562.625) (-560.762) [-561.399] (-562.276) * (-563.840) [-563.598] (-565.600) (-560.653) -- 0:00:17
      713500 -- [-564.055] (-562.467) (-563.277) (-564.693) * (-566.544) [-563.102] (-564.000) (-562.004) -- 0:00:17
      714000 -- (-564.811) (-561.358) [-564.204] (-565.549) * [-561.980] (-563.654) (-562.840) (-562.883) -- 0:00:18
      714500 -- (-561.171) (-562.350) [-562.639] (-562.403) * (-564.357) (-563.431) [-561.319] (-565.097) -- 0:00:17
      715000 -- (-561.130) (-562.740) (-561.643) [-562.485] * (-564.758) (-562.931) (-563.416) [-563.294] -- 0:00:17

      Average standard deviation of split frequencies: 0.008394

      715500 -- [-560.713] (-561.571) (-562.753) (-560.382) * [-564.031] (-565.897) (-563.093) (-561.854) -- 0:00:17
      716000 -- [-562.373] (-564.316) (-562.898) (-562.959) * (-570.644) [-562.210] (-563.850) (-562.963) -- 0:00:17
      716500 -- (-561.802) (-562.605) [-560.579] (-563.351) * (-561.367) [-561.880] (-564.024) (-562.588) -- 0:00:17
      717000 -- (-564.086) (-563.096) (-560.978) [-565.080] * (-564.328) [-561.524] (-563.966) (-561.250) -- 0:00:17
      717500 -- (-564.555) (-562.164) (-560.806) [-563.255] * [-560.431] (-562.118) (-561.766) (-562.297) -- 0:00:17
      718000 -- (-566.461) [-561.201] (-562.076) (-564.814) * (-561.462) (-560.582) (-562.791) [-562.296] -- 0:00:17
      718500 -- (-564.512) (-563.357) (-563.094) [-562.293] * [-560.707] (-560.949) (-563.245) (-561.687) -- 0:00:17
      719000 -- (-564.062) (-562.609) [-560.606] (-564.277) * [-560.634] (-560.539) (-569.874) (-561.264) -- 0:00:17
      719500 -- [-561.878] (-562.578) (-565.570) (-561.251) * [-563.293] (-560.872) (-565.016) (-560.715) -- 0:00:17
      720000 -- (-561.225) [-563.031] (-565.056) (-563.531) * (-562.949) [-560.975] (-561.286) (-562.340) -- 0:00:17

      Average standard deviation of split frequencies: 0.008708

      720500 -- (-562.720) (-562.077) [-564.888] (-562.069) * (-561.630) (-561.299) [-563.559] (-561.815) -- 0:00:17
      721000 -- (-564.506) (-561.505) (-563.228) [-562.484] * (-561.524) (-562.484) [-563.045] (-567.363) -- 0:00:17
      721500 -- (-566.572) (-560.497) [-561.478] (-560.462) * (-562.505) (-564.351) (-561.232) [-561.668] -- 0:00:17
      722000 -- (-566.493) (-562.614) (-562.351) [-561.874] * (-562.259) [-560.793] (-566.520) (-564.835) -- 0:00:17
      722500 -- [-562.567] (-562.226) (-563.394) (-560.570) * [-563.317] (-560.723) (-568.592) (-563.666) -- 0:00:17
      723000 -- [-560.725] (-564.438) (-561.422) (-561.438) * (-563.781) [-562.533] (-564.318) (-564.678) -- 0:00:17
      723500 -- (-562.068) (-561.825) (-565.352) [-562.508] * [-561.692] (-561.415) (-565.172) (-562.522) -- 0:00:17
      724000 -- (-564.555) [-561.374] (-562.855) (-561.767) * (-561.457) [-562.944] (-562.695) (-563.560) -- 0:00:17
      724500 -- (-562.806) [-564.872] (-563.333) (-563.507) * (-562.217) (-564.548) [-566.001] (-560.670) -- 0:00:17
      725000 -- (-562.099) (-564.373) (-560.965) [-561.793] * (-561.456) (-567.840) (-564.093) [-562.748] -- 0:00:17

      Average standard deviation of split frequencies: 0.008847

      725500 -- (-562.036) (-565.952) [-565.307] (-561.298) * (-561.748) (-563.190) [-560.338] (-562.740) -- 0:00:17
      726000 -- (-562.694) (-563.271) [-565.660] (-561.317) * [-563.956] (-563.784) (-560.458) (-561.326) -- 0:00:16
      726500 -- (-562.119) (-562.304) [-563.561] (-562.143) * (-562.140) (-563.170) [-560.558] (-562.722) -- 0:00:16
      727000 -- (-563.064) (-564.798) (-566.480) [-564.252] * [-564.738] (-563.407) (-562.114) (-562.133) -- 0:00:16
      727500 -- [-561.292] (-567.354) (-564.444) (-563.696) * (-560.918) [-562.923] (-560.444) (-562.106) -- 0:00:16
      728000 -- [-561.516] (-562.186) (-563.053) (-562.123) * (-561.711) (-564.852) (-563.482) [-561.404] -- 0:00:16
      728500 -- (-561.182) (-561.584) [-561.256] (-561.351) * (-561.239) (-563.024) [-560.970] (-563.233) -- 0:00:16
      729000 -- (-561.180) [-560.949] (-567.820) (-564.371) * (-560.754) [-560.194] (-568.892) (-560.583) -- 0:00:16
      729500 -- (-563.225) (-562.411) [-563.956] (-566.349) * [-561.419] (-562.513) (-566.920) (-561.922) -- 0:00:16
      730000 -- (-562.791) (-561.308) [-564.941] (-562.970) * [-561.797] (-563.552) (-568.233) (-562.328) -- 0:00:16

      Average standard deviation of split frequencies: 0.009194

      730500 -- (-561.285) (-563.969) (-561.557) [-562.386] * (-560.880) (-568.749) [-562.036] (-563.153) -- 0:00:16
      731000 -- [-562.999] (-565.017) (-566.066) (-561.961) * (-562.696) [-561.363] (-563.382) (-562.575) -- 0:00:16
      731500 -- [-563.462] (-563.957) (-561.099) (-561.662) * [-564.462] (-561.573) (-561.777) (-564.318) -- 0:00:16
      732000 -- (-561.632) (-561.823) (-562.456) [-561.525] * [-561.691] (-561.608) (-565.845) (-562.181) -- 0:00:16
      732500 -- (-561.530) (-562.247) (-563.967) [-563.999] * (-563.584) (-563.642) (-562.413) [-561.863] -- 0:00:16
      733000 -- (-561.680) (-562.174) (-564.186) [-561.168] * (-564.163) (-562.336) [-562.175] (-560.463) -- 0:00:16
      733500 -- (-562.418) (-563.655) (-563.672) [-562.199] * (-561.530) [-560.545] (-562.693) (-561.794) -- 0:00:16
      734000 -- (-566.179) (-565.052) [-561.147] (-563.421) * [-562.162] (-564.973) (-562.396) (-561.971) -- 0:00:16
      734500 -- (-564.456) (-565.775) [-564.572] (-564.674) * (-562.421) (-562.841) [-562.829] (-560.706) -- 0:00:16
      735000 -- (-563.573) (-564.299) [-562.219] (-561.661) * (-563.540) (-562.264) [-562.678] (-561.646) -- 0:00:16

      Average standard deviation of split frequencies: 0.008807

      735500 -- [-562.794] (-561.744) (-564.764) (-562.540) * (-560.701) (-562.535) (-563.637) [-561.896] -- 0:00:16
      736000 -- (-564.332) [-560.813] (-565.919) (-563.577) * [-563.513] (-563.800) (-562.014) (-562.756) -- 0:00:16
      736500 -- (-564.703) (-561.943) [-561.748] (-564.706) * (-565.342) [-562.396] (-561.063) (-561.714) -- 0:00:16
      737000 -- (-563.019) (-562.205) [-561.210] (-568.316) * (-564.002) (-562.187) [-562.322] (-561.554) -- 0:00:16
      737500 -- [-563.948] (-564.652) (-563.840) (-563.420) * [-561.703] (-564.116) (-563.110) (-563.857) -- 0:00:16
      738000 -- (-562.544) (-561.178) (-565.308) [-564.848] * (-560.291) (-564.081) (-561.657) [-563.702] -- 0:00:16
      738500 -- (-563.735) (-561.469) (-561.996) [-562.180] * (-561.133) (-560.592) [-562.441] (-562.414) -- 0:00:16
      739000 -- (-565.486) (-562.844) (-560.937) [-561.068] * [-564.169] (-561.461) (-563.124) (-560.665) -- 0:00:16
      739500 -- (-570.632) (-565.499) (-563.258) [-561.765] * (-561.902) [-563.018] (-562.101) (-561.715) -- 0:00:16
      740000 -- (-564.231) [-563.383] (-562.011) (-565.382) * (-560.665) [-563.719] (-563.827) (-562.300) -- 0:00:16

      Average standard deviation of split frequencies: 0.008910

      740500 -- [-561.073] (-562.746) (-565.842) (-561.974) * (-563.494) (-564.452) (-561.119) [-561.770] -- 0:00:16
      741000 -- (-565.688) [-561.918] (-562.616) (-563.604) * (-561.086) [-562.264] (-561.820) (-563.463) -- 0:00:16
      741500 -- (-562.154) (-562.966) [-562.897] (-562.923) * (-564.002) (-563.909) (-561.182) [-561.338] -- 0:00:16
      742000 -- (-561.206) [-565.780] (-565.020) (-562.312) * (-561.318) (-562.838) (-562.382) [-562.323] -- 0:00:15
      742500 -- (-562.776) (-562.297) [-561.534] (-560.898) * [-562.697] (-563.234) (-564.813) (-562.238) -- 0:00:15
      743000 -- (-562.089) (-563.163) [-560.677] (-564.194) * (-562.930) (-572.533) [-562.280] (-566.188) -- 0:00:15
      743500 -- (-561.240) (-561.955) (-562.175) [-563.911] * (-563.252) (-561.594) [-561.464] (-562.462) -- 0:00:15
      744000 -- (-562.410) [-560.824] (-562.231) (-567.581) * (-563.223) (-567.707) (-561.686) [-561.306] -- 0:00:15
      744500 -- (-562.618) [-562.050] (-561.840) (-564.706) * (-563.821) (-563.178) [-563.205] (-566.166) -- 0:00:15
      745000 -- (-561.605) (-562.024) (-566.823) [-565.417] * (-568.274) (-564.327) [-561.956] (-561.022) -- 0:00:15

      Average standard deviation of split frequencies: 0.008610

      745500 -- (-561.463) (-562.474) [-564.243] (-562.593) * (-563.535) (-561.969) (-562.829) [-560.907] -- 0:00:15
      746000 -- (-565.771) (-563.869) (-564.604) [-562.837] * (-562.119) (-560.927) (-560.750) [-562.353] -- 0:00:15
      746500 -- (-564.774) (-560.990) (-564.411) [-561.460] * (-563.924) (-564.838) (-561.070) [-560.774] -- 0:00:15
      747000 -- [-560.276] (-561.464) (-564.055) (-563.004) * (-563.320) [-561.603] (-562.441) (-561.427) -- 0:00:15
      747500 -- [-560.533] (-561.759) (-565.536) (-564.118) * (-564.218) (-562.995) (-564.119) [-562.084] -- 0:00:15
      748000 -- (-560.824) (-562.608) [-562.516] (-562.382) * (-561.670) [-561.545] (-561.075) (-561.603) -- 0:00:15
      748500 -- (-562.720) (-566.046) (-562.590) [-564.747] * (-562.252) (-562.265) [-561.037] (-561.031) -- 0:00:15
      749000 -- (-561.429) (-561.138) [-561.442] (-567.149) * (-562.250) (-561.328) [-564.604] (-562.746) -- 0:00:15
      749500 -- (-562.580) [-561.047] (-561.768) (-561.394) * (-562.041) (-561.429) [-564.426] (-561.893) -- 0:00:15
      750000 -- (-561.985) (-562.278) [-566.445] (-564.602) * (-560.937) [-560.607] (-561.010) (-562.112) -- 0:00:15

      Average standard deviation of split frequencies: 0.008595

      750500 -- (-562.464) (-565.132) (-563.438) [-561.967] * (-567.270) (-561.177) (-562.465) [-562.339] -- 0:00:15
      751000 -- (-560.514) (-563.947) [-565.162] (-564.324) * (-561.398) (-563.585) [-565.637] (-563.026) -- 0:00:15
      751500 -- (-560.555) (-561.322) (-564.412) [-560.231] * (-566.399) (-564.316) [-561.167] (-562.982) -- 0:00:15
      752000 -- [-562.201] (-561.455) (-563.637) (-561.552) * [-562.760] (-562.262) (-566.190) (-562.887) -- 0:00:15
      752500 -- (-562.940) [-561.658] (-561.803) (-562.807) * (-560.852) (-561.274) [-560.874] (-561.476) -- 0:00:15
      753000 -- [-561.575] (-561.308) (-563.904) (-561.101) * [-563.245] (-563.180) (-562.068) (-561.620) -- 0:00:15
      753500 -- (-560.573) [-565.414] (-564.032) (-562.545) * (-565.943) [-562.194] (-560.767) (-563.905) -- 0:00:15
      754000 -- (-560.716) (-563.675) (-562.056) [-562.467] * (-563.498) (-563.013) (-560.385) [-560.373] -- 0:00:15
      754500 -- (-560.956) (-564.435) (-561.508) [-561.804] * [-562.605] (-562.318) (-560.310) (-563.118) -- 0:00:15
      755000 -- (-560.703) (-566.173) (-563.173) [-562.577] * (-565.530) (-560.853) (-560.450) [-565.599] -- 0:00:15

      Average standard deviation of split frequencies: 0.008340

      755500 -- (-563.924) (-563.244) [-563.245] (-563.527) * (-564.052) (-561.557) [-562.830] (-564.071) -- 0:00:15
      756000 -- (-563.987) [-562.400] (-565.451) (-562.791) * (-562.763) [-563.653] (-561.771) (-561.493) -- 0:00:15
      756500 -- [-563.559] (-565.082) (-564.144) (-560.961) * (-561.154) [-562.287] (-560.660) (-561.985) -- 0:00:15
      757000 -- [-564.300] (-560.707) (-567.064) (-563.798) * (-565.908) [-560.773] (-560.922) (-564.295) -- 0:00:15
      757500 -- [-563.187] (-560.648) (-567.590) (-563.219) * (-565.508) (-560.941) [-561.755] (-562.816) -- 0:00:15
      758000 -- (-563.535) (-561.838) [-560.795] (-561.358) * (-565.502) (-561.432) (-563.253) [-561.519] -- 0:00:15
      758500 -- (-561.276) [-562.167] (-560.924) (-560.371) * [-564.068] (-561.763) (-561.229) (-561.520) -- 0:00:14
      759000 -- [-562.765] (-563.207) (-562.255) (-562.482) * (-565.926) (-563.677) (-562.761) [-562.992] -- 0:00:14
      759500 -- [-563.861] (-564.366) (-562.382) (-560.387) * (-561.600) (-563.730) [-561.641] (-563.494) -- 0:00:14
      760000 -- (-561.049) (-563.059) [-562.830] (-560.525) * (-562.442) (-562.636) (-561.879) [-562.577] -- 0:00:14

      Average standard deviation of split frequencies: 0.008328

      760500 -- (-561.869) (-561.510) [-565.505] (-565.269) * [-561.503] (-560.684) (-560.606) (-564.524) -- 0:00:14
      761000 -- (-565.114) (-562.540) [-561.678] (-561.111) * [-561.430] (-561.791) (-564.147) (-561.150) -- 0:00:14
      761500 -- (-567.076) (-563.347) (-562.377) [-560.985] * [-561.176] (-560.508) (-560.984) (-560.736) -- 0:00:14
      762000 -- (-561.927) (-567.673) [-561.413] (-561.643) * [-561.767] (-563.375) (-561.449) (-561.934) -- 0:00:14
      762500 -- [-563.595] (-564.022) (-563.475) (-561.037) * [-563.172] (-564.486) (-564.498) (-561.526) -- 0:00:14
      763000 -- [-560.995] (-563.415) (-565.607) (-561.805) * (-563.845) [-560.632] (-561.351) (-563.243) -- 0:00:14
      763500 -- (-562.828) (-563.367) (-563.576) [-563.043] * (-562.455) [-561.361] (-562.987) (-561.516) -- 0:00:14
      764000 -- (-561.776) (-561.486) [-562.098] (-566.628) * (-562.065) (-562.250) (-566.139) [-560.788] -- 0:00:14
      764500 -- [-561.770] (-560.738) (-564.418) (-561.292) * (-565.113) (-562.668) (-561.336) [-561.780] -- 0:00:14
      765000 -- (-562.141) [-562.323] (-564.615) (-562.974) * (-563.469) (-562.358) (-564.521) [-561.826] -- 0:00:14

      Average standard deviation of split frequencies: 0.008385

      765500 -- [-561.528] (-563.939) (-568.813) (-562.452) * (-562.954) (-561.524) [-564.240] (-561.031) -- 0:00:14
      766000 -- [-561.199] (-566.251) (-568.925) (-564.396) * (-563.807) (-564.814) (-565.919) [-561.670] -- 0:00:14
      766500 -- (-560.872) [-563.390] (-563.549) (-561.651) * (-563.291) (-560.614) (-561.085) [-561.552] -- 0:00:14
      767000 -- (-561.166) (-563.340) (-563.575) [-561.729] * [-560.675] (-560.892) (-560.719) (-562.691) -- 0:00:14
      767500 -- (-560.416) (-562.039) (-560.624) [-560.547] * (-560.645) (-560.408) [-560.966] (-561.896) -- 0:00:14
      768000 -- (-563.800) [-560.612] (-563.934) (-564.972) * (-568.021) (-560.363) (-567.064) [-563.706] -- 0:00:14
      768500 -- (-562.801) [-560.859] (-563.343) (-560.867) * (-561.524) [-562.387] (-562.237) (-561.071) -- 0:00:14
      769000 -- (-562.749) [-563.466] (-563.539) (-563.113) * [-563.418] (-563.759) (-562.960) (-562.684) -- 0:00:14
      769500 -- (-561.427) (-564.151) (-560.809) [-561.366] * (-560.859) (-560.611) [-564.200] (-562.707) -- 0:00:14
      770000 -- (-564.510) [-562.390] (-567.479) (-563.902) * [-562.025] (-560.667) (-563.678) (-563.820) -- 0:00:14

      Average standard deviation of split frequencies: 0.008319

      770500 -- (-563.375) (-562.602) (-564.550) [-564.054] * [-561.820] (-561.446) (-565.484) (-560.445) -- 0:00:14
      771000 -- (-565.719) (-563.111) (-562.203) [-564.013] * (-562.453) (-560.419) (-563.099) [-560.445] -- 0:00:14
      771500 -- (-562.680) (-564.018) (-564.605) [-561.594] * (-561.716) [-560.666] (-561.338) (-562.795) -- 0:00:14
      772000 -- (-562.981) [-563.353] (-560.977) (-560.425) * (-562.390) [-562.948] (-564.851) (-561.951) -- 0:00:14
      772500 -- (-562.663) (-561.751) [-560.946] (-560.639) * [-562.046] (-562.377) (-562.981) (-564.721) -- 0:00:14
      773000 -- (-560.944) (-560.975) [-561.366] (-561.537) * [-562.237] (-562.174) (-567.604) (-561.482) -- 0:00:14
      773500 -- (-562.439) (-561.681) [-562.786] (-561.505) * (-561.247) (-561.163) [-560.710] (-561.492)