--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:26:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsL/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -509.87 -513.47
2 -509.86 -512.91
--------------------------------------
TOTAL -509.86 -513.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894710 0.087366 0.373048 1.498392 0.862599 1364.75 1379.16 1.001
r(A<->C){all} 0.168924 0.020803 0.000090 0.448568 0.131644 224.62 271.31 1.000
r(A<->G){all} 0.168631 0.020249 0.000007 0.451652 0.131921 164.26 234.54 1.000
r(A<->T){all} 0.164058 0.019897 0.000121 0.449329 0.124280 264.60 316.01 1.000
r(C<->G){all} 0.170478 0.021177 0.000026 0.465616 0.131938 150.65 278.33 1.000
r(C<->T){all} 0.165849 0.019213 0.000046 0.442972 0.130344 183.72 197.23 1.005
r(G<->T){all} 0.162061 0.020346 0.000073 0.455687 0.119664 147.82 228.18 1.005
pi(A){all} 0.238664 0.000483 0.199194 0.284302 0.237853 968.85 1161.28 1.000
pi(C){all} 0.269279 0.000522 0.224128 0.311308 0.269466 1286.91 1332.30 1.000
pi(G){all} 0.314374 0.000571 0.269201 0.362332 0.314434 1273.15 1295.00 1.000
pi(T){all} 0.177683 0.000397 0.139450 0.217588 0.177177 1398.83 1401.46 1.000
alpha{1,2} 0.430822 0.237119 0.000292 1.405344 0.266275 1138.04 1146.89 1.000
alpha{3} 0.464335 0.236609 0.000232 1.465119 0.302485 1214.79 1324.07 1.000
pinvar{all} 0.995788 0.000027 0.986541 0.999997 0.997526 1278.22 1332.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -487.021696
Model 2: PositiveSelection -487.021654
Model 0: one-ratio -487.021689
Model 7: beta -487.021683
Model 8: beta&w>1 -487.021694
Model 0 vs 1 1.4000000078340236E-5
Model 2 vs 1 8.400000001529406E-5
Model 8 vs 7 2.2000000058142177E-5
>C1
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C2
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C3
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C4
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C5
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C6
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=124
C1 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C2 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C3 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C4 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C5 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C6 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
**************************************************
C1 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C2 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C3 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C4 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C5 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C6 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
**************************************************
C1 SLDTQGVKNRKQARSRYGAKKEKS
C2 SLDTQGVKNRKQARSRYGAKKEKS
C3 SLDTQGVKNRKQARSRYGAKKEKS
C4 SLDTQGVKNRKQARSRYGAKKEKS
C5 SLDTQGVKNRKQARSRYGAKKEKS
C6 SLDTQGVKNRKQARSRYGAKKEKS
************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3720]--->[3720]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.460 Mb, Max= 30.653 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C2 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C3 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C4 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C5 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C6 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
**************************************************
C1 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C2 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C3 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C4 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C5 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C6 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
**************************************************
C1 SLDTQGVKNRKQARSRYGAKKEKS
C2 SLDTQGVKNRKQARSRYGAKKEKS
C3 SLDTQGVKNRKQARSRYGAKKEKS
C4 SLDTQGVKNRKQARSRYGAKKEKS
C5 SLDTQGVKNRKQARSRYGAKKEKS
C6 SLDTQGVKNRKQARSRYGAKKEKS
************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
C2 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
C3 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
C4 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
C5 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
C6 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
**************************************************
C1 CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
C2 CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
C3 CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
C4 CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
C5 CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
C6 CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
**************************************************
C1 GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
C2 GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
C3 GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
C4 GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
C5 GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
C6 GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
**************************************************
C1 AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
C2 AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
C3 AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
C4 AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
C5 AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
C6 AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
**************************************************
C1 ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
C2 ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
C3 ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
C4 ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
C5 ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
C6 ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
**************************************************
C1 GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
C2 GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
C3 GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
C4 GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
C5 GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
C6 GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
**************************************************
C1 TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
C2 TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
C3 TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
C4 TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
C5 TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
C6 TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
**************************************************
C1 TGGAGCCAAGAAGGAGAAGAGC
C2 TGGAGCCAAGAAGGAGAAGAGC
C3 TGGAGCCAAGAAGGAGAAGAGC
C4 TGGAGCCAAGAAGGAGAAGAGC
C5 TGGAGCCAAGAAGGAGAAGAGC
C6 TGGAGCCAAGAAGGAGAAGAGC
**********************
>C1
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C2
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C3
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C4
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C5
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C6
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C1
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C2
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C3
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C4
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C5
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C6
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 372 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579793088
Setting output file names to "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 416530295
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0522115364
Seed = 509816621
Swapseed = 1579793088
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -832.553787 -- -24.965149
Chain 2 -- -832.553708 -- -24.965149
Chain 3 -- -832.553708 -- -24.965149
Chain 4 -- -832.553835 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -832.553787 -- -24.965149
Chain 2 -- -832.553835 -- -24.965149
Chain 3 -- -832.553835 -- -24.965149
Chain 4 -- -832.553787 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-832.554] (-832.554) (-832.554) (-832.554) * [-832.554] (-832.554) (-832.554) (-832.554)
500 -- (-521.726) (-523.616) [-525.022] (-527.474) * (-525.352) [-518.250] (-522.347) (-524.436) -- 0:00:00
1000 -- (-519.276) (-516.937) [-519.868] (-517.446) * (-530.194) (-521.913) (-522.970) [-515.891] -- 0:00:00
1500 -- [-521.024] (-522.301) (-521.270) (-516.163) * (-520.143) (-518.496) [-518.337] (-520.304) -- 0:00:00
2000 -- (-518.633) (-522.080) [-519.608] (-518.978) * (-522.450) (-520.261) (-520.828) [-516.951] -- 0:00:00
2500 -- [-514.348] (-516.521) (-519.609) (-521.933) * [-514.656] (-516.383) (-518.374) (-521.689) -- 0:00:00
3000 -- (-519.709) (-519.459) (-522.821) [-521.423] * (-521.038) [-517.917] (-526.745) (-516.799) -- 0:00:00
3500 -- (-530.681) (-516.677) (-526.783) [-516.153] * [-523.320] (-520.839) (-519.711) (-525.442) -- 0:00:00
4000 -- (-522.512) (-519.987) [-518.163] (-523.270) * (-521.365) (-520.446) [-516.784] (-525.511) -- 0:00:00
4500 -- [-518.325] (-539.786) (-520.628) (-523.243) * (-521.046) (-527.066) (-526.418) [-521.326] -- 0:00:00
5000 -- (-513.912) [-524.418] (-515.933) (-529.344) * (-522.573) (-522.589) (-514.789) [-514.972] -- 0:00:00
Average standard deviation of split frequencies: 0.104757
5500 -- (-521.133) (-520.322) [-522.753] (-514.790) * (-517.963) (-517.099) (-524.456) [-518.839] -- 0:00:00
6000 -- (-530.791) (-519.738) [-518.344] (-526.874) * (-519.263) [-516.981] (-516.753) (-517.571) -- 0:00:00
6500 -- (-520.695) (-518.243) (-523.287) [-520.544] * (-523.229) (-517.310) (-515.865) [-521.679] -- 0:00:00
7000 -- [-522.320] (-518.567) (-519.841) (-520.868) * [-518.717] (-516.965) (-515.502) (-514.128) -- 0:02:21
7500 -- (-523.958) (-525.818) [-515.921] (-517.644) * [-517.648] (-517.204) (-523.944) (-518.713) -- 0:02:12
8000 -- [-519.553] (-514.426) (-522.724) (-524.674) * (-525.523) (-516.075) [-516.783] (-519.085) -- 0:02:04
8500 -- [-515.277] (-517.103) (-520.676) (-514.705) * (-515.239) (-523.368) (-527.942) [-519.829] -- 0:01:56
9000 -- (-521.753) (-526.838) (-517.422) [-519.028] * [-522.609] (-517.506) (-527.876) (-516.620) -- 0:01:50
9500 -- (-516.716) [-520.655] (-519.268) (-527.545) * [-516.296] (-521.844) (-528.500) (-521.210) -- 0:01:44
10000 -- (-518.173) [-519.914] (-526.478) (-523.430) * (-522.530) (-529.683) (-517.224) [-519.223] -- 0:01:39
Average standard deviation of split frequencies: 0.048846
10500 -- [-525.966] (-510.580) (-518.732) (-523.953) * [-516.143] (-520.620) (-524.672) (-527.945) -- 0:01:34
11000 -- (-515.811) (-509.567) [-521.510] (-524.385) * (-527.167) (-520.872) [-521.341] (-524.265) -- 0:01:29
11500 -- (-517.818) (-509.835) [-522.373] (-522.079) * (-518.306) [-524.239] (-525.532) (-519.990) -- 0:01:25
12000 -- (-523.354) [-510.130] (-517.400) (-525.168) * (-525.762) (-517.709) [-524.877] (-524.277) -- 0:01:22
12500 -- (-516.307) [-509.672] (-517.581) (-535.113) * (-530.455) [-517.517] (-511.841) (-519.251) -- 0:01:19
13000 -- (-523.674) [-510.452] (-525.932) (-524.279) * (-515.934) [-518.322] (-511.024) (-514.327) -- 0:01:15
13500 -- (-511.595) (-510.922) [-519.051] (-510.406) * (-517.812) (-526.302) [-515.859] (-520.783) -- 0:01:13
14000 -- (-512.838) (-511.085) [-517.748] (-509.951) * (-522.089) (-528.575) (-511.581) [-514.819] -- 0:01:10
14500 -- (-513.920) (-508.911) (-538.807) [-509.513] * [-518.388] (-523.404) (-510.122) (-521.537) -- 0:01:07
15000 -- (-511.727) [-509.234] (-524.506) (-510.824) * (-525.018) (-514.848) [-512.256] (-517.186) -- 0:01:05
Average standard deviation of split frequencies: 0.062027
15500 -- (-513.058) [-509.383] (-515.675) (-510.672) * (-521.227) [-515.164] (-511.173) (-526.156) -- 0:01:03
16000 -- (-512.392) (-511.201) [-510.404] (-511.557) * [-515.150] (-513.800) (-514.129) (-525.684) -- 0:01:01
16500 -- (-509.593) (-511.432) (-511.248) [-509.985] * (-517.669) (-521.725) (-510.577) [-519.549] -- 0:00:59
17000 -- (-509.705) (-511.932) [-509.456] (-512.293) * (-541.624) (-525.948) (-510.320) [-520.494] -- 0:00:57
17500 -- (-511.565) [-509.692] (-509.343) (-511.576) * (-524.550) (-522.479) [-508.498] (-517.319) -- 0:00:56
18000 -- (-508.944) [-512.338] (-513.726) (-509.382) * (-512.326) (-521.259) [-510.534] (-516.825) -- 0:00:54
18500 -- (-509.103) (-512.241) [-509.326] (-510.558) * (-514.262) (-519.653) (-511.233) [-517.747] -- 0:00:53
19000 -- (-510.027) [-509.322] (-510.663) (-510.853) * [-512.387] (-522.386) (-508.307) (-523.976) -- 0:00:51
19500 -- (-510.333) (-512.851) (-511.100) [-509.745] * (-510.733) [-516.198] (-509.343) (-516.016) -- 0:00:50
20000 -- [-513.336] (-513.415) (-511.280) (-510.483) * (-508.972) [-520.434] (-511.683) (-519.272) -- 0:00:49
Average standard deviation of split frequencies: 0.046820
20500 -- (-512.472) [-510.142] (-511.502) (-509.659) * (-512.845) (-523.280) (-513.865) [-518.646] -- 0:00:47
21000 -- (-511.637) (-508.754) (-511.239) [-512.138] * [-509.983] (-521.665) (-510.586) (-521.789) -- 0:00:46
21500 -- [-511.056] (-509.057) (-510.790) (-511.257) * [-509.118] (-518.475) (-511.026) (-521.836) -- 0:00:45
22000 -- (-509.582) (-512.302) (-509.526) [-509.741] * (-510.617) (-518.824) [-510.964] (-518.555) -- 0:00:44
22500 -- (-511.240) (-511.069) (-510.199) [-509.523] * (-510.359) (-526.909) (-510.151) [-517.859] -- 0:00:43
23000 -- (-513.062) (-509.755) [-511.126] (-513.152) * [-514.385] (-516.706) (-511.119) (-537.042) -- 0:00:42
23500 -- [-511.571] (-510.472) (-510.356) (-510.719) * (-513.088) [-516.510] (-509.724) (-517.365) -- 0:00:41
24000 -- [-510.771] (-515.694) (-510.691) (-509.091) * (-509.274) (-524.934) (-513.216) [-523.350] -- 0:01:21
24500 -- (-509.599) [-513.029] (-509.309) (-509.716) * [-508.802] (-516.997) (-513.753) (-531.960) -- 0:01:19
25000 -- (-511.669) [-511.233] (-512.580) (-509.828) * (-511.712) (-522.720) [-510.103] (-526.925) -- 0:01:18
Average standard deviation of split frequencies: 0.041442
25500 -- (-511.681) [-510.166] (-509.990) (-511.981) * (-509.368) (-517.105) [-510.452] (-524.861) -- 0:01:16
26000 -- (-512.308) [-511.378] (-514.865) (-511.944) * (-509.654) (-521.925) [-510.477] (-518.134) -- 0:01:14
26500 -- (-514.033) [-511.704] (-509.762) (-512.588) * (-509.116) (-525.830) [-511.643] (-516.111) -- 0:01:13
27000 -- (-510.850) (-512.137) (-509.814) [-508.745] * (-509.210) (-521.250) [-510.695] (-516.742) -- 0:01:12
27500 -- (-509.602) [-509.902] (-509.518) (-509.514) * (-511.678) (-516.222) (-509.575) [-513.673] -- 0:01:10
28000 -- [-509.800] (-512.170) (-512.397) (-510.221) * (-514.336) (-519.443) (-509.366) [-517.125] -- 0:01:09
28500 -- (-509.525) [-510.667] (-508.390) (-509.649) * [-509.452] (-533.171) (-509.818) (-513.806) -- 0:01:08
29000 -- (-515.493) [-510.378] (-509.283) (-509.095) * (-509.938) [-517.747] (-514.050) (-523.723) -- 0:01:06
29500 -- [-511.711] (-515.666) (-509.362) (-509.613) * (-509.434) (-517.907) (-513.498) [-514.576] -- 0:01:05
30000 -- (-511.112) (-509.781) [-510.184] (-511.621) * (-509.671) (-518.497) [-514.134] (-520.863) -- 0:01:04
Average standard deviation of split frequencies: 0.034587
30500 -- [-510.818] (-511.275) (-510.928) (-509.218) * (-511.585) (-526.648) (-509.562) [-522.085] -- 0:01:03
31000 -- (-513.604) (-510.781) (-510.750) [-510.598] * (-511.738) (-522.725) (-509.078) [-521.083] -- 0:01:02
31500 -- (-510.080) (-514.509) (-509.111) [-512.262] * (-509.094) (-523.867) [-509.373] (-516.384) -- 0:01:01
32000 -- (-512.421) (-510.900) (-510.364) [-509.160] * (-508.580) (-525.325) (-509.749) [-514.746] -- 0:01:00
32500 -- (-509.763) [-509.788] (-510.454) (-511.053) * (-509.309) (-519.904) (-511.133) [-520.513] -- 0:00:59
33000 -- [-510.158] (-512.107) (-511.744) (-509.396) * (-511.491) (-531.819) [-511.871] (-519.790) -- 0:00:58
33500 -- [-509.527] (-511.087) (-510.251) (-511.672) * (-509.888) (-523.238) (-513.699) [-521.301] -- 0:00:57
34000 -- [-508.870] (-510.036) (-509.626) (-509.273) * (-511.309) [-522.894] (-512.741) (-520.020) -- 0:00:56
34500 -- (-510.561) [-511.128] (-508.794) (-509.697) * (-513.250) [-516.318] (-512.196) (-516.721) -- 0:00:55
35000 -- (-510.456) [-509.946] (-511.113) (-509.796) * [-510.753] (-522.480) (-509.407) (-520.031) -- 0:00:55
Average standard deviation of split frequencies: 0.033770
35500 -- (-512.306) [-509.048] (-511.222) (-509.603) * (-511.128) (-522.566) (-512.088) [-515.978] -- 0:00:54
36000 -- (-510.325) [-510.800] (-515.289) (-512.332) * (-512.810) (-516.643) (-510.649) [-522.958] -- 0:00:53
36500 -- [-511.977] (-510.608) (-513.825) (-509.330) * [-509.311] (-526.423) (-509.793) (-521.949) -- 0:00:52
37000 -- (-512.012) [-509.017] (-513.721) (-510.907) * [-509.227] (-522.408) (-509.546) (-522.493) -- 0:00:52
37500 -- (-514.103) (-509.027) (-509.993) [-511.885] * [-511.283] (-520.211) (-512.577) (-522.666) -- 0:00:51
38000 -- (-509.767) (-510.909) [-511.247] (-508.817) * (-514.184) [-522.182] (-511.279) (-523.835) -- 0:01:15
38500 -- (-511.319) [-509.617] (-509.628) (-508.714) * (-512.779) [-517.760] (-517.376) (-519.789) -- 0:01:14
39000 -- (-509.614) (-511.131) (-510.857) [-509.085] * [-509.220] (-520.851) (-510.957) (-519.958) -- 0:01:13
39500 -- (-509.309) (-512.214) (-513.814) [-513.833] * (-508.770) (-519.602) [-511.440] (-523.680) -- 0:01:12
40000 -- (-510.009) (-509.856) (-513.519) [-510.020] * [-508.773] (-524.020) (-509.900) (-516.442) -- 0:01:12
Average standard deviation of split frequencies: 0.030505
40500 -- [-511.519] (-515.282) (-514.594) (-510.799) * (-509.274) (-525.735) [-510.480] (-518.846) -- 0:01:11
41000 -- (-510.734) [-510.171] (-510.802) (-509.394) * (-508.729) [-528.581] (-512.412) (-521.613) -- 0:01:10
41500 -- (-509.774) (-509.345) (-510.411) [-510.187] * (-510.095) (-516.859) [-511.860] (-520.762) -- 0:01:09
42000 -- (-509.177) (-508.798) (-515.441) [-508.301] * (-510.422) [-510.064] (-512.926) (-515.276) -- 0:01:08
42500 -- (-511.126) [-512.679] (-511.821) (-514.643) * (-511.415) [-510.214] (-512.098) (-520.059) -- 0:01:07
43000 -- (-510.565) (-508.963) (-511.050) [-510.357] * (-512.634) (-510.277) [-510.362] (-517.886) -- 0:01:06
43500 -- (-512.531) [-513.996] (-512.491) (-513.082) * (-510.707) (-511.670) [-508.570] (-523.108) -- 0:01:05
44000 -- (-511.218) (-510.533) (-514.027) [-510.044] * (-512.298) (-513.277) (-510.205) [-519.200] -- 0:01:05
44500 -- (-510.440) (-510.133) (-508.934) [-513.518] * (-511.750) (-509.338) [-510.575] (-517.870) -- 0:01:04
45000 -- [-508.648] (-511.148) (-509.686) (-510.801) * (-510.725) (-512.240) (-514.181) [-527.898] -- 0:01:03
Average standard deviation of split frequencies: 0.026840
45500 -- [-508.933] (-508.642) (-509.817) (-509.702) * (-515.472) [-512.511] (-509.209) (-519.898) -- 0:01:02
46000 -- [-508.727] (-512.048) (-509.531) (-510.632) * (-510.580) (-510.597) [-511.758] (-529.521) -- 0:01:02
46500 -- (-508.437) (-510.178) (-512.213) [-509.371] * [-509.746] (-511.090) (-511.010) (-517.532) -- 0:01:01
47000 -- (-509.205) [-509.273] (-509.733) (-510.585) * [-510.055] (-508.847) (-510.734) (-527.495) -- 0:01:00
47500 -- (-509.125) (-509.551) [-508.768] (-510.706) * (-509.264) (-510.960) [-510.988] (-527.549) -- 0:01:00
48000 -- (-509.291) (-509.531) [-509.782] (-512.466) * (-509.097) (-508.836) [-508.852] (-518.800) -- 0:00:59
48500 -- (-508.985) (-510.822) [-514.762] (-510.625) * [-510.002] (-509.021) (-513.680) (-525.548) -- 0:00:58
49000 -- (-510.357) (-510.174) (-514.635) [-511.244] * (-510.275) (-509.254) [-512.141] (-520.588) -- 0:00:58
49500 -- (-509.821) (-510.978) [-510.753] (-508.586) * (-510.163) (-511.046) (-515.051) [-525.252] -- 0:00:57
50000 -- (-511.732) (-510.447) [-509.749] (-510.762) * [-510.329] (-513.063) (-509.182) (-515.938) -- 0:00:57
Average standard deviation of split frequencies: 0.023925
50500 -- [-509.835] (-509.188) (-510.943) (-510.917) * (-512.202) (-517.931) (-509.003) [-515.503] -- 0:00:56
51000 -- [-511.240] (-510.614) (-512.333) (-509.972) * (-510.767) [-514.745] (-509.315) (-519.502) -- 0:00:55
51500 -- (-512.674) [-512.662] (-509.017) (-513.319) * [-511.912] (-510.822) (-509.470) (-526.882) -- 0:00:55
52000 -- (-511.005) (-510.882) (-515.137) [-510.209] * (-509.757) [-508.936] (-510.227) (-512.355) -- 0:00:54
52500 -- [-509.819] (-514.174) (-512.729) (-510.347) * (-513.096) (-510.508) (-509.318) [-514.327] -- 0:00:54
53000 -- (-516.764) [-510.305] (-510.145) (-510.641) * (-514.916) (-509.118) (-510.273) [-512.121] -- 0:00:53
53500 -- (-513.644) (-509.127) [-510.243] (-511.981) * (-512.429) [-510.975] (-510.274) (-511.489) -- 0:00:53
54000 -- (-510.466) (-510.041) (-511.954) [-513.188] * (-511.794) (-510.232) (-513.498) [-510.290] -- 0:00:52
54500 -- (-511.459) (-511.618) (-514.251) [-509.787] * (-509.752) (-509.320) (-509.991) [-511.313] -- 0:01:09
55000 -- [-511.791] (-515.667) (-510.743) (-509.056) * (-511.225) (-509.264) (-512.398) [-510.797] -- 0:01:08
Average standard deviation of split frequencies: 0.027779
55500 -- (-513.489) [-509.807] (-517.070) (-509.200) * (-514.489) (-509.406) (-512.878) [-510.381] -- 0:01:08
56000 -- (-515.536) (-510.101) (-511.349) [-509.277] * (-514.829) [-509.239] (-510.715) (-511.521) -- 0:01:07
56500 -- (-514.633) (-509.902) (-511.414) [-510.566] * (-508.728) (-509.935) [-509.662] (-510.217) -- 0:01:06
57000 -- [-511.450] (-509.308) (-513.877) (-511.659) * (-510.355) (-510.228) [-510.371] (-511.414) -- 0:01:06
57500 -- (-512.487) (-511.787) [-510.287] (-509.787) * (-509.111) (-511.742) [-510.140] (-509.745) -- 0:01:05
58000 -- [-510.922] (-510.724) (-508.916) (-508.965) * (-509.224) (-510.527) [-509.588] (-508.489) -- 0:01:04
58500 -- (-509.943) [-510.900] (-508.559) (-510.405) * (-508.599) [-510.152] (-510.739) (-509.490) -- 0:01:04
59000 -- (-511.900) [-510.309] (-510.437) (-515.407) * (-512.520) (-510.373) (-511.828) [-511.825] -- 0:01:03
59500 -- [-512.110] (-512.473) (-508.709) (-515.376) * (-510.315) (-511.030) [-508.503] (-512.077) -- 0:01:03
60000 -- (-508.820) [-510.056] (-512.071) (-510.727) * (-509.850) (-508.532) [-509.261] (-511.486) -- 0:01:02
Average standard deviation of split frequencies: 0.027585
60500 -- (-509.243) [-511.596] (-511.822) (-512.918) * (-509.354) [-509.948] (-512.766) (-514.111) -- 0:01:02
61000 -- (-509.720) [-509.616] (-511.413) (-509.844) * (-509.358) (-509.902) (-510.090) [-510.968] -- 0:01:01
61500 -- (-513.632) [-512.685] (-510.565) (-508.957) * (-511.310) [-510.074] (-510.144) (-511.213) -- 0:01:01
62000 -- (-513.816) (-509.037) (-511.132) [-509.376] * [-509.982] (-512.333) (-509.720) (-512.347) -- 0:01:00
62500 -- (-510.512) [-509.549] (-509.776) (-509.273) * [-508.943] (-511.385) (-510.730) (-513.380) -- 0:01:00
63000 -- (-510.731) (-508.958) (-514.606) [-510.088] * (-513.537) (-511.173) [-510.594] (-510.517) -- 0:00:59
63500 -- (-508.786) (-510.573) [-510.878] (-511.658) * (-512.770) (-509.742) (-515.353) [-510.691] -- 0:00:58
64000 -- (-509.702) (-509.981) [-509.761] (-511.201) * (-510.286) (-511.418) (-513.033) [-509.486] -- 0:00:58
64500 -- (-511.191) (-509.619) (-512.308) [-508.768] * (-510.653) [-509.792] (-509.775) (-511.473) -- 0:00:58
65000 -- (-514.472) [-509.307] (-510.459) (-513.287) * [-510.019] (-510.442) (-511.112) (-512.215) -- 0:00:57
Average standard deviation of split frequencies: 0.024999
65500 -- (-510.856) (-511.367) (-511.128) [-509.464] * (-511.927) (-509.748) [-509.386] (-513.308) -- 0:00:57
66000 -- [-511.775] (-511.217) (-512.733) (-509.696) * [-509.596] (-508.890) (-508.623) (-512.317) -- 0:00:56
66500 -- (-513.850) (-509.311) [-510.829] (-514.884) * [-510.134] (-509.844) (-511.406) (-509.673) -- 0:00:56
67000 -- [-509.903] (-509.900) (-510.656) (-510.448) * [-509.855] (-511.427) (-510.964) (-508.724) -- 0:00:55
67500 -- (-517.544) [-510.818] (-513.637) (-509.900) * (-510.434) [-512.297] (-508.944) (-509.424) -- 0:00:55
68000 -- (-514.468) (-511.773) [-510.877] (-509.961) * (-509.952) (-512.194) (-513.668) [-511.118] -- 0:00:54
68500 -- [-510.923] (-508.510) (-511.309) (-511.618) * (-511.817) (-511.799) [-510.604] (-512.216) -- 0:00:54
69000 -- (-510.310) (-510.080) [-510.145] (-513.354) * (-511.819) [-512.367] (-512.358) (-512.298) -- 0:00:53
69500 -- (-509.516) (-512.939) (-509.967) [-511.913] * (-511.271) (-510.262) (-513.592) [-510.995] -- 0:00:53
70000 -- [-511.513] (-512.801) (-511.923) (-512.205) * (-510.707) (-512.338) [-509.230] (-510.196) -- 0:00:53
Average standard deviation of split frequencies: 0.029860
70500 -- (-511.385) [-512.625] (-510.970) (-509.524) * [-510.334] (-512.242) (-511.840) (-511.499) -- 0:00:52
71000 -- (-517.596) (-509.394) [-509.789] (-509.992) * (-509.282) (-510.767) (-509.068) [-510.714] -- 0:01:05
71500 -- (-512.807) (-509.023) (-511.578) [-509.126] * (-510.990) (-509.570) (-509.039) [-513.090] -- 0:01:04
72000 -- (-513.934) (-509.460) (-510.028) [-511.149] * (-510.048) (-510.808) (-509.162) [-510.791] -- 0:01:04
72500 -- (-511.784) (-510.577) [-512.503] (-510.044) * (-509.445) (-509.445) (-509.089) [-511.011] -- 0:01:03
73000 -- (-510.329) (-509.641) (-510.154) [-508.952] * (-508.779) (-513.797) [-509.280] (-518.112) -- 0:01:03
73500 -- (-509.704) (-510.042) (-511.731) [-509.340] * (-510.555) [-509.096] (-510.952) (-516.182) -- 0:01:03
74000 -- (-509.563) [-517.713] (-509.312) (-510.525) * (-510.332) [-510.384] (-510.282) (-513.143) -- 0:01:02
74500 -- (-509.582) (-514.879) (-508.561) [-514.983] * [-510.074] (-509.929) (-510.781) (-508.702) -- 0:01:02
75000 -- (-509.800) [-510.804] (-510.731) (-510.019) * (-509.193) (-510.491) (-509.992) [-508.913] -- 0:01:01
Average standard deviation of split frequencies: 0.029708
75500 -- (-511.810) (-511.896) [-508.697] (-510.790) * (-511.319) [-512.239] (-509.705) (-510.857) -- 0:01:01
76000 -- [-510.468] (-518.724) (-510.226) (-509.315) * (-509.213) (-509.785) (-511.822) [-508.410] -- 0:01:00
76500 -- [-509.308] (-516.704) (-510.575) (-512.402) * (-508.906) [-509.883] (-509.641) (-510.922) -- 0:01:00
77000 -- (-515.263) [-509.036] (-512.674) (-508.382) * (-509.745) [-509.438] (-509.832) (-512.749) -- 0:00:59
77500 -- (-512.637) [-510.765] (-511.035) (-509.261) * (-515.695) (-511.809) [-508.945] (-513.584) -- 0:00:59
78000 -- (-512.162) (-509.644) (-509.425) [-508.925] * (-510.564) [-511.787] (-510.523) (-511.532) -- 0:00:59
78500 -- (-514.669) (-510.634) (-508.596) [-509.639] * [-510.443] (-508.606) (-510.069) (-512.172) -- 0:00:58
79000 -- (-511.165) [-508.806] (-511.114) (-509.835) * (-514.468) (-511.713) (-512.614) [-509.936] -- 0:00:58
79500 -- (-509.018) [-510.612] (-514.288) (-510.299) * (-510.236) (-516.662) (-512.571) [-510.188] -- 0:00:57
80000 -- (-510.202) (-511.204) (-508.912) [-511.359] * (-508.902) [-510.909] (-509.361) (-509.826) -- 0:00:57
Average standard deviation of split frequencies: 0.031372
80500 -- (-510.844) (-514.174) [-508.746] (-508.994) * (-510.873) [-510.065] (-509.179) (-511.089) -- 0:00:57
81000 -- [-510.561] (-513.588) (-509.636) (-518.140) * [-510.731] (-509.565) (-510.427) (-512.903) -- 0:00:56
81500 -- [-513.895] (-513.361) (-508.874) (-516.300) * [-509.597] (-511.758) (-509.511) (-509.565) -- 0:00:56
82000 -- (-512.335) (-512.176) (-508.936) [-509.129] * (-511.713) [-511.298] (-511.620) (-509.454) -- 0:00:55
82500 -- (-512.700) (-510.198) [-509.412] (-512.015) * [-510.061] (-515.286) (-512.212) (-512.247) -- 0:00:55
83000 -- [-509.333] (-510.492) (-510.407) (-512.055) * (-510.101) (-514.680) (-509.080) [-509.056] -- 0:00:55
83500 -- [-509.254] (-508.889) (-511.944) (-514.057) * [-510.020] (-509.824) (-509.945) (-510.470) -- 0:00:54
84000 -- (-509.025) (-508.899) [-509.733] (-512.103) * (-509.715) (-509.238) [-514.347] (-510.334) -- 0:00:54
84500 -- (-509.937) [-509.600] (-512.309) (-513.337) * (-510.808) (-508.835) (-508.763) [-508.892] -- 0:00:54
85000 -- (-511.033) (-511.193) (-511.088) [-509.569] * (-510.931) (-509.961) (-510.875) [-508.756] -- 0:00:53
Average standard deviation of split frequencies: 0.028273
85500 -- (-512.484) (-510.506) [-510.407] (-511.093) * [-509.258] (-509.574) (-509.931) (-509.985) -- 0:00:53
86000 -- (-509.038) [-508.892] (-509.756) (-512.882) * (-510.257) (-513.822) (-510.235) [-508.864] -- 0:00:53
86500 -- (-508.822) [-512.397] (-510.912) (-512.095) * (-509.090) [-510.759] (-510.394) (-509.756) -- 0:00:52
87000 -- (-508.907) [-510.678] (-511.071) (-513.832) * [-509.981] (-511.285) (-509.512) (-509.996) -- 0:00:52
87500 -- [-510.759] (-513.616) (-510.144) (-513.007) * (-510.755) [-511.488] (-510.547) (-511.052) -- 0:01:02
88000 -- (-511.427) (-510.192) (-512.385) [-509.393] * (-509.719) [-509.862] (-508.945) (-513.434) -- 0:01:02
88500 -- (-509.178) [-511.025] (-511.352) (-509.622) * [-511.489] (-509.864) (-510.013) (-509.291) -- 0:01:01
89000 -- [-509.028] (-510.184) (-509.551) (-509.341) * [-510.365] (-511.020) (-512.139) (-510.410) -- 0:01:01
89500 -- [-511.065] (-509.123) (-509.060) (-511.508) * (-511.678) (-511.850) (-511.034) [-509.396] -- 0:01:01
90000 -- (-510.268) (-509.085) (-510.487) [-509.349] * (-512.686) (-510.174) [-509.009] (-513.708) -- 0:01:00
Average standard deviation of split frequencies: 0.025176
90500 -- (-509.807) (-509.643) [-509.573] (-508.448) * (-509.384) (-511.601) [-515.652] (-513.980) -- 0:01:00
91000 -- [-510.500] (-511.135) (-511.753) (-509.242) * (-509.543) (-511.014) (-512.451) [-509.216] -- 0:00:59
91500 -- (-510.719) (-512.098) [-508.871] (-510.034) * (-509.554) (-511.522) [-512.072] (-509.820) -- 0:00:59
92000 -- [-512.783] (-511.529) (-512.047) (-510.148) * (-512.110) (-509.009) [-509.288] (-511.097) -- 0:00:59
92500 -- (-512.705) (-511.528) [-508.963] (-508.898) * (-510.269) (-511.860) (-510.784) [-510.440] -- 0:00:58
93000 -- (-510.969) [-511.324] (-509.972) (-510.595) * (-508.872) [-511.312] (-509.898) (-515.624) -- 0:00:58
93500 -- (-513.467) [-508.999] (-510.994) (-510.246) * (-509.076) [-510.883] (-508.748) (-510.250) -- 0:00:58
94000 -- (-512.031) [-508.573] (-509.870) (-511.260) * [-511.817] (-509.932) (-512.062) (-509.471) -- 0:00:57
94500 -- (-508.890) (-509.289) [-509.081] (-510.804) * (-511.018) [-511.919] (-511.528) (-512.124) -- 0:00:57
95000 -- (-513.573) (-510.264) [-509.864] (-513.509) * (-512.633) (-508.984) [-511.149] (-509.391) -- 0:00:57
Average standard deviation of split frequencies: 0.025328
95500 -- [-509.617] (-510.786) (-513.895) (-509.343) * (-512.468) [-509.409] (-509.916) (-509.953) -- 0:00:56
96000 -- (-520.205) (-510.308) [-509.386] (-510.103) * (-513.794) [-509.463] (-510.906) (-511.745) -- 0:00:56
96500 -- [-508.945] (-510.335) (-513.232) (-509.885) * (-511.043) (-510.008) [-510.363] (-509.891) -- 0:00:56
97000 -- [-509.427] (-509.208) (-513.598) (-509.356) * (-515.681) (-511.068) [-508.943] (-510.482) -- 0:00:55
97500 -- (-510.011) (-508.980) (-513.650) [-508.354] * (-514.599) (-511.344) [-508.884] (-510.087) -- 0:00:55
98000 -- (-513.764) (-509.619) [-509.395] (-509.157) * (-509.062) (-509.175) (-512.381) [-508.910] -- 0:00:55
98500 -- (-508.825) (-513.230) [-508.987] (-509.157) * [-509.937] (-511.064) (-510.960) (-514.153) -- 0:00:54
99000 -- (-510.967) (-513.170) [-511.066] (-510.103) * (-511.202) [-511.848] (-512.837) (-512.280) -- 0:00:54
99500 -- (-515.880) (-513.810) [-510.357] (-509.050) * [-514.523] (-509.591) (-508.634) (-510.919) -- 0:00:54
100000 -- [-510.917] (-510.348) (-512.238) (-511.156) * (-511.653) (-511.523) [-509.155] (-511.687) -- 0:00:54
Average standard deviation of split frequencies: 0.026016
100500 -- (-508.624) (-513.301) (-513.270) [-509.677] * (-510.521) [-509.243] (-508.868) (-510.648) -- 0:00:53
101000 -- [-510.663] (-510.406) (-511.456) (-509.310) * (-508.711) (-509.586) [-509.415] (-508.529) -- 0:00:53
101500 -- [-509.597] (-518.477) (-513.477) (-512.965) * (-511.761) [-512.011] (-508.650) (-511.781) -- 0:00:53
102000 -- (-510.807) (-516.621) [-510.318] (-509.103) * (-510.477) [-511.206] (-510.658) (-522.538) -- 0:00:52
102500 -- (-513.686) (-508.980) [-511.922] (-511.798) * (-512.949) [-509.312] (-510.079) (-511.812) -- 0:00:52
103000 -- (-513.108) (-510.909) [-510.256] (-511.512) * (-510.800) [-510.696] (-512.996) (-510.777) -- 0:00:52
103500 -- [-509.381] (-508.321) (-513.948) (-511.009) * [-509.275] (-509.847) (-510.211) (-510.763) -- 0:00:51
104000 -- (-516.503) [-512.910] (-510.329) (-508.618) * (-509.192) (-510.034) (-509.415) [-510.594] -- 0:00:51
104500 -- (-511.579) (-513.009) [-512.177] (-510.594) * (-511.052) (-512.934) (-509.740) [-509.798] -- 0:00:59
105000 -- (-509.981) (-513.897) (-513.805) [-510.790] * (-508.636) [-508.690] (-511.132) (-514.858) -- 0:00:59
Average standard deviation of split frequencies: 0.022236
105500 -- (-509.736) [-511.399] (-510.755) (-510.881) * [-510.196] (-511.380) (-509.627) (-519.367) -- 0:00:59
106000 -- (-514.826) [-509.088] (-510.582) (-508.420) * (-509.662) [-511.377] (-510.514) (-513.732) -- 0:00:59
106500 -- [-509.580] (-510.820) (-509.873) (-509.411) * [-510.225] (-512.141) (-514.639) (-513.097) -- 0:00:58
107000 -- [-509.998] (-511.522) (-510.603) (-510.097) * [-509.307] (-512.690) (-509.689) (-511.252) -- 0:00:58
107500 -- (-510.664) [-510.191] (-511.315) (-508.710) * (-510.002) (-515.166) [-509.009] (-509.555) -- 0:00:58
108000 -- (-510.253) [-510.384] (-514.398) (-510.498) * (-511.816) (-514.572) [-508.344] (-512.483) -- 0:00:57
108500 -- (-509.578) (-511.336) [-513.119] (-509.972) * (-511.803) [-509.450] (-510.781) (-510.978) -- 0:00:57
109000 -- (-509.215) (-510.251) [-509.487] (-513.196) * (-511.350) [-510.287] (-511.538) (-513.704) -- 0:00:57
109500 -- (-508.884) (-510.276) [-510.786] (-509.243) * (-509.587) (-510.700) (-512.151) [-511.387] -- 0:00:56
110000 -- (-511.145) (-510.601) [-512.929] (-508.861) * (-509.693) (-510.597) (-509.345) [-510.589] -- 0:00:56
Average standard deviation of split frequencies: 0.020402
110500 -- (-512.257) [-510.902] (-510.572) (-508.749) * [-509.957] (-512.015) (-512.815) (-509.969) -- 0:00:56
111000 -- [-510.134] (-510.078) (-515.521) (-509.183) * (-510.310) (-509.369) [-509.620] (-509.518) -- 0:00:56
111500 -- (-509.059) (-510.914) (-519.801) [-509.277] * (-509.644) (-509.364) (-511.613) [-511.677] -- 0:00:55
112000 -- (-509.339) (-510.980) (-515.919) [-509.710] * (-510.364) (-510.295) (-508.925) [-510.437] -- 0:00:55
112500 -- [-509.180] (-513.611) (-509.522) (-508.519) * (-514.613) (-511.632) (-508.866) [-512.220] -- 0:00:55
113000 -- (-509.034) (-514.857) (-512.010) [-508.928] * [-511.458] (-511.913) (-510.735) (-511.779) -- 0:00:54
113500 -- (-508.932) (-509.346) (-510.569) [-510.073] * (-509.896) (-510.634) [-508.483] (-509.472) -- 0:00:54
114000 -- (-508.541) (-509.686) (-510.675) [-512.974] * (-512.535) (-514.681) [-510.262] (-509.491) -- 0:00:54
114500 -- (-511.201) [-510.835] (-510.624) (-511.818) * (-510.227) (-510.293) (-513.580) [-508.490] -- 0:00:54
115000 -- (-512.824) [-509.414] (-510.127) (-509.347) * (-508.963) (-512.281) [-513.457] (-513.286) -- 0:00:53
Average standard deviation of split frequencies: 0.022125
115500 -- (-512.494) (-511.818) [-510.178] (-509.824) * (-509.009) [-511.740] (-512.882) (-509.250) -- 0:00:53
116000 -- [-513.522] (-513.672) (-510.695) (-516.083) * (-512.955) (-512.037) [-511.966] (-511.103) -- 0:00:53
116500 -- (-516.335) (-512.156) (-510.219) [-515.876] * [-510.073] (-509.230) (-508.768) (-512.738) -- 0:00:53
117000 -- [-509.547] (-511.729) (-510.626) (-513.441) * [-511.021] (-510.345) (-508.942) (-508.709) -- 0:00:52
117500 -- [-510.080] (-513.835) (-512.567) (-511.198) * (-514.828) [-510.259] (-509.570) (-509.258) -- 0:00:52
118000 -- (-509.369) [-510.411] (-511.656) (-509.647) * [-511.503] (-509.013) (-511.087) (-511.122) -- 0:00:52
118500 -- (-510.101) [-508.628] (-510.116) (-509.627) * (-509.375) (-510.171) [-513.158] (-510.087) -- 0:00:52
119000 -- (-509.665) (-509.114) (-512.166) [-509.733] * (-510.354) (-517.392) [-512.266] (-511.879) -- 0:00:51
119500 -- (-510.080) (-510.257) [-510.367] (-510.772) * (-510.296) (-513.471) (-512.199) [-509.922] -- 0:00:51
120000 -- (-510.819) (-510.050) (-511.658) [-510.417] * (-509.436) (-512.722) (-511.455) [-512.176] -- 0:00:51
Average standard deviation of split frequencies: 0.023223
120500 -- (-514.693) [-510.898] (-510.655) (-511.004) * [-509.140] (-509.794) (-508.657) (-510.070) -- 0:00:58
121000 -- (-512.634) [-512.742] (-515.142) (-510.371) * [-510.428] (-512.325) (-509.640) (-515.035) -- 0:00:58
121500 -- [-515.751] (-509.110) (-512.343) (-509.442) * (-513.715) [-510.642] (-513.869) (-509.180) -- 0:00:57
122000 -- [-509.792] (-510.619) (-513.600) (-512.788) * (-511.361) (-509.990) (-510.767) [-511.390] -- 0:00:57
122500 -- [-509.692] (-508.642) (-509.580) (-509.517) * (-509.837) (-512.898) (-511.065) [-511.619] -- 0:00:57
123000 -- (-508.563) (-510.024) [-510.413] (-510.521) * (-509.848) (-510.331) [-509.434] (-512.747) -- 0:00:57
123500 -- (-512.773) (-512.987) [-510.693] (-510.533) * (-511.658) (-510.947) (-511.578) [-514.066] -- 0:00:56
124000 -- (-510.615) (-509.362) (-509.689) [-510.251] * (-510.756) (-510.886) [-509.304] (-512.471) -- 0:00:56
124500 -- (-509.559) [-510.092] (-511.125) (-509.833) * (-508.889) [-510.940] (-512.028) (-509.246) -- 0:00:56
125000 -- (-511.815) (-511.169) [-510.886] (-509.571) * [-509.419] (-511.742) (-515.985) (-511.415) -- 0:00:56
Average standard deviation of split frequencies: 0.020951
125500 -- (-510.700) (-510.709) [-509.371] (-510.171) * (-512.672) [-511.486] (-511.825) (-510.410) -- 0:00:55
126000 -- (-511.983) [-512.123] (-513.858) (-509.267) * (-512.712) (-511.937) (-511.389) [-508.904] -- 0:00:55
126500 -- (-508.798) [-510.200] (-511.234) (-509.422) * (-511.930) (-511.234) [-508.992] (-511.044) -- 0:00:55
127000 -- (-510.259) [-511.428] (-508.873) (-508.924) * (-509.377) [-511.216] (-511.784) (-511.075) -- 0:00:54
127500 -- (-513.231) [-515.703] (-509.530) (-509.140) * [-514.656] (-511.538) (-509.041) (-509.669) -- 0:00:54
128000 -- (-510.259) [-511.342] (-512.808) (-509.302) * [-510.717] (-512.174) (-509.387) (-511.375) -- 0:00:54
128500 -- (-510.109) (-509.186) (-508.503) [-510.967] * (-508.781) (-509.163) [-514.049] (-508.336) -- 0:00:54
129000 -- [-512.412] (-512.180) (-509.132) (-509.824) * [-508.932] (-509.854) (-514.084) (-509.155) -- 0:00:54
129500 -- (-511.802) (-509.127) (-509.226) [-509.947] * [-509.368] (-510.595) (-512.168) (-509.065) -- 0:00:53
130000 -- (-511.847) (-509.580) [-511.394] (-508.884) * (-514.728) (-509.853) [-510.612] (-511.011) -- 0:00:53
Average standard deviation of split frequencies: 0.021646
130500 -- (-511.881) [-511.555] (-511.403) (-508.973) * (-515.931) (-510.271) (-510.270) [-512.712] -- 0:00:53
131000 -- [-509.889] (-508.694) (-511.472) (-508.663) * (-513.162) [-511.207] (-510.282) (-513.920) -- 0:00:53
131500 -- [-510.169] (-508.951) (-510.368) (-509.393) * (-514.397) [-510.153] (-509.842) (-509.272) -- 0:00:52
132000 -- (-512.187) (-510.644) (-511.172) [-511.107] * (-513.710) (-511.888) [-509.942] (-509.168) -- 0:00:52
132500 -- [-510.837] (-511.918) (-509.307) (-511.436) * (-513.404) (-512.783) (-515.039) [-509.207] -- 0:00:52
133000 -- [-512.027] (-515.214) (-510.328) (-511.944) * (-510.051) (-511.747) [-511.396] (-509.526) -- 0:00:52
133500 -- (-509.887) (-514.712) (-509.891) [-511.092] * (-511.161) (-513.523) [-510.078] (-509.426) -- 0:00:51
134000 -- [-513.339] (-513.279) (-512.844) (-509.682) * (-509.492) [-510.652] (-508.532) (-509.946) -- 0:00:51
134500 -- (-510.697) [-515.230] (-513.773) (-509.158) * (-510.134) [-510.331] (-509.210) (-509.182) -- 0:00:51
135000 -- (-508.940) (-513.418) [-511.705] (-508.978) * (-510.745) [-511.778] (-511.564) (-512.867) -- 0:00:51
Average standard deviation of split frequencies: 0.022257
135500 -- (-510.582) (-511.121) [-512.790] (-510.851) * (-512.597) [-508.609] (-510.080) (-511.064) -- 0:00:57
136000 -- (-511.709) (-510.109) (-509.575) [-510.369] * [-509.842] (-509.620) (-510.255) (-514.086) -- 0:00:57
136500 -- [-511.834] (-511.119) (-509.524) (-509.240) * [-510.835] (-511.603) (-511.967) (-510.305) -- 0:00:56
137000 -- (-515.115) (-511.443) [-512.123] (-509.508) * [-509.216] (-508.491) (-511.955) (-511.398) -- 0:00:56
137500 -- (-510.563) (-510.370) (-513.014) [-509.456] * (-508.876) [-513.136] (-509.434) (-513.934) -- 0:00:56
138000 -- [-512.500] (-510.855) (-514.939) (-508.450) * [-512.423] (-514.223) (-510.452) (-509.989) -- 0:00:56
138500 -- (-512.163) (-509.840) (-511.985) [-509.317] * (-511.153) (-513.160) (-511.593) [-510.886] -- 0:00:55
139000 -- (-510.477) (-517.481) (-508.768) [-509.213] * (-509.843) (-510.166) (-514.017) [-511.816] -- 0:00:55
139500 -- (-513.315) (-511.308) [-510.298] (-512.235) * (-510.091) [-510.546] (-510.889) (-511.595) -- 0:00:55
140000 -- [-512.324] (-511.653) (-509.935) (-511.879) * (-509.121) (-510.858) (-511.740) [-509.013] -- 0:00:55
Average standard deviation of split frequencies: 0.022753
140500 -- (-509.993) [-512.141] (-511.408) (-509.959) * (-509.947) [-509.989] (-513.260) (-512.158) -- 0:00:55
141000 -- (-512.362) [-511.400] (-511.848) (-510.780) * (-511.257) [-510.019] (-514.596) (-508.846) -- 0:00:54
141500 -- (-509.428) (-509.010) [-510.184] (-510.529) * (-513.510) [-509.695] (-511.516) (-512.125) -- 0:00:54
142000 -- (-508.943) (-511.415) (-512.425) [-510.935] * [-510.799] (-510.698) (-512.242) (-509.665) -- 0:00:54
142500 -- (-508.582) (-512.752) [-511.441] (-511.235) * [-512.198] (-512.213) (-510.921) (-512.552) -- 0:00:54
143000 -- (-510.198) (-509.501) [-508.680] (-512.524) * (-511.295) (-509.599) (-511.266) [-512.679] -- 0:00:53
143500 -- [-509.029] (-511.603) (-509.960) (-509.759) * (-509.533) (-510.477) (-510.852) [-510.253] -- 0:00:53
144000 -- (-509.735) (-509.077) (-513.862) [-508.648] * [-511.006] (-509.703) (-511.669) (-510.991) -- 0:00:53
144500 -- (-512.211) (-511.623) [-508.724] (-509.581) * (-508.889) (-508.709) [-513.164] (-510.492) -- 0:00:53
145000 -- (-511.693) (-509.278) [-510.449] (-508.624) * (-510.153) (-510.958) (-510.192) [-511.783] -- 0:00:53
Average standard deviation of split frequencies: 0.023409
145500 -- (-509.790) (-510.124) [-509.470] (-509.287) * (-510.688) (-512.750) (-510.774) [-510.910] -- 0:00:52
146000 -- (-510.701) (-509.710) [-512.125] (-509.289) * (-511.363) (-511.637) (-509.509) [-509.414] -- 0:00:52
146500 -- [-511.914] (-509.061) (-511.572) (-509.622) * [-510.900] (-512.768) (-513.204) (-509.406) -- 0:00:52
147000 -- (-509.750) (-509.701) [-513.345] (-510.868) * (-510.668) [-512.296] (-512.550) (-509.803) -- 0:00:52
147500 -- [-511.002] (-508.931) (-510.141) (-510.425) * [-509.741] (-510.504) (-512.569) (-513.945) -- 0:00:52
148000 -- [-510.870] (-509.269) (-510.469) (-511.567) * [-511.194] (-509.196) (-512.790) (-510.596) -- 0:00:57
148500 -- (-509.084) (-510.364) [-511.680] (-511.201) * (-513.449) [-508.580] (-511.126) (-511.239) -- 0:00:57
149000 -- [-508.896] (-509.514) (-512.466) (-512.275) * (-512.225) (-509.648) (-509.869) [-509.060] -- 0:00:57
149500 -- (-510.094) (-509.066) (-509.218) [-508.889] * (-509.959) (-511.024) (-511.518) [-514.185] -- 0:00:56
150000 -- (-515.764) [-509.034] (-508.762) (-509.436) * (-512.364) [-509.567] (-513.656) (-511.024) -- 0:00:56
Average standard deviation of split frequencies: 0.023935
150500 -- (-516.757) (-509.746) (-509.784) [-509.171] * (-509.843) (-508.949) [-512.061] (-513.026) -- 0:00:56
151000 -- (-512.367) [-512.496] (-510.324) (-509.425) * (-508.855) (-509.574) (-511.675) [-510.048] -- 0:00:56
151500 -- (-512.765) [-511.178] (-512.684) (-511.337) * (-509.341) (-508.851) [-508.958] (-513.372) -- 0:00:56
152000 -- (-510.615) [-510.557] (-517.258) (-513.485) * (-510.356) [-509.528] (-513.026) (-509.502) -- 0:00:55
152500 -- (-508.974) (-512.402) (-514.296) [-511.807] * (-513.105) [-510.390] (-512.144) (-508.537) -- 0:00:55
153000 -- [-511.202] (-512.234) (-509.006) (-511.324) * (-510.744) (-509.820) [-511.803] (-510.380) -- 0:00:55
153500 -- [-514.004] (-510.409) (-513.900) (-509.375) * [-510.157] (-509.342) (-510.293) (-508.911) -- 0:00:55
154000 -- (-512.351) (-512.089) (-513.139) [-509.361] * (-510.637) [-509.050] (-511.307) (-508.773) -- 0:00:54
154500 -- [-509.415] (-510.013) (-510.826) (-510.935) * (-513.183) [-508.668] (-511.501) (-509.136) -- 0:00:54
155000 -- (-513.271) (-513.479) (-509.565) [-509.254] * (-514.678) [-511.902] (-512.193) (-511.125) -- 0:00:54
Average standard deviation of split frequencies: 0.022107
155500 -- (-512.773) (-511.344) (-510.375) [-514.567] * (-509.844) (-512.547) (-512.038) [-509.133] -- 0:00:54
156000 -- [-509.336] (-512.686) (-511.892) (-509.803) * (-510.666) [-512.131] (-509.842) (-509.155) -- 0:00:54
156500 -- (-510.081) [-508.981] (-510.219) (-514.275) * (-509.436) [-510.005] (-512.461) (-509.612) -- 0:00:53
157000 -- (-511.079) (-509.858) (-511.491) [-510.178] * [-511.490] (-513.928) (-511.902) (-508.907) -- 0:00:53
157500 -- (-510.494) (-509.942) (-509.874) [-511.082] * (-511.917) (-512.202) (-508.874) [-510.126] -- 0:00:53
158000 -- [-508.374] (-513.236) (-513.328) (-510.151) * [-509.523] (-510.109) (-512.136) (-509.894) -- 0:00:53
158500 -- (-508.335) (-511.557) [-511.837] (-514.448) * [-508.782] (-511.405) (-513.799) (-511.503) -- 0:00:53
159000 -- (-510.584) (-508.854) [-509.124] (-510.190) * (-512.107) (-513.622) [-510.211] (-512.646) -- 0:00:52
159500 -- (-512.364) [-512.509] (-508.677) (-510.685) * [-509.875] (-510.115) (-509.691) (-509.470) -- 0:00:52
160000 -- (-510.819) (-511.009) [-510.926] (-510.425) * [-508.899] (-508.642) (-510.286) (-510.782) -- 0:00:52
Average standard deviation of split frequencies: 0.023146
160500 -- (-515.698) [-513.558] (-511.428) (-509.275) * (-509.979) [-510.295] (-509.713) (-511.149) -- 0:00:57
161000 -- (-513.505) [-512.589] (-518.408) (-511.364) * (-512.897) (-509.238) [-509.832] (-517.340) -- 0:00:57
161500 -- (-510.862) [-511.219] (-515.615) (-510.123) * (-514.308) (-509.818) (-510.528) [-512.833] -- 0:00:57
162000 -- [-510.169] (-512.151) (-514.704) (-513.346) * (-511.354) [-508.858] (-509.594) (-510.963) -- 0:00:56
162500 -- (-509.427) (-510.596) [-509.632] (-514.195) * (-510.972) [-508.616] (-511.102) (-510.731) -- 0:00:56
163000 -- (-509.062) (-510.847) [-509.139] (-511.140) * (-512.890) [-509.285] (-510.075) (-510.951) -- 0:00:56
163500 -- (-508.772) (-509.792) [-510.594] (-509.388) * (-510.927) (-509.903) [-508.792] (-511.402) -- 0:00:56
164000 -- [-509.276] (-513.645) (-509.928) (-510.483) * [-509.225] (-509.106) (-509.729) (-510.957) -- 0:00:56
164500 -- (-511.229) [-508.936] (-508.785) (-510.356) * (-509.918) (-508.942) [-509.048] (-510.486) -- 0:00:55
165000 -- [-509.013] (-510.242) (-510.767) (-512.213) * (-509.536) (-508.725) [-514.244] (-511.767) -- 0:00:55
Average standard deviation of split frequencies: 0.022718
165500 -- (-509.383) (-510.055) (-509.869) [-510.045] * (-509.663) (-512.979) [-510.652] (-509.674) -- 0:00:55
166000 -- (-515.133) (-509.267) (-511.034) [-508.356] * (-511.159) (-510.231) [-510.771] (-509.670) -- 0:00:55
166500 -- (-512.732) (-508.980) (-509.678) [-511.482] * (-511.561) [-515.375] (-509.952) (-511.721) -- 0:00:55
167000 -- (-512.135) [-513.740] (-511.183) (-509.577) * (-509.173) (-509.588) (-511.555) [-510.290] -- 0:00:54
167500 -- (-515.404) [-512.015] (-510.720) (-510.018) * (-511.981) (-510.696) (-514.446) [-511.932] -- 0:00:54
168000 -- (-510.190) [-509.463] (-512.442) (-512.241) * (-511.166) [-512.641] (-512.130) (-513.732) -- 0:00:54
168500 -- (-510.722) [-510.240] (-511.007) (-514.138) * (-508.618) (-508.884) (-511.847) [-510.039] -- 0:00:54
169000 -- (-510.716) [-509.915] (-511.188) (-509.256) * [-508.347] (-511.640) (-514.125) (-509.127) -- 0:00:54
169500 -- [-512.633] (-509.682) (-511.549) (-508.842) * [-510.580] (-509.776) (-509.744) (-508.636) -- 0:00:53
170000 -- (-510.960) (-511.853) [-510.710] (-511.484) * (-509.698) (-509.787) [-510.175] (-509.663) -- 0:00:53
Average standard deviation of split frequencies: 0.019642
170500 -- (-517.626) [-509.811] (-511.549) (-513.390) * (-510.739) (-511.286) (-509.898) [-510.108] -- 0:00:53
171000 -- (-511.805) (-511.604) (-512.012) [-510.808] * [-509.675] (-510.891) (-511.740) (-510.062) -- 0:00:53
171500 -- (-511.477) (-510.741) (-510.828) [-511.780] * (-510.677) [-511.416] (-512.622) (-509.539) -- 0:00:53
172000 -- (-512.621) (-509.646) [-511.609] (-513.395) * (-511.295) (-512.140) [-510.690] (-510.399) -- 0:00:52
172500 -- (-510.203) (-508.695) (-508.825) [-511.447] * (-512.763) (-512.758) [-510.788] (-509.804) -- 0:00:52
173000 -- (-513.304) (-509.213) (-508.657) [-510.290] * [-514.720] (-511.828) (-511.488) (-511.735) -- 0:00:52
173500 -- (-508.689) (-509.283) [-509.747] (-513.620) * (-513.442) [-510.204] (-509.369) (-509.149) -- 0:00:52
174000 -- (-510.126) (-513.806) [-509.379] (-510.585) * [-511.950] (-512.384) (-514.220) (-509.298) -- 0:00:52
174500 -- (-509.094) [-511.480] (-511.685) (-509.904) * [-511.005] (-511.217) (-511.182) (-512.507) -- 0:00:52
175000 -- [-508.729] (-511.539) (-509.475) (-510.930) * [-509.921] (-510.353) (-511.682) (-510.775) -- 0:00:51
Average standard deviation of split frequencies: 0.020237
175500 -- (-509.499) (-510.439) (-511.168) [-509.769] * (-509.666) (-511.407) [-509.775] (-510.728) -- 0:00:51
176000 -- [-510.535] (-509.847) (-510.925) (-509.736) * (-513.121) [-510.222] (-509.973) (-515.217) -- 0:00:56
176500 -- (-512.624) [-508.769] (-508.480) (-509.882) * (-512.978) [-509.241] (-512.409) (-512.140) -- 0:00:55
177000 -- (-511.674) [-511.424] (-508.973) (-512.363) * (-510.003) [-509.705] (-510.020) (-511.509) -- 0:00:55
177500 -- (-510.212) (-510.257) [-509.046] (-510.216) * (-513.948) [-511.099] (-511.602) (-514.217) -- 0:00:55
178000 -- [-512.109] (-509.489) (-511.941) (-509.420) * (-517.301) [-511.609] (-510.458) (-508.928) -- 0:00:55
178500 -- (-511.929) [-511.492] (-511.654) (-514.425) * (-511.606) (-511.516) [-512.337] (-508.667) -- 0:00:55
179000 -- (-511.207) [-509.415] (-509.555) (-509.541) * (-510.516) (-509.457) (-510.570) [-509.591] -- 0:00:55
179500 -- (-509.588) (-509.089) [-510.600] (-511.833) * (-508.744) (-510.741) (-510.362) [-508.621] -- 0:00:54
180000 -- (-509.746) [-510.446] (-514.629) (-511.753) * [-513.231] (-512.446) (-511.726) (-508.965) -- 0:00:54
Average standard deviation of split frequencies: 0.021599
180500 -- (-510.562) [-511.156] (-511.413) (-512.951) * (-514.780) (-512.276) [-509.424] (-509.109) -- 0:00:54
181000 -- (-511.569) (-509.865) [-510.075] (-508.697) * [-509.204] (-508.698) (-511.231) (-510.415) -- 0:00:54
181500 -- [-511.127] (-510.595) (-510.110) (-510.495) * (-511.849) (-509.888) (-512.303) [-509.827] -- 0:00:54
182000 -- [-509.341] (-511.309) (-508.854) (-508.855) * (-510.202) (-509.164) (-510.482) [-509.695] -- 0:00:53
182500 -- (-510.594) (-509.139) [-509.128] (-509.273) * (-509.438) [-509.718] (-508.630) (-509.237) -- 0:00:53
183000 -- (-511.732) (-513.978) [-510.174] (-511.773) * (-509.902) (-511.620) [-510.236] (-510.921) -- 0:00:53
183500 -- [-509.065] (-510.820) (-510.580) (-509.987) * [-511.452] (-509.771) (-515.434) (-510.485) -- 0:00:53
184000 -- [-509.626] (-510.462) (-509.955) (-511.396) * [-509.110] (-511.196) (-513.990) (-509.335) -- 0:00:53
184500 -- (-509.589) (-511.677) (-516.921) [-509.323] * (-509.115) [-510.627] (-508.486) (-508.744) -- 0:00:53
185000 -- [-510.899] (-510.316) (-510.877) (-509.733) * [-512.718] (-510.599) (-510.873) (-513.584) -- 0:00:52
Average standard deviation of split frequencies: 0.018942
185500 -- (-514.009) (-511.531) (-513.281) [-509.723] * (-511.557) (-509.734) (-511.214) [-510.056] -- 0:00:52
186000 -- (-511.789) (-513.295) (-510.017) [-510.977] * (-509.936) (-509.811) (-508.933) [-511.246] -- 0:00:52
186500 -- (-510.335) (-509.841) [-508.880] (-512.716) * [-511.781] (-509.361) (-508.838) (-510.560) -- 0:00:52
187000 -- (-511.323) (-509.482) [-513.154] (-510.719) * (-515.232) [-511.791] (-513.461) (-512.978) -- 0:00:52
187500 -- (-513.603) (-511.828) (-509.786) [-513.800] * (-511.484) [-510.395] (-509.258) (-511.233) -- 0:00:52
188000 -- (-512.413) [-511.752] (-509.032) (-511.508) * (-511.207) (-512.353) (-511.052) [-510.263] -- 0:00:51
188500 -- (-513.164) (-513.625) [-509.707] (-512.434) * (-510.187) (-512.789) (-509.444) [-511.254] -- 0:00:51
189000 -- (-510.022) [-511.023] (-513.380) (-511.200) * (-510.144) (-511.393) [-508.495] (-512.999) -- 0:00:51
189500 -- (-510.126) [-510.818] (-509.602) (-517.393) * (-510.547) (-509.432) (-508.718) [-513.009] -- 0:00:51
190000 -- (-515.890) (-511.368) (-511.027) [-513.099] * (-510.573) (-508.925) [-510.522] (-514.559) -- 0:00:51
Average standard deviation of split frequencies: 0.018868
190500 -- (-515.067) (-509.878) (-511.937) [-515.749] * [-509.463] (-511.865) (-510.848) (-511.760) -- 0:00:50
191000 -- [-508.930] (-510.293) (-511.783) (-509.527) * [-509.732] (-511.793) (-511.208) (-511.624) -- 0:00:50
191500 -- (-510.098) [-512.115] (-512.158) (-510.170) * [-510.371] (-514.272) (-510.698) (-511.058) -- 0:00:50
192000 -- (-513.879) (-511.830) (-511.408) [-508.893] * (-510.446) (-511.731) [-512.067] (-509.262) -- 0:00:50
192500 -- (-509.578) (-509.841) [-509.626] (-509.075) * (-510.747) [-509.062] (-509.317) (-509.539) -- 0:00:54
193000 -- (-509.678) (-510.965) (-512.790) [-511.685] * [-509.920] (-508.874) (-509.460) (-509.043) -- 0:00:54
193500 -- (-509.893) [-510.555] (-510.660) (-515.588) * (-510.917) [-512.615] (-510.779) (-513.769) -- 0:00:54
194000 -- (-511.803) (-513.830) (-510.914) [-510.468] * (-509.685) [-509.549] (-510.931) (-515.060) -- 0:00:54
194500 -- (-511.137) (-512.456) (-508.800) [-510.970] * (-510.832) (-510.359) (-512.391) [-511.747] -- 0:00:53
195000 -- (-510.404) [-509.316] (-511.980) (-509.320) * [-509.200] (-510.320) (-510.517) (-508.889) -- 0:00:53
Average standard deviation of split frequencies: 0.017905
195500 -- (-512.027) [-510.888] (-510.958) (-513.637) * (-508.673) (-508.819) [-508.698] (-510.105) -- 0:00:53
196000 -- (-511.555) (-509.931) [-510.830] (-512.457) * (-509.375) (-508.622) (-509.295) [-508.673] -- 0:00:53
196500 -- [-511.229] (-510.282) (-512.358) (-509.612) * [-509.913] (-511.332) (-509.591) (-509.285) -- 0:00:53
197000 -- (-508.600) (-510.540) (-510.255) [-510.531] * (-509.187) [-508.577] (-509.383) (-510.564) -- 0:00:52
197500 -- (-509.994) (-514.305) (-511.138) [-509.051] * [-510.863] (-511.913) (-511.149) (-512.945) -- 0:00:52
198000 -- (-511.247) (-512.713) (-508.516) [-509.773] * [-509.286] (-510.326) (-509.637) (-512.523) -- 0:00:52
198500 -- (-510.713) (-510.899) [-508.274] (-509.750) * [-510.619] (-510.712) (-513.280) (-509.820) -- 0:00:52
199000 -- (-512.019) (-511.514) [-508.745] (-509.322) * (-509.992) (-510.697) (-511.390) [-509.977] -- 0:00:52
199500 -- [-510.556] (-510.048) (-513.880) (-514.005) * (-513.332) (-509.422) (-513.369) [-508.204] -- 0:00:52
200000 -- (-510.651) [-510.308] (-509.985) (-512.951) * (-510.478) (-510.780) (-512.800) [-510.944] -- 0:00:51
Average standard deviation of split frequencies: 0.018517
200500 -- (-508.374) [-512.033] (-511.341) (-510.398) * (-513.422) (-510.689) (-512.035) [-510.751] -- 0:00:51
201000 -- (-508.519) [-511.236] (-515.212) (-509.034) * (-513.325) (-509.352) (-513.491) [-513.648] -- 0:00:51
201500 -- (-509.073) (-513.283) (-512.884) [-512.762] * (-511.304) (-508.738) (-510.213) [-509.878] -- 0:00:51
202000 -- [-509.447] (-514.065) (-511.652) (-512.756) * (-509.250) (-513.360) [-510.138] (-510.876) -- 0:00:51
202500 -- (-508.593) (-512.398) (-510.889) [-513.422] * [-509.376] (-512.198) (-513.313) (-510.831) -- 0:00:51
203000 -- (-509.129) (-508.842) (-510.233) [-508.221] * (-509.734) (-513.218) (-511.520) [-511.148] -- 0:00:51
203500 -- (-509.294) [-511.622] (-510.190) (-509.405) * (-510.008) (-512.540) [-510.531] (-510.655) -- 0:00:50
204000 -- [-511.578] (-512.725) (-509.921) (-509.427) * (-508.736) [-512.215] (-509.997) (-510.257) -- 0:00:50
204500 -- (-509.300) (-509.885) (-510.635) [-510.401] * (-511.480) (-523.119) (-509.430) [-510.883] -- 0:00:50
205000 -- (-510.757) (-510.751) (-512.086) [-510.698] * (-509.336) (-517.198) [-508.868] (-515.472) -- 0:00:50
Average standard deviation of split frequencies: 0.019993
205500 -- (-512.074) (-513.319) [-511.724] (-509.936) * (-514.235) (-515.519) (-509.336) [-510.838] -- 0:00:50
206000 -- (-511.087) [-512.575] (-508.809) (-509.768) * [-513.575] (-509.266) (-511.984) (-512.100) -- 0:00:50
206500 -- (-510.121) (-509.998) (-509.060) [-510.385] * (-512.003) [-509.250] (-510.424) (-512.548) -- 0:00:49
207000 -- [-508.870] (-514.137) (-510.146) (-515.220) * (-512.342) (-511.674) [-511.019] (-509.875) -- 0:00:49
207500 -- (-518.096) (-511.031) [-511.116] (-510.270) * [-509.731] (-509.112) (-510.159) (-512.178) -- 0:00:49
208000 -- (-512.043) (-509.927) (-508.828) [-509.124] * (-513.522) (-513.949) (-508.582) [-511.669] -- 0:00:49
208500 -- (-512.554) [-508.892] (-513.779) (-509.440) * (-509.076) (-513.675) (-511.103) [-512.052] -- 0:00:53
209000 -- (-510.931) (-509.425) [-508.994] (-508.402) * (-513.559) [-512.130] (-511.201) (-512.982) -- 0:00:52
209500 -- (-511.440) [-514.097] (-508.915) (-511.190) * (-509.064) (-512.302) [-511.075] (-513.680) -- 0:00:52
210000 -- [-514.973] (-511.294) (-513.071) (-513.845) * (-509.785) [-509.108] (-512.223) (-510.239) -- 0:00:52
Average standard deviation of split frequencies: 0.020257
210500 -- (-512.953) (-510.377) [-510.710] (-508.809) * (-510.899) [-509.163] (-510.954) (-514.038) -- 0:00:52
211000 -- [-509.354] (-513.220) (-512.273) (-509.227) * (-513.874) [-509.530] (-511.998) (-511.424) -- 0:00:52
211500 -- (-508.594) (-511.421) (-509.258) [-510.671] * (-510.597) [-510.387] (-509.313) (-508.492) -- 0:00:52
212000 -- (-515.006) (-511.272) [-508.577] (-510.544) * (-510.481) (-509.616) [-509.881] (-512.855) -- 0:00:52
212500 -- (-510.947) [-510.464] (-513.836) (-508.811) * (-514.460) (-510.179) [-512.896] (-511.255) -- 0:00:51
213000 -- (-509.844) (-511.103) (-513.177) [-510.229] * (-509.322) (-510.955) [-510.878] (-511.513) -- 0:00:51
213500 -- (-509.168) (-509.348) [-508.341] (-509.059) * (-508.575) (-510.950) [-512.838] (-514.136) -- 0:00:51
214000 -- (-509.696) (-510.137) [-509.966] (-509.626) * [-508.490] (-509.316) (-511.345) (-511.986) -- 0:00:51
214500 -- [-508.826] (-509.928) (-513.827) (-511.761) * (-510.180) (-509.141) [-513.578] (-511.078) -- 0:00:51
215000 -- (-509.678) (-508.344) [-510.429] (-515.731) * [-511.178] (-508.814) (-511.887) (-512.856) -- 0:00:51
Average standard deviation of split frequencies: 0.019642
215500 -- (-509.492) [-509.340] (-513.341) (-509.981) * [-509.783] (-510.470) (-514.353) (-511.676) -- 0:00:50
216000 -- (-511.925) [-509.670] (-511.130) (-510.526) * (-509.216) (-509.517) [-513.775] (-509.232) -- 0:00:50
216500 -- [-516.266] (-511.137) (-515.159) (-514.601) * (-510.378) (-510.820) (-511.364) [-511.622] -- 0:00:50
217000 -- (-510.542) (-512.443) (-510.015) [-509.634] * (-511.066) (-509.416) [-511.202] (-512.316) -- 0:00:50
217500 -- (-513.353) (-508.789) (-509.517) [-509.769] * (-512.487) (-512.946) [-513.028] (-512.892) -- 0:00:50
218000 -- (-509.701) (-508.600) [-510.062] (-509.814) * (-510.122) (-512.114) (-514.510) [-512.662] -- 0:00:50
218500 -- (-511.357) (-509.025) [-513.297] (-509.781) * [-509.839] (-512.549) (-512.974) (-512.453) -- 0:00:50
219000 -- (-509.477) (-509.745) (-509.203) [-509.413] * (-510.738) (-512.675) (-509.768) [-512.499] -- 0:00:49
219500 -- (-510.971) [-511.340] (-514.217) (-512.683) * (-510.189) (-511.264) (-512.368) [-511.526] -- 0:00:49
220000 -- (-512.665) (-509.494) (-509.415) [-510.028] * (-513.222) (-511.361) [-510.211] (-511.401) -- 0:00:49
Average standard deviation of split frequencies: 0.019583
220500 -- (-509.617) (-509.856) (-510.075) [-513.525] * (-511.499) (-510.319) [-510.876] (-516.615) -- 0:00:49
221000 -- (-514.397) (-512.054) [-510.753] (-510.257) * (-510.992) [-510.452] (-509.947) (-511.254) -- 0:00:49
221500 -- (-512.723) [-514.439] (-511.067) (-512.886) * (-510.844) (-511.014) (-513.640) [-510.650] -- 0:00:49
222000 -- [-509.422] (-509.841) (-510.497) (-513.543) * [-511.372] (-508.376) (-511.534) (-513.886) -- 0:00:49
222500 -- [-510.805] (-513.517) (-510.724) (-510.153) * (-510.210) (-508.849) (-510.962) [-508.938] -- 0:00:48
223000 -- (-510.786) (-513.965) (-513.210) [-508.951] * (-510.169) (-508.813) (-510.185) [-510.881] -- 0:00:48
223500 -- (-511.383) [-509.594] (-510.589) (-509.467) * (-511.738) (-512.490) [-512.344] (-508.927) -- 0:00:48
224000 -- [-508.744] (-510.585) (-511.962) (-510.880) * (-510.330) (-516.535) (-516.193) [-509.194] -- 0:00:48
224500 -- (-511.574) (-510.355) (-512.531) [-513.370] * [-508.589] (-513.496) (-510.100) (-510.207) -- 0:00:51
225000 -- (-508.771) (-510.770) [-510.236] (-512.441) * (-510.592) [-515.287] (-509.014) (-509.718) -- 0:00:51
Average standard deviation of split frequencies: 0.018663
225500 -- (-509.386) (-510.317) [-510.486] (-509.529) * [-510.486] (-509.605) (-508.674) (-508.939) -- 0:00:51
226000 -- [-511.573] (-509.944) (-511.995) (-515.206) * (-511.972) (-513.554) (-510.982) [-513.453] -- 0:00:51
226500 -- [-510.431] (-510.577) (-510.937) (-512.531) * (-510.039) (-513.387) (-509.713) [-509.552] -- 0:00:51
227000 -- (-511.108) [-512.909] (-513.954) (-511.476) * [-514.449] (-511.347) (-511.423) (-510.308) -- 0:00:51
227500 -- [-512.452] (-511.583) (-509.402) (-510.148) * (-510.632) (-509.385) [-510.713] (-509.685) -- 0:00:50
228000 -- (-510.002) (-512.559) (-510.179) [-508.904] * (-510.814) (-511.239) (-512.719) [-510.468] -- 0:00:50
228500 -- (-509.023) (-509.445) [-509.308] (-510.068) * [-510.641] (-511.345) (-514.949) (-510.645) -- 0:00:50
229000 -- [-511.874] (-511.054) (-509.315) (-509.348) * (-512.361) (-511.466) [-509.738] (-510.086) -- 0:00:50
229500 -- (-513.767) (-509.173) [-508.197] (-512.338) * (-508.691) (-509.060) (-509.319) [-513.202] -- 0:00:50
230000 -- (-511.937) (-509.457) [-512.548] (-513.186) * (-509.259) (-510.332) (-509.353) [-511.754] -- 0:00:50
Average standard deviation of split frequencies: 0.017640
230500 -- (-512.930) (-510.865) [-511.278] (-511.784) * (-509.207) (-509.797) (-510.186) [-510.819] -- 0:00:50
231000 -- [-511.695] (-512.103) (-509.882) (-510.798) * [-510.545] (-510.562) (-508.540) (-509.816) -- 0:00:49
231500 -- (-511.853) [-510.359] (-511.064) (-510.893) * (-509.961) (-511.810) [-509.315] (-509.427) -- 0:00:49
232000 -- (-509.506) [-512.578] (-510.786) (-511.994) * (-510.075) (-509.535) [-510.681] (-508.670) -- 0:00:49
232500 -- (-511.241) [-513.004] (-510.760) (-511.189) * (-510.401) (-509.636) [-508.578] (-512.588) -- 0:00:49
233000 -- [-514.809] (-510.149) (-512.104) (-509.545) * (-512.504) (-511.313) [-508.544] (-511.739) -- 0:00:49
233500 -- [-511.625] (-511.782) (-511.518) (-512.127) * (-510.409) (-508.382) [-509.876] (-510.654) -- 0:00:49
234000 -- (-508.805) [-509.536] (-511.931) (-512.268) * (-512.651) (-509.211) [-511.427] (-510.420) -- 0:00:49
234500 -- (-512.709) (-512.021) [-509.111] (-512.588) * (-509.226) [-510.959] (-511.587) (-509.373) -- 0:00:48
235000 -- (-511.945) [-510.470] (-509.398) (-509.743) * (-509.471) [-508.856] (-513.172) (-511.494) -- 0:00:48
Average standard deviation of split frequencies: 0.017662
235500 -- (-514.506) [-509.967] (-510.377) (-511.945) * (-509.343) (-508.877) (-511.251) [-509.218] -- 0:00:48
236000 -- [-512.229] (-509.229) (-511.355) (-508.403) * (-512.049) [-509.668] (-510.360) (-517.855) -- 0:00:48
236500 -- (-510.414) [-508.680] (-509.588) (-509.362) * (-509.794) (-509.724) (-508.855) [-511.582] -- 0:00:48
237000 -- [-510.810] (-509.493) (-509.416) (-510.924) * (-509.091) (-513.411) (-509.972) [-509.582] -- 0:00:48
237500 -- (-509.926) [-511.281] (-509.069) (-509.234) * (-510.544) (-511.000) (-509.591) [-511.643] -- 0:00:48
238000 -- [-509.555] (-512.385) (-510.298) (-515.282) * [-511.711] (-509.935) (-509.061) (-512.223) -- 0:00:48
238500 -- (-513.007) (-510.822) (-509.950) [-509.096] * [-510.932] (-512.109) (-511.300) (-511.454) -- 0:00:47
239000 -- [-512.655] (-512.083) (-509.740) (-509.884) * (-509.233) [-508.426] (-510.966) (-513.914) -- 0:00:47
239500 -- [-510.122] (-512.565) (-510.576) (-513.501) * (-510.929) (-510.026) [-511.854] (-514.169) -- 0:00:47
240000 -- (-512.381) (-511.603) (-510.047) [-509.747] * (-512.916) [-511.016] (-511.619) (-515.770) -- 0:00:47
Average standard deviation of split frequencies: 0.017053
240500 -- (-508.574) [-508.692] (-509.003) (-510.317) * (-510.025) [-512.129] (-512.275) (-510.929) -- 0:00:50
241000 -- (-509.781) [-513.504] (-511.913) (-508.416) * (-510.949) (-512.702) (-510.757) [-510.424] -- 0:00:50
241500 -- (-509.584) [-510.599] (-509.546) (-510.434) * (-513.960) [-510.151] (-510.638) (-511.343) -- 0:00:50
242000 -- (-512.023) (-509.579) [-510.237] (-510.004) * [-509.920] (-511.532) (-509.290) (-512.217) -- 0:00:50
242500 -- (-512.588) [-512.607] (-510.343) (-511.084) * (-510.472) [-511.958] (-508.634) (-520.912) -- 0:00:49
243000 -- (-513.939) [-511.774] (-510.473) (-512.689) * [-512.887] (-510.469) (-509.764) (-509.243) -- 0:00:49
243500 -- (-510.860) [-508.885] (-508.703) (-509.758) * (-510.051) (-512.469) [-509.497] (-510.021) -- 0:00:49
244000 -- (-509.963) (-511.367) (-511.142) [-511.260] * (-510.985) (-512.065) [-509.101] (-509.259) -- 0:00:49
244500 -- (-512.534) [-510.531] (-509.613) (-511.484) * (-510.084) (-512.450) [-509.860] (-510.876) -- 0:00:49
245000 -- (-515.307) [-510.156] (-511.617) (-512.435) * (-509.293) [-510.574] (-511.736) (-509.367) -- 0:00:49
Average standard deviation of split frequencies: 0.015668
245500 -- [-510.944] (-510.931) (-508.821) (-511.781) * [-509.725] (-510.627) (-511.352) (-511.537) -- 0:00:49
246000 -- (-511.995) (-509.863) [-510.892] (-511.755) * (-509.410) [-513.370] (-511.087) (-513.444) -- 0:00:49
246500 -- (-511.614) (-511.252) (-510.272) [-510.979] * (-511.694) (-515.957) [-512.317] (-511.092) -- 0:00:48
247000 -- (-509.428) (-512.021) (-508.683) [-509.154] * (-510.484) (-510.994) [-513.580] (-510.117) -- 0:00:48
247500 -- (-510.148) (-509.758) (-510.158) [-513.058] * [-511.217] (-510.328) (-509.368) (-509.744) -- 0:00:48
248000 -- [-510.453] (-513.640) (-510.051) (-510.871) * [-510.440] (-509.693) (-510.174) (-508.716) -- 0:00:48
248500 -- (-509.901) (-510.379) (-510.093) [-511.762] * (-511.121) (-511.192) [-511.349] (-508.973) -- 0:00:48
249000 -- (-508.643) [-509.260] (-511.583) (-513.882) * [-510.522] (-509.316) (-511.357) (-510.912) -- 0:00:48
249500 -- (-511.937) (-509.520) [-511.288] (-510.490) * (-510.210) [-513.454] (-511.386) (-513.434) -- 0:00:48
250000 -- [-509.282] (-513.200) (-510.394) (-512.227) * (-511.076) (-512.094) (-510.897) [-512.886] -- 0:00:48
Average standard deviation of split frequencies: 0.015045
250500 -- (-510.878) (-511.149) (-511.901) [-509.328] * [-509.134] (-512.732) (-509.239) (-514.030) -- 0:00:47
251000 -- (-509.479) (-508.800) (-511.676) [-508.957] * [-513.380] (-517.407) (-508.808) (-512.021) -- 0:00:47
251500 -- (-513.584) [-509.907] (-510.370) (-509.997) * (-509.758) [-509.431] (-508.837) (-511.663) -- 0:00:47
252000 -- [-511.290] (-508.826) (-509.532) (-509.315) * (-512.632) (-509.107) [-510.437] (-511.616) -- 0:00:47
252500 -- [-509.264] (-513.031) (-509.140) (-511.188) * (-517.879) (-514.996) (-508.479) [-510.112] -- 0:00:47
253000 -- (-509.472) [-511.438] (-509.421) (-513.227) * (-512.841) [-511.520] (-511.209) (-512.822) -- 0:00:47
253500 -- (-512.454) [-510.443] (-512.202) (-509.320) * (-509.749) (-511.849) [-509.614] (-511.518) -- 0:00:47
254000 -- (-514.162) (-508.879) [-511.861] (-509.516) * (-512.458) [-509.960] (-509.173) (-509.582) -- 0:00:46
254500 -- [-511.008] (-508.772) (-513.438) (-513.272) * (-512.398) [-514.856] (-509.364) (-512.350) -- 0:00:46
255000 -- (-510.836) [-510.164] (-509.680) (-509.033) * (-513.547) (-513.629) [-509.105] (-510.402) -- 0:00:46
Average standard deviation of split frequencies: 0.015598
255500 -- (-511.220) (-509.814) [-512.133] (-510.118) * (-509.765) (-509.471) [-509.032] (-510.873) -- 0:00:49
256000 -- [-509.890] (-512.309) (-511.151) (-514.932) * (-509.591) (-509.099) (-509.293) [-510.853] -- 0:00:49
256500 -- [-510.115] (-509.975) (-513.534) (-509.827) * [-513.885] (-510.061) (-513.399) (-510.403) -- 0:00:49
257000 -- (-512.098) [-509.874] (-509.446) (-516.749) * [-509.167] (-508.797) (-510.841) (-509.894) -- 0:00:49
257500 -- (-511.853) [-509.526] (-510.070) (-509.110) * (-512.721) [-509.966] (-509.891) (-512.698) -- 0:00:49
258000 -- [-509.876] (-513.165) (-508.880) (-510.675) * [-509.852] (-513.245) (-511.809) (-510.933) -- 0:00:48
258500 -- [-510.083] (-512.099) (-510.298) (-511.227) * [-508.475] (-512.663) (-511.583) (-510.212) -- 0:00:48
259000 -- (-509.680) (-511.582) [-510.154] (-511.531) * (-510.243) [-512.502] (-510.658) (-510.388) -- 0:00:48
259500 -- (-508.972) [-511.854] (-512.346) (-510.829) * (-508.971) (-509.967) (-509.044) [-509.948] -- 0:00:48
260000 -- (-511.574) (-514.528) (-510.111) [-511.478] * (-509.812) [-508.981] (-509.460) (-511.606) -- 0:00:48
Average standard deviation of split frequencies: 0.014468
260500 -- [-509.185] (-512.325) (-509.483) (-512.543) * (-510.924) (-510.066) [-511.745] (-512.175) -- 0:00:48
261000 -- [-510.931] (-509.585) (-509.615) (-514.691) * (-510.799) (-512.648) [-513.878] (-512.571) -- 0:00:48
261500 -- (-514.956) [-509.178] (-513.047) (-511.589) * (-510.377) (-510.976) (-510.754) [-508.620] -- 0:00:48
262000 -- (-509.713) [-509.126] (-513.269) (-511.703) * (-509.134) (-509.141) (-510.368) [-512.296] -- 0:00:47
262500 -- (-512.007) (-512.315) [-512.203] (-508.946) * [-509.052] (-510.499) (-512.942) (-512.322) -- 0:00:47
263000 -- (-510.866) (-511.806) [-511.712] (-509.725) * (-509.052) [-509.820] (-511.427) (-510.684) -- 0:00:47
263500 -- [-510.821] (-512.653) (-511.806) (-509.683) * (-510.310) [-508.322] (-516.306) (-508.556) -- 0:00:47
264000 -- (-510.945) (-510.150) [-509.530] (-509.811) * (-509.416) [-509.120] (-515.262) (-509.548) -- 0:00:47
264500 -- (-509.996) (-510.044) [-511.369] (-513.927) * (-509.868) (-514.234) (-509.595) [-510.214] -- 0:00:47
265000 -- (-509.189) (-509.949) [-510.422] (-509.633) * (-509.721) [-510.085] (-511.632) (-514.186) -- 0:00:47
Average standard deviation of split frequencies: 0.014473
265500 -- (-509.670) [-510.717] (-513.068) (-512.904) * (-514.426) (-510.597) [-516.322] (-510.432) -- 0:00:47
266000 -- (-511.376) [-510.002] (-511.519) (-509.368) * [-511.502] (-511.008) (-511.213) (-509.536) -- 0:00:46
266500 -- [-510.723] (-516.972) (-512.726) (-509.724) * (-511.478) (-511.058) [-510.904] (-514.254) -- 0:00:46
267000 -- (-510.395) [-510.759] (-512.107) (-510.082) * [-510.470] (-512.023) (-511.413) (-510.654) -- 0:00:46
267500 -- (-508.808) [-509.860] (-511.748) (-510.373) * (-509.524) (-511.301) (-510.939) [-513.046] -- 0:00:46
268000 -- (-509.462) (-514.895) (-510.501) [-510.237] * (-513.382) (-515.650) [-509.384] (-509.570) -- 0:00:46
268500 -- (-514.372) (-514.040) (-509.851) [-510.002] * (-513.800) (-513.803) [-509.723] (-510.128) -- 0:00:46
269000 -- [-512.528] (-512.697) (-511.119) (-509.369) * (-509.469) (-512.301) [-515.163] (-515.646) -- 0:00:46
269500 -- (-508.628) (-510.145) [-509.261] (-510.794) * (-510.686) (-509.728) (-511.023) [-511.624] -- 0:00:46
270000 -- [-510.426] (-510.022) (-512.585) (-509.342) * (-510.400) [-509.293] (-510.787) (-513.522) -- 0:00:48
Average standard deviation of split frequencies: 0.013062
270500 -- (-513.983) (-510.971) (-512.769) [-511.178] * (-510.432) (-509.486) [-510.136] (-511.724) -- 0:00:48
271000 -- [-511.424] (-509.163) (-512.145) (-510.087) * (-512.094) (-511.283) (-509.463) [-514.375] -- 0:00:48
271500 -- (-512.657) [-513.610] (-514.937) (-512.998) * (-511.169) [-510.214] (-510.981) (-508.788) -- 0:00:48
272000 -- (-509.867) (-509.831) (-513.804) [-510.877] * (-513.541) (-509.819) (-509.539) [-509.271] -- 0:00:48
272500 -- (-511.835) (-510.640) [-511.084] (-508.651) * (-513.767) (-515.812) [-511.441] (-511.375) -- 0:00:48
273000 -- (-511.588) (-511.793) [-510.167] (-515.508) * (-511.834) (-520.567) [-511.045] (-509.401) -- 0:00:47
273500 -- (-509.037) (-512.153) (-510.454) [-509.845] * (-510.559) [-510.362] (-510.361) (-512.404) -- 0:00:47
274000 -- (-515.006) (-514.968) [-514.025] (-509.316) * (-510.434) [-510.661] (-510.667) (-510.734) -- 0:00:47
274500 -- [-509.504] (-514.182) (-509.393) (-510.250) * (-510.021) (-513.404) (-509.310) [-510.033] -- 0:00:47
275000 -- [-508.358] (-510.538) (-509.906) (-510.960) * [-509.309] (-512.246) (-510.552) (-514.045) -- 0:00:47
Average standard deviation of split frequencies: 0.013569
275500 -- (-509.395) (-510.437) (-512.955) [-511.060] * (-512.149) [-511.305] (-510.941) (-509.571) -- 0:00:47
276000 -- (-510.213) [-509.021] (-510.720) (-511.589) * (-511.189) (-509.798) [-510.232] (-509.950) -- 0:00:47
276500 -- (-511.525) (-512.789) [-512.435] (-510.025) * (-510.516) [-509.505] (-509.237) (-511.337) -- 0:00:47
277000 -- (-511.305) (-509.815) (-509.593) [-514.854] * (-510.678) (-509.563) [-509.733] (-510.976) -- 0:00:46
277500 -- (-509.593) (-509.336) (-509.881) [-513.779] * (-510.232) (-510.698) [-509.736] (-508.569) -- 0:00:46
278000 -- [-512.245] (-513.183) (-511.454) (-512.928) * (-510.626) (-508.826) [-511.378] (-511.400) -- 0:00:46
278500 -- (-510.473) (-516.050) [-510.724] (-510.085) * (-509.098) (-511.461) (-509.540) [-511.328] -- 0:00:46
279000 -- (-509.579) (-509.710) (-509.283) [-509.562] * (-509.905) [-511.528] (-516.060) (-509.680) -- 0:00:46
279500 -- (-510.159) (-515.233) (-509.335) [-508.896] * (-510.774) (-509.774) [-509.239] (-508.566) -- 0:00:46
280000 -- (-509.379) [-508.910] (-509.207) (-510.551) * (-510.071) [-508.447] (-510.117) (-516.432) -- 0:00:46
Average standard deviation of split frequencies: 0.014067
280500 -- [-511.231] (-509.237) (-509.225) (-510.150) * [-509.319] (-508.766) (-512.803) (-514.454) -- 0:00:46
281000 -- (-511.805) (-510.319) (-513.710) [-509.934] * (-514.862) [-508.638] (-508.553) (-513.898) -- 0:00:46
281500 -- (-512.838) (-509.913) (-512.097) [-509.736] * [-511.307] (-511.919) (-509.832) (-509.969) -- 0:00:45
282000 -- (-509.945) [-510.748] (-509.292) (-509.747) * (-510.122) (-510.941) (-510.109) [-510.657] -- 0:00:45
282500 -- [-508.971] (-512.213) (-509.267) (-510.867) * (-509.023) [-512.685] (-514.846) (-510.061) -- 0:00:45
283000 -- (-511.055) (-508.603) (-510.867) [-509.377] * (-511.249) (-510.288) (-510.712) [-510.369] -- 0:00:45
283500 -- [-508.477] (-509.606) (-509.530) (-510.099) * (-509.395) (-517.572) [-510.579] (-512.530) -- 0:00:45
284000 -- (-510.827) [-508.736] (-509.209) (-511.872) * [-512.475] (-510.077) (-509.107) (-510.021) -- 0:00:45
284500 -- (-511.270) (-509.293) [-508.908] (-510.727) * (-510.721) (-511.145) (-508.920) [-510.656] -- 0:00:45
285000 -- (-509.905) (-508.928) (-510.745) [-509.905] * [-510.903] (-517.003) (-510.666) (-509.516) -- 0:00:45
Average standard deviation of split frequencies: 0.014834
285500 -- (-508.635) (-510.294) (-510.113) [-509.768] * (-510.921) (-511.743) (-509.896) [-509.405] -- 0:00:45
286000 -- (-509.941) (-511.073) [-509.252] (-509.858) * (-508.855) (-511.832) (-509.194) [-509.868] -- 0:00:47
286500 -- [-512.304] (-509.356) (-513.188) (-509.964) * (-509.478) (-512.067) [-510.795] (-509.652) -- 0:00:47
287000 -- (-512.027) (-509.192) (-510.952) [-508.684] * (-510.928) (-509.226) [-510.251] (-514.505) -- 0:00:47
287500 -- (-509.551) (-511.484) [-510.539] (-510.257) * [-509.353] (-513.273) (-509.312) (-516.376) -- 0:00:47
288000 -- (-509.826) (-512.015) (-510.665) [-509.120] * (-511.324) (-508.529) [-509.754] (-512.520) -- 0:00:46
288500 -- (-509.374) (-511.682) [-513.538] (-510.780) * [-514.006] (-511.641) (-511.014) (-510.723) -- 0:00:46
289000 -- (-510.082) (-511.584) [-510.024] (-509.390) * [-510.152] (-511.197) (-509.944) (-514.138) -- 0:00:46
289500 -- [-509.818] (-517.454) (-509.073) (-510.309) * (-511.743) (-510.168) [-509.422] (-513.790) -- 0:00:46
290000 -- (-512.280) (-510.578) [-511.303] (-513.134) * (-509.500) (-512.171) [-508.803] (-510.872) -- 0:00:46
Average standard deviation of split frequencies: 0.015407
290500 -- (-510.133) (-510.558) [-510.673] (-510.747) * (-509.806) (-514.996) (-509.409) [-512.379] -- 0:00:46
291000 -- [-509.262] (-510.768) (-514.003) (-510.157) * (-510.067) (-511.701) (-510.964) [-508.717] -- 0:00:46
291500 -- (-509.830) (-509.488) (-510.309) [-510.147] * (-511.968) (-511.875) (-510.050) [-509.676] -- 0:00:46
292000 -- (-510.763) [-510.780] (-512.052) (-512.122) * (-512.035) (-509.808) [-508.576] (-511.039) -- 0:00:46
292500 -- [-510.162] (-512.358) (-509.033) (-512.661) * (-509.561) [-508.720] (-509.236) (-509.821) -- 0:00:45
293000 -- (-512.097) (-509.251) (-509.714) [-511.948] * (-512.225) (-510.137) (-508.733) [-510.904] -- 0:00:45
293500 -- (-509.749) (-508.750) [-511.601] (-511.895) * (-511.429) [-509.022] (-509.130) (-513.532) -- 0:00:45
294000 -- (-509.771) [-512.555] (-508.871) (-510.269) * (-510.832) (-509.411) [-510.595] (-510.690) -- 0:00:45
294500 -- (-509.479) (-510.936) (-508.700) [-508.876] * (-509.880) (-511.787) (-510.492) [-510.681] -- 0:00:45
295000 -- (-510.001) [-510.758] (-509.305) (-509.314) * (-510.543) (-509.144) [-514.581] (-510.404) -- 0:00:45
Average standard deviation of split frequencies: 0.014687
295500 -- [-510.070] (-513.986) (-508.995) (-509.004) * [-510.604] (-510.390) (-512.981) (-511.669) -- 0:00:45
296000 -- (-508.642) (-511.549) (-511.929) [-509.894] * (-510.999) (-511.315) [-509.983] (-512.145) -- 0:00:45
296500 -- [-512.105] (-511.387) (-508.849) (-510.844) * (-512.412) (-508.667) (-508.874) [-510.222] -- 0:00:45
297000 -- [-510.807] (-513.966) (-509.681) (-509.580) * (-510.979) (-511.366) (-508.633) [-509.153] -- 0:00:44
297500 -- (-508.519) (-509.546) (-510.473) [-509.894] * (-513.386) (-508.885) [-510.168] (-510.017) -- 0:00:44
298000 -- (-510.936) (-511.442) (-515.214) [-510.688] * (-513.518) (-508.453) (-510.994) [-509.268] -- 0:00:44
298500 -- [-509.197] (-511.228) (-515.593) (-512.794) * (-510.406) (-511.716) (-512.155) [-508.799] -- 0:00:44
299000 -- (-510.794) (-510.889) [-510.502] (-510.495) * (-512.174) (-509.589) (-513.782) [-508.782] -- 0:00:44
299500 -- (-512.891) [-510.636] (-510.397) (-513.952) * (-512.182) (-510.246) (-515.013) [-511.772] -- 0:00:44
300000 -- [-510.507] (-508.925) (-510.729) (-512.744) * (-510.515) (-509.252) [-511.940] (-512.340) -- 0:00:44
Average standard deviation of split frequencies: 0.014664
300500 -- [-510.707] (-513.630) (-513.497) (-513.753) * (-513.642) (-509.852) [-510.870] (-510.298) -- 0:00:44
301000 -- (-509.689) (-513.084) [-511.261] (-510.556) * (-515.666) (-511.413) (-512.063) [-510.999] -- 0:00:44
301500 -- (-511.344) (-512.899) (-513.436) [-509.383] * (-513.588) (-510.974) [-512.102] (-510.320) -- 0:00:44
302000 -- (-511.557) [-509.012] (-511.591) (-511.693) * (-510.041) (-510.848) [-512.511] (-511.508) -- 0:00:43
302500 -- (-510.044) [-509.926] (-510.604) (-512.353) * (-509.112) [-508.655] (-511.919) (-509.470) -- 0:00:46
303000 -- [-509.406] (-510.929) (-509.540) (-509.737) * (-509.294) (-508.521) [-508.605] (-510.107) -- 0:00:46
303500 -- (-508.750) [-515.741] (-509.146) (-513.517) * (-510.829) (-512.095) [-508.746] (-510.215) -- 0:00:45
304000 -- (-509.845) (-512.135) [-510.348] (-512.923) * (-510.669) [-510.882] (-508.730) (-512.192) -- 0:00:45
304500 -- [-510.820] (-509.232) (-511.514) (-512.516) * (-509.430) (-510.964) (-509.507) [-509.675] -- 0:00:45
305000 -- (-511.299) [-509.943] (-510.403) (-510.580) * [-508.842] (-508.701) (-508.817) (-510.409) -- 0:00:45
Average standard deviation of split frequencies: 0.015043
305500 -- (-509.928) [-511.225] (-510.293) (-508.741) * (-511.304) (-509.362) (-511.600) [-509.866] -- 0:00:45
306000 -- (-509.453) [-509.546] (-509.877) (-508.797) * [-510.082] (-512.497) (-513.645) (-513.599) -- 0:00:45
306500 -- [-509.129] (-511.822) (-509.839) (-515.723) * (-513.547) (-510.539) [-508.299] (-509.198) -- 0:00:45
307000 -- (-511.493) (-511.037) (-510.574) [-510.784] * (-512.704) (-510.810) (-511.479) [-511.022] -- 0:00:45
307500 -- (-510.328) [-509.175] (-509.376) (-509.047) * [-509.541] (-508.948) (-510.798) (-511.427) -- 0:00:45
308000 -- (-509.482) (-508.783) [-509.006] (-510.223) * [-512.397] (-510.123) (-512.179) (-508.852) -- 0:00:44
308500 -- (-511.782) [-509.236] (-509.829) (-511.406) * [-510.708] (-509.507) (-511.037) (-509.686) -- 0:00:44
309000 -- (-511.552) [-512.610] (-512.908) (-512.033) * (-509.807) (-510.243) [-509.486] (-509.694) -- 0:00:44
309500 -- (-514.266) (-511.121) [-512.376] (-510.691) * (-509.326) (-511.652) [-510.619] (-509.739) -- 0:00:44
310000 -- (-509.900) (-514.943) [-512.123] (-511.852) * (-513.047) [-510.242] (-512.688) (-511.240) -- 0:00:44
Average standard deviation of split frequencies: 0.014281
310500 -- (-510.276) (-512.912) [-509.481] (-509.624) * (-509.215) [-511.034] (-511.601) (-510.801) -- 0:00:44
311000 -- [-509.803] (-515.025) (-510.754) (-508.690) * (-511.155) (-510.444) [-509.966] (-511.403) -- 0:00:44
311500 -- (-508.832) (-510.623) (-514.780) [-510.999] * [-514.716] (-510.258) (-511.316) (-510.441) -- 0:00:44
312000 -- (-512.159) (-509.324) [-510.537] (-513.947) * (-517.977) (-511.144) (-508.729) [-510.418] -- 0:00:44
312500 -- (-511.367) (-508.631) (-510.447) [-509.065] * (-512.135) (-510.654) (-513.671) [-509.555] -- 0:00:44
313000 -- (-514.479) (-508.855) (-508.565) [-508.984] * (-510.035) (-512.126) [-509.387] (-510.114) -- 0:00:43
313500 -- (-514.300) (-510.358) [-511.350] (-508.988) * (-510.326) (-510.447) (-509.098) [-510.058] -- 0:00:43
314000 -- [-509.005] (-510.860) (-516.492) (-509.440) * (-513.248) (-512.327) (-508.965) [-511.269] -- 0:00:43
314500 -- (-511.488) (-511.998) (-509.235) [-510.206] * (-510.310) [-509.784] (-510.616) (-508.812) -- 0:00:43
315000 -- [-513.249] (-516.930) (-509.256) (-510.814) * (-509.161) [-509.376] (-511.229) (-511.719) -- 0:00:43
Average standard deviation of split frequencies: 0.014040
315500 -- (-511.588) (-511.589) [-510.537] (-510.488) * (-508.421) (-509.903) (-512.616) [-510.391] -- 0:00:43
316000 -- (-510.450) (-509.021) (-510.214) [-511.155] * (-509.072) [-509.893] (-508.569) (-509.679) -- 0:00:43
316500 -- [-511.043] (-512.316) (-508.922) (-509.424) * [-509.346] (-515.376) (-512.998) (-512.621) -- 0:00:43
317000 -- (-511.301) (-515.741) (-509.250) [-510.877] * [-510.872] (-512.317) (-509.636) (-510.826) -- 0:00:43
317500 -- [-509.657] (-509.382) (-510.777) (-509.534) * (-509.707) (-510.053) (-509.619) [-509.755] -- 0:00:42
318000 -- (-510.169) (-509.284) (-513.774) [-509.752] * (-510.070) [-510.143] (-509.512) (-514.931) -- 0:00:42
318500 -- [-509.553] (-509.467) (-511.038) (-509.430) * [-514.879] (-510.751) (-508.673) (-513.209) -- 0:00:42
319000 -- (-512.552) (-509.381) (-512.902) [-512.005] * (-509.234) (-511.843) [-509.025] (-511.380) -- 0:00:44
319500 -- (-509.296) (-508.536) (-513.352) [-512.026] * [-509.152] (-512.054) (-509.762) (-509.465) -- 0:00:44
320000 -- (-511.885) (-509.543) (-509.912) [-513.273] * (-510.299) [-509.316] (-510.007) (-513.057) -- 0:00:44
Average standard deviation of split frequencies: 0.013058
320500 -- [-511.396] (-511.645) (-510.648) (-511.317) * [-512.170] (-509.210) (-509.229) (-517.931) -- 0:00:44
321000 -- (-509.808) (-509.714) (-508.738) [-510.375] * (-508.736) (-510.204) [-510.431] (-512.813) -- 0:00:44
321500 -- [-509.862] (-510.839) (-510.245) (-509.270) * (-510.684) (-510.654) (-513.680) [-509.560] -- 0:00:44
322000 -- (-511.460) (-512.265) (-511.611) [-508.759] * [-510.172] (-511.182) (-510.087) (-508.762) -- 0:00:44
322500 -- (-513.613) [-509.818] (-513.044) (-511.522) * [-512.219] (-510.225) (-512.754) (-512.127) -- 0:00:44
323000 -- (-516.503) (-511.279) [-509.126] (-510.029) * (-513.151) (-511.008) [-514.072] (-509.477) -- 0:00:44
323500 -- (-516.277) (-511.598) [-510.936] (-509.041) * (-515.734) [-513.074] (-510.585) (-509.427) -- 0:00:43
324000 -- (-509.775) [-512.882] (-510.222) (-509.997) * (-509.138) (-511.378) [-508.927] (-509.975) -- 0:00:43
324500 -- [-508.911] (-509.493) (-511.166) (-509.020) * (-508.459) (-513.551) [-510.710] (-508.505) -- 0:00:43
325000 -- [-510.027] (-509.373) (-511.492) (-509.760) * [-510.115] (-513.231) (-511.170) (-510.570) -- 0:00:43
Average standard deviation of split frequencies: 0.013525
325500 -- (-510.687) (-509.522) (-511.838) [-509.708] * (-512.247) (-510.897) (-512.990) [-514.079] -- 0:00:43
326000 -- (-511.439) (-512.544) (-510.402) [-508.709] * (-510.030) (-510.726) (-512.362) [-510.031] -- 0:00:43
326500 -- (-509.458) (-509.251) [-510.144] (-509.797) * (-510.634) (-513.435) (-510.753) [-510.948] -- 0:00:43
327000 -- (-510.581) (-513.197) (-516.257) [-509.007] * (-509.626) [-512.621] (-513.215) (-510.745) -- 0:00:43
327500 -- (-509.927) (-509.584) [-510.436] (-510.097) * (-510.209) (-509.990) (-512.984) [-509.408] -- 0:00:43
328000 -- (-512.785) (-511.098) [-509.945] (-510.943) * [-511.341] (-510.406) (-511.545) (-508.882) -- 0:00:43
328500 -- (-519.684) (-513.182) [-508.697] (-510.224) * [-509.776] (-509.264) (-511.145) (-510.019) -- 0:00:42
329000 -- (-511.416) [-510.667] (-513.104) (-508.477) * (-510.227) [-510.296] (-509.927) (-511.796) -- 0:00:42
329500 -- (-510.422) (-510.452) [-510.880] (-512.534) * (-509.393) (-510.418) [-510.060] (-509.912) -- 0:00:42
330000 -- [-517.819] (-510.103) (-514.857) (-508.492) * (-509.144) (-511.322) (-510.892) [-509.967] -- 0:00:42
Average standard deviation of split frequencies: 0.012741
330500 -- [-509.374] (-510.239) (-511.185) (-509.096) * (-513.763) [-510.719] (-510.511) (-511.871) -- 0:00:42
331000 -- [-510.454] (-511.242) (-513.424) (-509.598) * [-510.473] (-510.471) (-513.434) (-510.017) -- 0:00:42
331500 -- (-509.444) (-512.288) [-509.313] (-510.980) * (-508.565) [-510.045] (-512.111) (-509.579) -- 0:00:42
332000 -- [-511.123] (-510.777) (-511.042) (-511.345) * (-512.003) (-511.062) (-509.103) [-509.195] -- 0:00:42
332500 -- [-510.908] (-513.342) (-508.890) (-509.866) * [-509.094] (-510.722) (-510.967) (-509.799) -- 0:00:42
333000 -- [-508.845] (-512.141) (-509.663) (-510.122) * [-510.243] (-512.064) (-510.117) (-510.721) -- 0:00:42
333500 -- [-512.324] (-510.496) (-511.415) (-509.205) * [-513.484] (-508.710) (-512.389) (-514.295) -- 0:00:41
334000 -- [-510.686] (-510.488) (-508.538) (-511.271) * (-510.634) [-510.028] (-512.542) (-513.590) -- 0:00:41
334500 -- [-508.267] (-513.273) (-511.701) (-512.784) * (-512.025) (-510.832) (-511.922) [-509.917] -- 0:00:41
335000 -- (-509.802) [-510.663] (-508.673) (-514.149) * (-510.213) (-512.297) [-509.953] (-512.133) -- 0:00:41
Average standard deviation of split frequencies: 0.013591
335500 -- (-513.969) [-514.740] (-509.228) (-508.767) * (-509.091) (-516.223) [-510.558] (-508.818) -- 0:00:43
336000 -- (-509.381) (-510.192) (-512.292) [-513.151] * [-509.764] (-510.706) (-512.862) (-510.100) -- 0:00:43
336500 -- (-509.651) (-510.284) (-511.222) [-509.803] * [-510.842] (-509.961) (-511.659) (-508.780) -- 0:00:43
337000 -- (-510.401) (-510.146) [-509.977] (-514.990) * (-509.744) [-509.524] (-512.950) (-512.554) -- 0:00:43
337500 -- (-509.037) (-511.672) [-511.248] (-509.444) * [-515.308] (-512.188) (-510.518) (-510.339) -- 0:00:43
338000 -- (-510.045) (-516.349) (-513.048) [-511.330] * (-511.273) (-512.890) [-508.814] (-509.324) -- 0:00:43
338500 -- (-512.738) [-509.564] (-510.303) (-508.763) * (-510.433) (-516.101) [-510.842] (-508.775) -- 0:00:42
339000 -- (-517.817) (-509.264) (-509.393) [-511.685] * [-508.613] (-511.190) (-511.366) (-510.657) -- 0:00:42
339500 -- (-512.713) (-509.543) (-516.852) [-512.318] * (-509.927) (-511.019) [-513.894] (-513.350) -- 0:00:42
340000 -- (-509.918) [-512.917] (-513.097) (-508.838) * (-509.129) (-508.720) [-515.117] (-512.180) -- 0:00:42
Average standard deviation of split frequencies: 0.013665
340500 -- [-510.372] (-511.325) (-509.765) (-509.350) * (-510.472) (-513.807) [-509.254] (-512.319) -- 0:00:42
341000 -- (-511.121) (-509.620) [-509.305] (-513.001) * (-511.557) [-509.894] (-508.636) (-510.592) -- 0:00:42
341500 -- (-511.443) (-512.079) (-510.207) [-509.779] * (-510.215) [-509.447] (-508.967) (-509.907) -- 0:00:42
342000 -- (-511.923) [-510.560] (-511.453) (-511.143) * [-508.650] (-512.206) (-509.648) (-509.033) -- 0:00:42
342500 -- (-511.872) (-510.447) [-508.561] (-509.270) * (-509.655) (-510.466) [-509.177] (-509.365) -- 0:00:42
343000 -- [-508.955] (-519.030) (-510.078) (-510.347) * [-510.022] (-511.334) (-513.279) (-508.273) -- 0:00:42
343500 -- [-509.925] (-511.927) (-509.676) (-509.364) * (-510.665) (-509.789) (-513.728) [-516.364] -- 0:00:42
344000 -- [-508.766] (-512.268) (-510.407) (-510.138) * (-509.409) [-510.683] (-510.724) (-508.465) -- 0:00:41
344500 -- [-510.154] (-510.573) (-509.335) (-510.899) * (-509.416) (-511.070) (-513.776) [-509.961] -- 0:00:41
345000 -- (-511.846) [-509.173] (-511.238) (-511.706) * (-510.882) (-509.252) (-511.326) [-511.168] -- 0:00:41
Average standard deviation of split frequencies: 0.013539
345500 -- (-510.459) [-508.991] (-509.636) (-510.470) * (-509.345) (-510.304) (-509.589) [-509.541] -- 0:00:41
346000 -- (-512.620) (-509.554) (-509.965) [-510.758] * (-514.283) [-509.014] (-513.617) (-510.643) -- 0:00:41
346500 -- (-510.793) (-509.050) [-510.131] (-510.203) * [-510.987] (-509.068) (-512.654) (-512.086) -- 0:00:41
347000 -- [-511.724] (-510.427) (-511.039) (-509.988) * (-509.718) [-511.676] (-509.785) (-514.081) -- 0:00:41
347500 -- (-510.921) (-512.047) [-516.361] (-514.733) * (-513.305) (-509.444) (-510.515) [-512.107] -- 0:00:41
348000 -- (-511.598) (-510.252) (-509.599) [-511.625] * (-512.212) (-510.931) [-510.107] (-509.475) -- 0:00:41
348500 -- (-512.842) (-509.858) [-511.498] (-513.762) * (-513.278) (-511.042) (-512.252) [-508.694] -- 0:00:41
349000 -- (-510.417) (-509.297) [-512.240] (-513.151) * (-512.650) (-510.212) [-512.368] (-514.477) -- 0:00:41
349500 -- (-509.287) (-509.444) (-509.983) [-511.101] * (-509.480) (-513.216) [-510.617] (-510.443) -- 0:00:40
350000 -- (-509.130) (-513.185) (-510.523) [-510.936] * [-509.904] (-511.922) (-510.324) (-510.051) -- 0:00:40
Average standard deviation of split frequencies: 0.012920
350500 -- (-510.159) (-513.031) (-508.251) [-510.930] * [-510.678] (-510.882) (-511.854) (-510.540) -- 0:00:40
351000 -- (-510.842) (-510.640) [-508.559] (-508.933) * [-511.087] (-514.848) (-510.441) (-511.835) -- 0:00:40
351500 -- [-510.584] (-511.013) (-510.525) (-511.130) * (-509.254) [-511.712] (-511.412) (-512.211) -- 0:00:40
352000 -- (-511.523) (-513.779) (-508.889) [-511.684] * [-509.974] (-511.322) (-510.021) (-510.121) -- 0:00:42
352500 -- [-509.791] (-515.501) (-512.676) (-515.678) * (-514.430) (-513.030) (-509.821) [-511.454] -- 0:00:42
353000 -- [-511.428] (-509.844) (-509.937) (-509.673) * (-513.981) (-510.643) (-512.544) [-509.245] -- 0:00:42
353500 -- (-510.359) (-511.194) [-512.305] (-509.484) * (-510.897) (-514.255) (-515.866) [-509.518] -- 0:00:42
354000 -- [-509.029] (-510.440) (-510.750) (-510.357) * [-509.252] (-510.711) (-514.715) (-511.510) -- 0:00:41
354500 -- (-513.472) [-509.962] (-511.470) (-513.270) * (-512.978) (-512.944) (-511.367) [-509.851] -- 0:00:41
355000 -- [-510.333] (-509.266) (-513.586) (-509.707) * (-510.149) (-509.469) [-517.554] (-510.116) -- 0:00:41
Average standard deviation of split frequencies: 0.013008
355500 -- [-510.548] (-511.472) (-509.182) (-510.236) * (-511.151) [-508.586] (-510.382) (-509.448) -- 0:00:41
356000 -- (-510.752) (-511.992) [-509.478] (-510.309) * (-511.842) [-509.289] (-516.194) (-510.267) -- 0:00:41
356500 -- (-516.310) [-511.990] (-514.037) (-510.371) * (-510.573) (-514.032) [-509.538] (-512.500) -- 0:00:41
357000 -- (-512.159) (-512.180) (-509.877) [-511.184] * (-509.757) [-510.111] (-509.096) (-513.679) -- 0:00:41
357500 -- (-509.930) [-514.914] (-508.937) (-508.964) * [-511.813] (-512.002) (-512.293) (-513.588) -- 0:00:41
358000 -- (-510.281) [-510.591] (-509.461) (-512.361) * (-511.289) (-510.379) [-509.309] (-510.610) -- 0:00:41
358500 -- [-510.467] (-511.067) (-509.761) (-509.525) * (-511.435) (-510.311) [-511.444] (-515.305) -- 0:00:41
359000 -- (-510.816) [-511.930] (-512.024) (-511.573) * (-511.939) (-511.282) [-510.822] (-513.942) -- 0:00:41
359500 -- (-512.175) (-511.979) [-510.034] (-512.033) * (-510.867) (-508.173) [-514.190] (-512.443) -- 0:00:40
360000 -- (-509.283) (-510.194) [-510.575] (-509.393) * (-510.426) (-512.424) [-511.132] (-512.189) -- 0:00:40
Average standard deviation of split frequencies: 0.013301
360500 -- (-512.561) [-509.987] (-509.360) (-508.786) * (-511.206) [-509.431] (-511.418) (-511.041) -- 0:00:40
361000 -- (-512.610) (-511.461) [-510.204] (-514.576) * (-509.653) (-511.477) [-511.659] (-509.224) -- 0:00:40
361500 -- (-509.716) (-513.793) [-512.822] (-510.909) * [-516.296] (-511.669) (-512.504) (-509.788) -- 0:00:40
362000 -- (-510.291) [-509.557] (-509.390) (-511.359) * (-513.702) [-510.119] (-514.240) (-508.668) -- 0:00:40
362500 -- (-515.769) [-512.140] (-511.114) (-510.999) * (-509.106) [-508.490] (-511.987) (-508.924) -- 0:00:40
363000 -- (-509.341) [-509.105] (-511.025) (-511.157) * [-511.653] (-509.643) (-509.756) (-509.984) -- 0:00:40
363500 -- (-508.550) (-511.817) (-515.266) [-511.302] * (-513.114) (-511.384) (-509.383) [-509.967] -- 0:00:40
364000 -- (-512.755) [-510.067] (-513.128) (-514.799) * (-513.132) (-511.172) (-511.692) [-508.570] -- 0:00:40
364500 -- (-510.901) [-512.408] (-510.481) (-511.805) * (-513.008) (-509.859) (-510.887) [-509.609] -- 0:00:40
365000 -- [-509.636] (-511.320) (-512.185) (-509.083) * (-509.118) (-508.593) [-509.166] (-513.736) -- 0:00:40
Average standard deviation of split frequencies: 0.013562
365500 -- (-508.668) (-511.010) (-511.440) [-509.888] * (-513.191) (-511.563) (-508.841) [-508.941] -- 0:00:39
366000 -- (-512.007) (-511.683) [-511.817] (-511.025) * (-511.043) (-516.285) [-512.880] (-508.342) -- 0:00:39
366500 -- [-508.186] (-513.695) (-510.853) (-512.681) * [-509.990] (-512.752) (-511.502) (-510.012) -- 0:00:39
367000 -- (-508.633) [-511.342] (-512.128) (-515.646) * (-511.294) [-511.205] (-511.535) (-509.265) -- 0:00:39
367500 -- (-509.850) [-510.470] (-509.383) (-512.392) * [-510.558] (-509.791) (-513.366) (-509.561) -- 0:00:39
368000 -- (-511.408) [-513.329] (-510.758) (-512.124) * (-514.928) (-511.068) [-509.690] (-509.375) -- 0:00:39
368500 -- (-511.534) [-508.966] (-512.824) (-511.046) * (-513.072) (-512.802) [-509.065] (-508.414) -- 0:00:39
369000 -- [-513.101] (-513.579) (-509.902) (-508.625) * [-511.091] (-510.196) (-509.471) (-509.924) -- 0:00:41
369500 -- (-509.380) (-513.939) (-509.829) [-508.895] * [-512.526] (-508.984) (-509.132) (-510.915) -- 0:00:40
370000 -- (-509.610) (-513.161) [-508.680] (-511.797) * (-510.843) (-511.357) [-508.637] (-511.584) -- 0:00:40
Average standard deviation of split frequencies: 0.014289
370500 -- [-508.344] (-512.615) (-514.629) (-516.902) * (-509.874) [-510.997] (-508.525) (-511.691) -- 0:00:40
371000 -- (-511.818) (-509.496) (-508.827) [-510.859] * [-515.264] (-511.226) (-508.550) (-511.007) -- 0:00:40
371500 -- (-510.044) [-509.555] (-509.647) (-510.446) * (-511.342) (-508.816) (-512.018) [-510.673] -- 0:00:40
372000 -- (-513.802) [-508.729] (-509.681) (-511.972) * [-509.572] (-511.989) (-509.049) (-514.935) -- 0:00:40
372500 -- [-511.580] (-512.333) (-510.336) (-509.679) * (-509.953) (-511.388) (-510.663) [-510.240] -- 0:00:40
373000 -- [-514.156] (-513.837) (-512.847) (-513.149) * (-512.701) (-511.255) (-510.524) [-513.948] -- 0:00:40
373500 -- (-508.951) [-508.791] (-510.790) (-512.249) * [-509.798] (-512.011) (-508.522) (-510.273) -- 0:00:40
374000 -- [-509.432] (-511.907) (-510.588) (-508.849) * [-510.119] (-510.845) (-508.988) (-509.170) -- 0:00:40
374500 -- [-509.887] (-510.101) (-512.378) (-509.678) * [-510.093] (-509.369) (-511.644) (-509.312) -- 0:00:40
375000 -- (-510.004) [-513.344] (-510.425) (-510.786) * (-510.122) (-511.207) [-513.268] (-509.190) -- 0:00:40
Average standard deviation of split frequencies: 0.014529
375500 -- (-511.523) (-512.326) (-509.918) [-513.045] * (-513.713) [-511.579] (-509.785) (-509.749) -- 0:00:39
376000 -- (-511.872) (-509.801) [-508.807] (-508.515) * [-514.543] (-509.655) (-509.767) (-511.031) -- 0:00:39
376500 -- (-512.283) (-509.827) [-510.524] (-510.108) * [-508.823] (-510.070) (-510.745) (-510.376) -- 0:00:39
377000 -- (-509.149) [-511.474] (-510.136) (-510.858) * [-510.274] (-510.441) (-512.434) (-510.827) -- 0:00:39
377500 -- [-509.375] (-510.295) (-510.541) (-510.820) * (-513.288) [-512.603] (-511.732) (-509.460) -- 0:00:39
378000 -- (-510.648) [-512.236] (-510.994) (-509.097) * (-512.717) [-509.942] (-510.623) (-511.377) -- 0:00:39
378500 -- (-509.684) (-510.788) (-512.467) [-510.064] * (-513.282) (-512.678) (-510.350) [-515.643] -- 0:00:39
379000 -- (-509.938) (-511.628) (-512.516) [-508.444] * (-512.932) (-511.028) (-509.340) [-509.256] -- 0:00:39
379500 -- (-509.859) (-514.152) [-509.571] (-511.068) * (-510.866) [-508.847] (-508.319) (-510.031) -- 0:00:39
380000 -- (-511.835) [-509.546] (-511.068) (-509.690) * [-509.779] (-511.348) (-514.438) (-510.022) -- 0:00:39
Average standard deviation of split frequencies: 0.014059
380500 -- (-511.393) (-510.464) (-511.063) [-509.598] * (-510.395) [-509.262] (-510.507) (-509.009) -- 0:00:39
381000 -- [-510.058] (-508.580) (-512.119) (-508.935) * (-510.743) (-509.809) (-511.422) [-508.946] -- 0:00:38
381500 -- [-510.514] (-510.275) (-510.727) (-510.195) * [-509.610] (-509.868) (-514.102) (-509.164) -- 0:00:38
382000 -- (-511.020) (-511.012) [-511.611] (-512.579) * (-512.693) (-508.571) (-511.222) [-508.796] -- 0:00:38
382500 -- (-511.522) (-509.688) (-512.035) [-508.494] * (-512.070) (-513.212) (-511.234) [-510.164] -- 0:00:38
383000 -- (-510.133) [-512.606] (-512.935) (-508.562) * (-511.142) (-517.320) [-508.243] (-508.310) -- 0:00:38
383500 -- (-511.724) (-510.407) (-513.621) [-509.205] * [-509.337] (-509.113) (-508.405) (-509.470) -- 0:00:38
384000 -- [-509.994] (-511.114) (-512.616) (-511.472) * (-510.085) [-509.696] (-511.355) (-512.439) -- 0:00:38
384500 -- (-511.146) (-512.566) [-509.357] (-508.902) * (-509.103) [-509.445] (-511.584) (-512.429) -- 0:00:38
385000 -- (-512.667) (-511.687) (-509.849) [-515.042] * [-513.710] (-510.634) (-512.305) (-512.567) -- 0:00:38
Average standard deviation of split frequencies: 0.016307
385500 -- [-509.630] (-512.137) (-508.650) (-515.357) * (-509.805) (-509.094) (-510.945) [-510.516] -- 0:00:38
386000 -- [-508.649] (-509.616) (-511.731) (-510.915) * (-508.453) [-508.999] (-511.273) (-515.521) -- 0:00:39
386500 -- (-512.791) (-510.670) [-509.259] (-511.801) * [-511.185] (-509.174) (-510.126) (-508.964) -- 0:00:39
387000 -- (-510.403) (-512.874) [-509.474] (-510.699) * (-509.192) [-509.455] (-509.740) (-517.500) -- 0:00:39
387500 -- (-509.275) (-512.503) (-510.444) [-510.943] * (-510.526) (-509.694) [-510.599] (-512.267) -- 0:00:39
388000 -- (-509.661) [-510.790] (-511.808) (-509.038) * (-510.714) [-509.215] (-510.681) (-509.205) -- 0:00:39
388500 -- (-509.582) [-509.110] (-512.452) (-511.000) * [-509.080] (-511.719) (-510.687) (-509.246) -- 0:00:39
389000 -- (-511.294) (-510.320) [-509.837] (-513.486) * (-508.766) (-510.309) [-511.234] (-509.353) -- 0:00:39
389500 -- (-513.530) (-512.394) (-512.259) [-510.332] * (-511.293) (-510.167) (-511.414) [-508.663] -- 0:00:39
390000 -- (-518.258) (-513.965) [-512.498] (-510.422) * (-510.160) (-510.303) [-508.715] (-510.546) -- 0:00:39
Average standard deviation of split frequencies: 0.016467
390500 -- (-509.637) [-509.299] (-510.142) (-508.954) * (-509.107) [-511.619] (-511.613) (-509.942) -- 0:00:39
391000 -- (-509.353) (-512.156) (-511.245) [-510.402] * (-514.390) (-511.653) (-510.192) [-511.252] -- 0:00:38
391500 -- (-509.304) (-509.519) (-510.439) [-516.702] * [-511.111] (-510.820) (-511.049) (-511.388) -- 0:00:38
392000 -- (-510.196) (-509.605) (-511.964) [-508.430] * (-514.761) [-509.791] (-510.000) (-509.630) -- 0:00:38
392500 -- (-509.041) (-512.701) [-512.848] (-509.054) * (-512.678) (-509.236) (-518.591) [-508.734] -- 0:00:38
393000 -- (-510.806) [-511.915] (-512.173) (-511.681) * [-513.439] (-512.053) (-515.665) (-511.769) -- 0:00:38
393500 -- (-511.035) [-510.037] (-510.692) (-509.245) * (-511.969) (-510.270) [-513.661] (-512.385) -- 0:00:38
394000 -- [-509.827] (-512.861) (-514.628) (-509.095) * [-508.923] (-510.334) (-509.178) (-515.823) -- 0:00:38
394500 -- (-513.341) (-509.579) (-513.726) [-508.741] * (-509.150) (-509.921) (-512.067) [-516.190] -- 0:00:38
395000 -- (-509.351) (-511.032) [-509.242] (-509.056) * (-509.141) (-509.980) (-510.518) [-509.441] -- 0:00:38
Average standard deviation of split frequencies: 0.016876
395500 -- [-509.386] (-512.035) (-510.625) (-512.295) * (-512.327) [-512.206] (-511.558) (-511.031) -- 0:00:38
396000 -- (-508.790) (-510.534) [-512.057] (-509.470) * (-509.572) (-512.343) (-509.140) [-509.800] -- 0:00:38
396500 -- [-510.319] (-513.474) (-512.465) (-513.525) * [-511.544] (-512.136) (-511.665) (-510.171) -- 0:00:38
397000 -- (-510.368) (-511.114) [-508.465] (-511.485) * (-510.236) [-513.157] (-516.629) (-512.882) -- 0:00:37
397500 -- (-513.789) [-509.911] (-509.249) (-509.967) * (-513.545) (-518.534) [-509.189] (-512.110) -- 0:00:37
398000 -- (-510.128) [-510.647] (-516.377) (-510.908) * (-511.048) (-513.905) (-513.934) [-508.803] -- 0:00:37
398500 -- (-509.458) [-509.758] (-509.702) (-509.529) * (-514.001) (-510.437) [-510.670] (-509.306) -- 0:00:37
399000 -- (-509.720) (-513.689) (-510.228) [-514.298] * (-512.717) (-512.943) [-514.456] (-513.819) -- 0:00:37
399500 -- (-509.789) (-509.922) [-509.480] (-510.576) * [-512.107] (-510.655) (-514.934) (-509.698) -- 0:00:37
400000 -- (-511.139) (-510.155) [-510.382] (-510.535) * (-512.250) (-511.463) [-509.225] (-509.980) -- 0:00:37
Average standard deviation of split frequencies: 0.016818
400500 -- (-511.005) (-513.774) (-511.537) [-509.974] * (-511.451) (-513.725) [-512.905] (-511.420) -- 0:00:37
401000 -- (-512.731) (-513.244) (-510.170) [-510.942] * (-510.980) (-509.825) (-512.770) [-509.992] -- 0:00:37
401500 -- (-510.070) (-509.769) [-511.811] (-517.562) * (-511.842) (-510.789) (-511.548) [-511.478] -- 0:00:37
402000 -- (-508.748) (-510.059) [-513.349] (-510.395) * (-512.485) (-509.462) [-509.876] (-515.196) -- 0:00:37
402500 -- (-509.553) (-510.053) [-510.980] (-509.972) * (-510.253) [-512.486] (-510.889) (-512.623) -- 0:00:38
403000 -- (-508.805) [-509.232] (-512.349) (-511.159) * (-509.281) (-511.492) [-509.341] (-511.712) -- 0:00:38
403500 -- (-510.083) [-509.270] (-510.440) (-508.789) * [-509.638] (-508.624) (-511.985) (-512.823) -- 0:00:38
404000 -- (-509.118) [-509.354] (-509.345) (-511.033) * (-511.156) (-509.689) [-509.776] (-511.257) -- 0:00:38
404500 -- (-508.602) [-510.834] (-509.452) (-511.222) * (-510.488) [-512.327] (-509.190) (-509.366) -- 0:00:38
405000 -- (-512.058) [-509.386] (-509.491) (-511.563) * [-511.094] (-509.718) (-508.686) (-510.501) -- 0:00:38
Average standard deviation of split frequencies: 0.016597
405500 -- (-509.396) [-509.234] (-510.502) (-510.981) * (-512.932) (-509.836) [-511.759] (-515.349) -- 0:00:38
406000 -- (-510.750) [-508.441] (-512.061) (-510.112) * (-511.980) (-509.365) [-513.009] (-510.157) -- 0:00:38
406500 -- (-511.705) (-511.659) (-511.857) [-510.889] * (-513.108) (-510.873) [-512.440] (-509.748) -- 0:00:37
407000 -- [-516.494] (-510.927) (-509.652) (-518.022) * (-509.322) (-509.788) [-509.205] (-511.166) -- 0:00:37
407500 -- (-513.652) (-509.518) [-510.786] (-515.643) * [-508.888] (-509.993) (-509.100) (-509.877) -- 0:00:37
408000 -- (-514.295) (-509.331) [-508.608] (-516.640) * (-511.189) [-510.559] (-511.759) (-509.067) -- 0:00:37
408500 -- (-510.175) (-511.038) (-509.682) [-509.330] * (-509.471) (-510.109) (-510.419) [-509.172] -- 0:00:37
409000 -- (-509.589) (-511.455) [-509.730] (-513.085) * (-511.509) (-508.977) [-509.881] (-509.320) -- 0:00:37
409500 -- (-511.557) (-509.111) [-509.358] (-511.111) * (-511.057) (-514.397) (-512.896) [-510.158] -- 0:00:37
410000 -- (-512.028) (-509.491) [-512.019] (-513.844) * (-510.625) [-508.425] (-511.540) (-510.072) -- 0:00:37
Average standard deviation of split frequencies: 0.016476
410500 -- [-509.817] (-511.291) (-512.434) (-511.529) * (-509.643) (-509.461) (-510.854) [-512.162] -- 0:00:37
411000 -- [-510.600] (-514.034) (-513.947) (-512.194) * (-509.357) (-512.157) (-509.438) [-509.040] -- 0:00:37
411500 -- (-509.298) [-508.728] (-515.655) (-516.093) * (-512.691) [-512.555] (-510.025) (-512.638) -- 0:00:37
412000 -- (-509.229) (-508.918) [-514.389] (-518.473) * [-511.719] (-508.435) (-510.254) (-509.591) -- 0:00:37
412500 -- (-510.954) (-511.367) (-510.460) [-513.800] * [-513.928] (-511.494) (-513.612) (-510.501) -- 0:00:37
413000 -- (-511.052) [-511.627] (-510.051) (-512.599) * (-510.981) (-510.543) (-510.142) [-513.125] -- 0:00:36
413500 -- [-509.136] (-510.040) (-509.966) (-508.940) * (-510.986) [-512.616] (-512.386) (-510.837) -- 0:00:36
414000 -- (-509.357) (-509.285) (-510.089) [-510.326] * (-509.850) (-510.044) [-510.668] (-509.440) -- 0:00:36
414500 -- (-513.731) (-509.793) [-508.530] (-511.112) * (-508.741) (-511.271) (-510.404) [-509.728] -- 0:00:36
415000 -- [-512.129] (-515.196) (-509.667) (-513.362) * (-509.100) [-509.683] (-509.062) (-510.850) -- 0:00:36
Average standard deviation of split frequencies: 0.015531
415500 -- (-517.169) (-510.712) [-511.962] (-512.821) * [-510.282] (-511.823) (-512.900) (-514.141) -- 0:00:36
416000 -- (-520.401) (-509.052) (-511.615) [-510.589] * (-513.263) [-512.355] (-510.634) (-511.575) -- 0:00:36
416500 -- (-517.215) (-509.035) [-509.002] (-511.290) * (-510.611) (-509.865) [-512.303] (-510.567) -- 0:00:36
417000 -- (-510.831) (-512.361) [-513.566] (-512.255) * [-510.314] (-512.903) (-509.652) (-513.081) -- 0:00:36
417500 -- (-509.934) [-510.423] (-508.757) (-513.319) * [-510.084] (-510.384) (-509.260) (-514.441) -- 0:00:36
418000 -- [-509.292] (-509.263) (-509.262) (-509.016) * (-512.268) (-509.053) [-510.381] (-510.711) -- 0:00:36
418500 -- (-508.879) (-513.303) [-509.358] (-509.994) * (-508.678) (-511.544) [-509.366] (-510.679) -- 0:00:36
419000 -- (-508.794) (-513.464) (-510.441) [-508.605] * [-511.502] (-509.232) (-508.399) (-509.581) -- 0:00:36
419500 -- (-509.720) (-509.733) (-509.436) [-510.098] * (-510.647) (-509.732) [-508.777] (-509.694) -- 0:00:37
420000 -- (-511.528) (-510.569) [-511.642] (-510.668) * [-510.627] (-510.307) (-513.063) (-509.182) -- 0:00:37
Average standard deviation of split frequencies: 0.015095
420500 -- (-511.781) (-512.970) (-512.832) [-512.190] * (-509.754) (-513.204) [-516.026] (-508.440) -- 0:00:37
421000 -- (-513.590) [-508.589] (-510.328) (-509.163) * (-509.574) (-510.953) [-509.597] (-509.057) -- 0:00:37
421500 -- (-510.577) (-509.793) [-510.410] (-510.257) * (-509.718) (-512.461) (-516.396) [-509.887] -- 0:00:37
422000 -- (-511.045) (-511.447) (-511.707) [-508.583] * (-515.130) (-512.191) (-518.637) [-510.353] -- 0:00:36
422500 -- [-510.373] (-511.647) (-511.479) (-510.056) * [-510.189] (-510.419) (-515.352) (-514.988) -- 0:00:36
423000 -- (-508.444) [-512.053] (-509.349) (-509.748) * (-509.922) (-508.522) (-513.132) [-511.267] -- 0:00:36
423500 -- (-511.240) [-510.990] (-509.764) (-512.256) * [-512.655] (-510.926) (-510.572) (-508.713) -- 0:00:36
424000 -- [-511.224] (-511.457) (-510.290) (-512.204) * (-511.921) (-510.561) (-510.522) [-509.520] -- 0:00:36
424500 -- (-513.930) (-515.751) (-511.223) [-510.220] * (-511.451) (-510.010) [-511.055] (-511.724) -- 0:00:36
425000 -- (-512.064) (-511.533) [-515.743] (-509.686) * [-512.124] (-509.352) (-512.480) (-510.757) -- 0:00:36
Average standard deviation of split frequencies: 0.015037
425500 -- (-509.643) (-510.905) [-515.987] (-508.643) * (-512.770) (-510.834) [-508.912] (-515.807) -- 0:00:36
426000 -- (-511.309) [-512.471] (-510.159) (-510.396) * (-511.001) (-510.886) [-509.657] (-509.568) -- 0:00:36
426500 -- (-510.115) (-509.611) (-512.237) [-512.659] * (-511.471) [-509.312] (-511.826) (-508.736) -- 0:00:36
427000 -- (-510.026) (-509.753) (-513.886) [-508.838] * (-510.513) (-512.031) [-512.176] (-508.699) -- 0:00:36
427500 -- (-513.252) (-509.790) (-509.555) [-508.981] * (-513.367) [-510.382] (-510.913) (-508.375) -- 0:00:36
428000 -- (-510.533) (-509.811) [-508.858] (-509.072) * (-511.511) (-510.841) (-509.388) [-508.359] -- 0:00:36
428500 -- (-509.140) (-512.037) [-509.647] (-509.148) * (-511.182) (-510.769) (-511.668) [-510.725] -- 0:00:36
429000 -- (-508.396) (-514.523) [-512.042] (-509.797) * (-509.766) [-510.230] (-515.396) (-510.889) -- 0:00:35
429500 -- (-509.761) (-515.373) [-513.708] (-511.341) * (-511.291) (-511.075) [-509.054] (-511.008) -- 0:00:35
430000 -- (-510.712) (-513.057) (-508.792) [-509.284] * [-513.403] (-510.872) (-509.796) (-511.460) -- 0:00:35
Average standard deviation of split frequencies: 0.014552
430500 -- (-510.132) (-510.225) (-511.383) [-511.017] * (-516.813) [-512.641] (-511.311) (-513.079) -- 0:00:35
431000 -- (-512.316) (-511.789) [-510.996] (-511.061) * (-513.995) (-510.264) [-510.159] (-509.451) -- 0:00:35
431500 -- (-513.076) [-511.724] (-510.653) (-512.385) * (-510.452) (-509.097) (-509.855) [-511.200] -- 0:00:35
432000 -- (-509.483) (-510.727) [-509.895] (-514.704) * (-509.383) (-510.802) [-513.874] (-512.646) -- 0:00:35
432500 -- (-511.845) (-510.547) [-513.695] (-511.183) * [-510.722] (-510.079) (-510.789) (-510.251) -- 0:00:35
433000 -- (-511.963) (-510.776) (-514.702) [-514.598] * (-509.369) [-509.648] (-512.275) (-510.415) -- 0:00:35
433500 -- (-512.122) [-511.016] (-508.343) (-510.205) * (-511.162) [-513.048] (-511.434) (-509.974) -- 0:00:35
434000 -- (-513.233) [-511.574] (-511.274) (-508.702) * (-509.766) (-508.579) [-510.036] (-510.424) -- 0:00:35
434500 -- (-512.402) [-511.697] (-509.928) (-509.649) * [-511.701] (-510.185) (-509.742) (-509.530) -- 0:00:35
435000 -- (-510.759) [-512.389] (-509.012) (-511.154) * [-509.127] (-509.635) (-514.627) (-508.789) -- 0:00:35
Average standard deviation of split frequencies: 0.014437
435500 -- (-509.220) (-508.623) [-509.575] (-511.967) * [-508.971] (-510.812) (-514.177) (-509.093) -- 0:00:34
436000 -- (-508.880) [-510.432] (-509.838) (-511.164) * (-512.360) (-512.702) [-510.728] (-511.585) -- 0:00:36
436500 -- (-509.214) (-509.931) [-509.092] (-509.818) * (-511.979) (-508.934) [-508.729] (-511.812) -- 0:00:36
437000 -- (-508.827) (-510.550) [-509.365] (-509.804) * (-509.804) [-512.698] (-511.322) (-509.344) -- 0:00:36
437500 -- (-510.555) [-509.600] (-512.070) (-508.654) * [-510.711] (-510.698) (-512.037) (-512.041) -- 0:00:36
438000 -- (-511.726) [-510.784] (-512.048) (-510.611) * [-511.373] (-515.994) (-514.121) (-510.619) -- 0:00:35
438500 -- (-510.833) [-514.734] (-508.908) (-514.043) * (-510.246) [-514.199] (-512.819) (-511.448) -- 0:00:35
439000 -- [-509.785] (-511.192) (-510.977) (-513.676) * [-513.832] (-508.988) (-512.121) (-508.479) -- 0:00:35
439500 -- (-513.232) (-510.141) [-510.990] (-514.657) * (-514.730) [-509.502] (-513.988) (-511.595) -- 0:00:35
440000 -- (-510.936) (-510.477) [-508.721] (-509.951) * (-510.721) [-510.644] (-512.933) (-508.562) -- 0:00:35
Average standard deviation of split frequencies: 0.014284
440500 -- [-512.103] (-511.433) (-510.705) (-510.967) * (-510.088) [-510.556] (-510.507) (-508.939) -- 0:00:35
441000 -- [-511.024] (-515.559) (-510.155) (-510.058) * [-511.797] (-512.548) (-512.858) (-512.311) -- 0:00:35
441500 -- [-511.324] (-509.097) (-511.412) (-509.182) * (-508.808) [-508.606] (-510.622) (-510.100) -- 0:00:35
442000 -- [-508.922] (-509.125) (-511.127) (-509.591) * (-511.997) (-510.337) [-510.969] (-511.217) -- 0:00:35
442500 -- (-509.595) (-512.526) (-511.684) [-510.415] * (-510.879) [-510.279] (-514.629) (-509.647) -- 0:00:35
443000 -- (-509.218) (-512.530) [-509.708] (-510.850) * (-510.482) (-510.432) [-509.040] (-509.454) -- 0:00:35
443500 -- (-514.782) [-512.081] (-509.165) (-515.605) * [-509.583] (-511.621) (-509.822) (-509.354) -- 0:00:35
444000 -- (-514.048) [-509.718] (-508.676) (-509.463) * (-510.551) [-509.112] (-514.821) (-510.142) -- 0:00:35
444500 -- [-513.831] (-510.324) (-509.334) (-511.321) * [-510.891] (-512.718) (-512.933) (-509.472) -- 0:00:34
445000 -- (-509.864) (-510.710) (-513.611) [-512.241] * (-510.471) (-512.758) (-510.591) [-509.448] -- 0:00:34
Average standard deviation of split frequencies: 0.013616
445500 -- (-510.318) [-509.940] (-511.074) (-509.906) * (-509.607) [-510.643] (-513.243) (-511.158) -- 0:00:34
446000 -- (-509.921) (-509.750) (-511.751) [-513.109] * (-510.458) (-510.782) (-510.907) [-510.868] -- 0:00:34
446500 -- (-511.345) (-509.958) (-510.029) [-509.755] * (-511.913) [-512.365] (-509.798) (-510.366) -- 0:00:34
447000 -- [-510.383] (-510.130) (-511.889) (-509.562) * (-510.610) (-512.961) [-511.920] (-511.280) -- 0:00:34
447500 -- [-510.784] (-509.466) (-511.438) (-510.816) * (-510.192) (-512.022) [-510.890] (-515.127) -- 0:00:34
448000 -- [-511.874] (-512.798) (-511.630) (-512.901) * (-510.354) [-510.698] (-515.480) (-512.961) -- 0:00:34
448500 -- (-513.140) (-513.464) [-512.572] (-511.657) * (-510.407) (-511.550) [-513.682] (-514.236) -- 0:00:34
449000 -- (-509.143) [-510.238] (-512.638) (-510.489) * [-512.727] (-517.120) (-511.605) (-510.105) -- 0:00:34
449500 -- [-508.654] (-510.877) (-511.238) (-509.534) * (-512.113) (-512.296) (-512.426) [-509.540] -- 0:00:34
450000 -- (-510.359) (-511.842) (-512.690) [-511.161] * (-509.312) (-510.160) (-509.493) [-509.009] -- 0:00:34
Average standard deviation of split frequencies: 0.013537
450500 -- [-510.481] (-515.978) (-514.276) (-513.330) * (-510.466) (-514.375) [-511.802] (-508.422) -- 0:00:34
451000 -- (-510.476) (-513.290) [-510.115] (-511.035) * [-511.769] (-509.298) (-510.464) (-508.522) -- 0:00:34
451500 -- [-508.823] (-510.440) (-513.302) (-509.764) * [-510.753] (-512.272) (-512.550) (-510.210) -- 0:00:34
452000 -- (-510.308) [-509.829] (-511.439) (-511.413) * [-508.895] (-509.904) (-517.498) (-514.376) -- 0:00:33
452500 -- (-509.316) [-511.163] (-512.810) (-511.219) * (-509.178) (-512.850) (-513.339) [-513.038] -- 0:00:35
453000 -- (-511.327) [-509.401] (-508.387) (-510.430) * (-511.246) [-510.209] (-512.469) (-512.740) -- 0:00:35
453500 -- (-511.378) (-511.037) (-508.600) [-510.348] * [-508.968] (-510.032) (-509.940) (-510.261) -- 0:00:34
454000 -- [-511.884] (-509.342) (-510.539) (-509.345) * (-509.669) [-509.742] (-515.507) (-511.146) -- 0:00:34
454500 -- (-513.510) (-510.173) (-510.581) [-509.935] * (-512.983) (-512.339) [-509.792] (-511.496) -- 0:00:34
455000 -- [-517.266] (-511.858) (-512.213) (-509.960) * (-509.503) [-512.189] (-509.917) (-516.585) -- 0:00:34
Average standard deviation of split frequencies: 0.014169
455500 -- (-514.876) (-510.000) (-509.933) [-511.266] * (-511.642) [-511.181] (-509.746) (-510.723) -- 0:00:34
456000 -- (-511.449) (-511.450) (-509.513) [-509.358] * (-510.934) [-508.576] (-509.650) (-511.886) -- 0:00:34
456500 -- [-509.137] (-509.864) (-509.669) (-510.532) * (-510.305) (-511.032) (-508.645) [-514.046] -- 0:00:34
457000 -- (-509.775) (-512.794) [-515.093] (-510.219) * (-513.794) (-510.154) [-511.927] (-517.778) -- 0:00:34
457500 -- [-508.465] (-510.500) (-511.626) (-512.650) * (-510.380) (-511.155) (-509.839) [-513.037] -- 0:00:34
458000 -- (-521.068) (-510.846) [-508.760] (-515.619) * (-510.653) (-512.357) (-510.171) [-508.663] -- 0:00:34
458500 -- (-509.432) (-510.936) (-509.845) [-516.187] * (-510.111) (-510.888) [-510.615] (-511.794) -- 0:00:34
459000 -- [-512.705] (-509.487) (-510.242) (-513.031) * [-509.546] (-510.223) (-510.894) (-511.540) -- 0:00:34
459500 -- (-509.491) (-509.963) [-508.973] (-515.075) * (-509.195) (-509.068) (-511.425) [-512.874] -- 0:00:34
460000 -- [-511.218] (-509.501) (-508.413) (-511.877) * (-508.844) [-510.886] (-510.712) (-512.570) -- 0:00:34
Average standard deviation of split frequencies: 0.014146
460500 -- (-512.081) [-508.959] (-508.786) (-510.530) * (-519.289) [-509.884] (-511.808) (-513.662) -- 0:00:33
461000 -- (-511.997) [-509.327] (-514.187) (-510.851) * (-510.622) (-510.765) (-512.276) [-508.947] -- 0:00:33
461500 -- (-512.989) [-508.923] (-518.428) (-511.951) * (-509.287) (-514.573) (-508.812) [-509.513] -- 0:00:33
462000 -- (-509.980) (-509.319) [-514.785] (-508.406) * (-509.538) (-510.402) [-508.789] (-510.854) -- 0:00:33
462500 -- (-509.332) (-518.750) (-509.192) [-508.676] * (-509.789) [-508.550] (-509.140) (-512.703) -- 0:00:33
463000 -- [-510.574] (-516.899) (-508.973) (-512.798) * (-508.860) (-510.950) (-509.160) [-510.666] -- 0:00:33
463500 -- (-510.185) (-512.201) (-509.213) [-512.697] * (-509.649) (-508.837) [-509.725] (-509.148) -- 0:00:33
464000 -- [-509.038] (-511.627) (-508.582) (-509.797) * (-510.224) (-508.956) (-511.193) [-511.994] -- 0:00:33
464500 -- [-509.480] (-513.053) (-512.387) (-512.334) * (-509.402) (-509.092) (-511.511) [-511.177] -- 0:00:33
465000 -- (-513.048) (-511.255) (-511.776) [-511.896] * (-508.599) [-509.708] (-509.562) (-511.676) -- 0:00:33
Average standard deviation of split frequencies: 0.014341
465500 -- [-513.057] (-512.194) (-511.088) (-511.830) * (-509.782) [-513.497] (-512.965) (-512.783) -- 0:00:33
466000 -- (-508.715) (-510.524) (-512.455) [-512.270] * (-514.436) (-509.809) [-510.726] (-513.634) -- 0:00:33
466500 -- (-508.857) (-512.319) (-512.364) [-511.749] * (-514.017) [-508.904] (-511.486) (-509.733) -- 0:00:33
467000 -- [-510.212] (-512.960) (-510.734) (-511.473) * (-508.827) (-508.987) [-510.503] (-513.266) -- 0:00:33
467500 -- (-510.984) [-511.850] (-510.063) (-508.772) * (-509.220) [-512.221] (-513.848) (-510.791) -- 0:00:33
468000 -- (-509.391) (-510.750) [-510.691] (-512.162) * (-509.099) [-511.991] (-510.598) (-511.433) -- 0:00:32
468500 -- (-509.509) (-510.385) [-511.049] (-511.753) * [-510.617] (-509.187) (-510.475) (-512.206) -- 0:00:32
469000 -- [-509.976] (-512.236) (-509.156) (-515.042) * [-511.028] (-509.885) (-512.313) (-509.094) -- 0:00:33
469500 -- (-509.214) (-509.962) (-512.009) [-508.566] * (-510.777) (-510.897) (-511.936) [-510.444] -- 0:00:33
470000 -- (-509.003) [-511.776] (-511.117) (-509.769) * (-510.232) [-509.352] (-511.129) (-509.331) -- 0:00:33
Average standard deviation of split frequencies: 0.013315
470500 -- (-511.389) [-509.574] (-510.649) (-511.360) * (-509.401) (-508.632) [-512.654] (-508.332) -- 0:00:33
471000 -- (-510.592) [-511.668] (-511.772) (-510.944) * (-510.316) (-514.575) [-509.241] (-508.909) -- 0:00:33
471500 -- (-510.151) (-511.288) [-508.813] (-510.819) * (-510.463) (-512.119) [-510.639] (-508.560) -- 0:00:33
472000 -- (-511.048) (-509.921) [-512.356] (-511.765) * [-512.023] (-508.866) (-509.512) (-509.901) -- 0:00:33
472500 -- (-510.378) (-510.479) (-509.247) [-509.863] * (-511.365) [-510.138] (-510.928) (-510.507) -- 0:00:33
473000 -- [-509.499] (-510.032) (-510.389) (-511.954) * [-510.092] (-510.409) (-510.455) (-509.298) -- 0:00:33
473500 -- [-510.952] (-513.396) (-511.492) (-510.208) * (-513.810) [-510.548] (-513.330) (-511.047) -- 0:00:33
474000 -- [-508.625] (-511.415) (-509.530) (-512.278) * [-510.649] (-509.760) (-517.315) (-508.756) -- 0:00:33
474500 -- [-509.276] (-513.197) (-509.697) (-512.865) * (-512.648) [-509.657] (-510.076) (-509.148) -- 0:00:33
475000 -- (-509.148) (-509.351) (-508.331) [-511.282] * (-510.807) (-512.298) [-509.969] (-511.434) -- 0:00:33
Average standard deviation of split frequencies: 0.013515
475500 -- (-509.268) (-509.687) [-508.922] (-510.848) * [-509.554] (-514.860) (-509.525) (-515.679) -- 0:00:33
476000 -- [-512.130] (-510.867) (-509.426) (-509.690) * [-513.185] (-509.633) (-514.617) (-513.781) -- 0:00:33
476500 -- (-510.828) [-511.687] (-511.721) (-509.207) * (-511.255) [-513.202] (-509.770) (-513.438) -- 0:00:32
477000 -- (-510.296) (-509.669) (-510.999) [-509.316] * (-514.606) (-518.066) [-510.533] (-509.979) -- 0:00:32
477500 -- [-511.300] (-510.918) (-511.063) (-510.280) * (-509.711) (-508.655) [-510.419] (-509.593) -- 0:00:32
478000 -- [-511.988] (-509.565) (-510.625) (-510.415) * (-510.025) [-511.768] (-509.656) (-510.783) -- 0:00:32
478500 -- (-512.053) [-508.718] (-511.615) (-511.557) * [-511.639] (-514.655) (-509.660) (-511.567) -- 0:00:32
479000 -- [-511.753] (-508.850) (-513.223) (-511.205) * [-510.300] (-512.136) (-511.388) (-509.286) -- 0:00:32
479500 -- (-510.865) (-509.769) [-509.686] (-510.296) * (-511.261) (-514.067) [-514.323] (-514.775) -- 0:00:32
480000 -- (-509.564) (-509.495) [-509.954] (-508.812) * (-511.479) [-509.683] (-509.456) (-509.773) -- 0:00:32
Average standard deviation of split frequencies: 0.013096
480500 -- (-509.287) (-511.139) [-510.647] (-509.419) * (-510.165) (-510.236) (-509.566) [-510.442] -- 0:00:32
481000 -- (-510.512) [-512.146] (-508.981) (-510.125) * [-511.788] (-511.699) (-508.720) (-509.564) -- 0:00:32
481500 -- (-511.127) [-512.036] (-514.512) (-510.066) * [-510.314] (-514.440) (-510.889) (-513.987) -- 0:00:32
482000 -- (-510.949) [-509.276] (-508.842) (-509.406) * (-512.768) (-510.006) (-510.070) [-509.575] -- 0:00:32
482500 -- (-513.062) (-513.567) [-511.656] (-509.609) * [-510.318] (-509.487) (-509.582) (-513.329) -- 0:00:32
483000 -- (-509.866) [-511.933] (-509.729) (-511.484) * [-509.730] (-510.429) (-512.123) (-513.221) -- 0:00:32
483500 -- (-514.011) (-513.355) (-510.217) [-510.049] * (-509.762) (-512.476) [-509.639] (-509.699) -- 0:00:32
484000 -- (-514.673) (-514.587) (-509.577) [-510.319] * (-509.231) (-508.847) (-510.061) [-512.271] -- 0:00:33
484500 -- (-514.088) [-509.751] (-515.327) (-509.938) * (-509.304) (-510.099) (-512.560) [-510.285] -- 0:00:32
485000 -- (-514.389) [-510.290] (-514.083) (-509.712) * (-512.448) (-510.277) [-510.284] (-511.007) -- 0:00:32
Average standard deviation of split frequencies: 0.012210
485500 -- (-509.773) [-510.823] (-509.630) (-509.360) * [-509.487] (-511.983) (-510.319) (-511.348) -- 0:00:32
486000 -- (-510.752) (-512.091) (-508.952) [-508.289] * [-509.329] (-511.097) (-509.826) (-509.888) -- 0:00:32
486500 -- [-510.239] (-512.145) (-509.088) (-508.312) * (-510.356) (-511.438) [-510.123] (-508.646) -- 0:00:32
487000 -- (-512.080) (-517.918) [-510.756] (-514.102) * [-512.309] (-510.313) (-513.031) (-515.327) -- 0:00:32
487500 -- (-513.029) (-513.574) [-510.066] (-511.221) * (-511.169) [-510.836] (-511.913) (-512.932) -- 0:00:32
488000 -- [-512.302] (-511.514) (-510.014) (-512.884) * (-509.281) [-509.068] (-509.648) (-508.884) -- 0:00:32
488500 -- (-511.687) (-510.433) (-510.152) [-511.523] * [-508.855] (-513.656) (-514.052) (-509.491) -- 0:00:32
489000 -- [-509.879] (-509.600) (-510.494) (-509.385) * [-508.710] (-511.754) (-511.355) (-509.560) -- 0:00:32
489500 -- (-509.784) [-509.958] (-510.150) (-512.183) * (-509.400) [-517.014] (-510.932) (-511.694) -- 0:00:32
490000 -- (-508.933) [-509.957] (-510.740) (-510.392) * [-512.086] (-508.739) (-509.487) (-510.346) -- 0:00:32
Average standard deviation of split frequencies: 0.011649
490500 -- (-510.317) [-509.069] (-512.247) (-508.865) * (-513.276) [-509.551] (-510.678) (-512.665) -- 0:00:32
491000 -- [-515.415] (-512.376) (-511.651) (-510.005) * (-511.152) [-510.172] (-512.590) (-510.798) -- 0:00:32
491500 -- (-513.021) (-513.367) (-512.275) [-509.094] * [-511.036] (-512.551) (-510.074) (-511.480) -- 0:00:32
492000 -- (-509.725) (-509.888) [-511.123] (-515.336) * (-511.324) (-508.818) (-511.007) [-515.885] -- 0:00:32
492500 -- (-509.335) (-510.981) [-510.279] (-515.607) * (-510.119) (-509.413) (-509.547) [-509.137] -- 0:00:31
493000 -- (-513.185) (-508.278) [-509.355] (-520.398) * [-509.059] (-510.413) (-510.197) (-509.990) -- 0:00:31
493500 -- [-509.971] (-510.143) (-512.558) (-509.569) * (-509.750) [-509.191] (-511.337) (-510.509) -- 0:00:31
494000 -- [-516.550] (-508.847) (-513.754) (-510.365) * (-512.895) (-511.722) (-508.296) [-508.687] -- 0:00:31
494500 -- (-509.469) (-508.822) [-510.285] (-510.965) * (-511.975) (-510.474) [-508.927] (-509.142) -- 0:00:31
495000 -- (-512.503) (-512.555) [-509.021] (-510.047) * (-512.071) (-509.339) [-511.441] (-510.141) -- 0:00:31
Average standard deviation of split frequencies: 0.011821
495500 -- (-510.932) (-513.518) (-509.240) [-510.653] * (-511.829) (-511.545) [-514.998] (-510.390) -- 0:00:31
496000 -- [-510.761] (-509.566) (-511.432) (-509.520) * [-511.417] (-517.918) (-512.222) (-511.941) -- 0:00:31
496500 -- (-516.018) [-513.026] (-509.605) (-509.223) * (-510.144) (-512.519) (-510.735) [-510.501] -- 0:00:31
497000 -- (-511.661) (-509.775) [-509.727] (-510.181) * (-514.498) (-512.314) [-509.403] (-513.818) -- 0:00:31
497500 -- (-510.918) (-511.355) [-509.752] (-511.527) * (-511.936) [-510.006] (-511.629) (-511.334) -- 0:00:31
498000 -- (-510.061) [-508.698] (-510.126) (-509.841) * (-514.154) (-510.303) (-509.919) [-510.665] -- 0:00:31
498500 -- [-508.825] (-509.156) (-511.384) (-512.903) * (-512.023) [-508.854] (-512.748) (-510.044) -- 0:00:32
499000 -- (-509.502) (-509.967) (-510.269) [-509.980] * (-510.247) (-509.924) (-509.034) [-512.564] -- 0:00:32
499500 -- (-510.441) [-510.948] (-509.572) (-514.939) * (-510.327) (-513.278) (-511.333) [-515.598] -- 0:00:32
500000 -- [-508.765] (-511.452) (-515.307) (-512.707) * (-511.339) (-511.702) [-511.617] (-511.247) -- 0:00:32
Average standard deviation of split frequencies: 0.011416
500500 -- (-509.400) (-515.838) [-509.835] (-508.341) * [-512.582] (-510.109) (-510.719) (-511.130) -- 0:00:31
501000 -- [-508.851] (-516.262) (-518.333) (-509.412) * (-512.334) [-512.676] (-510.796) (-509.985) -- 0:00:31
501500 -- (-512.052) (-516.960) [-511.139] (-510.824) * (-509.397) (-512.056) (-512.213) [-510.640] -- 0:00:31
502000 -- [-508.957] (-518.510) (-512.567) (-510.061) * (-509.350) [-513.083] (-511.847) (-509.864) -- 0:00:31
502500 -- (-509.903) (-508.391) (-510.976) [-510.015] * (-510.733) (-509.220) [-509.835] (-511.246) -- 0:00:31
503000 -- (-511.352) (-514.522) [-508.750] (-509.333) * (-513.394) (-508.849) [-511.764] (-509.460) -- 0:00:31
503500 -- [-509.932] (-512.168) (-513.832) (-511.599) * (-509.239) (-512.832) [-515.072] (-510.583) -- 0:00:31
504000 -- (-510.188) [-510.127] (-510.420) (-511.887) * (-510.720) (-510.750) (-512.142) [-510.130] -- 0:00:31
504500 -- [-511.146] (-509.318) (-510.079) (-508.916) * (-511.904) (-515.101) (-511.323) [-511.288] -- 0:00:31
505000 -- [-510.616] (-511.211) (-512.498) (-509.563) * [-510.432] (-510.988) (-510.835) (-512.711) -- 0:00:31
Average standard deviation of split frequencies: 0.011820
505500 -- (-513.983) [-510.910] (-509.291) (-509.138) * (-512.718) (-511.854) [-509.111] (-511.349) -- 0:00:31
506000 -- (-511.061) (-513.074) (-510.190) [-509.830] * (-515.498) [-515.580] (-510.221) (-509.810) -- 0:00:31
506500 -- (-509.367) (-511.901) (-508.954) [-511.302] * (-512.786) [-508.742] (-513.740) (-510.416) -- 0:00:31
507000 -- (-513.259) [-509.715] (-509.039) (-510.230) * (-510.469) (-510.149) (-510.645) [-510.734] -- 0:00:31
507500 -- (-511.480) (-509.033) [-511.779] (-509.551) * (-511.897) [-509.087] (-512.864) (-513.999) -- 0:00:31
508000 -- (-511.668) (-511.815) [-510.748] (-510.506) * (-518.626) [-510.564] (-511.294) (-511.315) -- 0:00:30
508500 -- (-516.197) (-513.511) [-509.379] (-510.978) * [-509.476] (-512.522) (-511.872) (-513.112) -- 0:00:30
509000 -- (-510.973) (-511.594) (-509.790) [-514.388] * (-509.522) (-513.756) (-509.271) [-509.527] -- 0:00:30
509500 -- (-513.342) (-510.820) [-509.693] (-510.623) * (-511.188) [-509.747] (-511.746) (-510.962) -- 0:00:30
510000 -- (-511.827) [-509.341] (-509.473) (-512.450) * (-511.623) (-513.200) (-510.480) [-511.373] -- 0:00:30
Average standard deviation of split frequencies: 0.012462
510500 -- (-511.542) (-511.404) [-512.081] (-510.327) * (-511.398) [-510.801] (-512.296) (-509.571) -- 0:00:30
511000 -- (-511.270) (-511.082) (-509.186) [-511.747] * (-511.454) (-510.623) [-509.113] (-509.367) -- 0:00:30
511500 -- (-511.208) [-513.280] (-510.218) (-511.778) * [-511.425] (-513.429) (-508.734) (-512.429) -- 0:00:30
512000 -- [-512.823] (-512.890) (-511.148) (-511.300) * (-512.599) (-509.337) [-510.575] (-511.799) -- 0:00:30
512500 -- (-510.222) [-509.325] (-510.870) (-510.855) * [-509.090] (-510.002) (-510.136) (-510.029) -- 0:00:30
513000 -- [-511.628] (-510.421) (-510.352) (-510.513) * (-509.565) [-511.509] (-510.959) (-514.211) -- 0:00:31
513500 -- (-510.342) (-509.093) (-510.396) [-517.608] * (-510.655) [-509.270] (-511.498) (-509.074) -- 0:00:31
514000 -- [-509.705] (-508.671) (-512.955) (-510.516) * (-508.911) (-510.254) (-510.134) [-508.550] -- 0:00:31
514500 -- (-513.069) (-515.017) (-511.456) [-509.064] * (-509.392) (-510.137) (-510.286) [-509.351] -- 0:00:31
515000 -- (-509.187) (-513.955) (-514.823) [-510.240] * (-514.477) (-514.932) [-509.985] (-509.351) -- 0:00:31
Average standard deviation of split frequencies: 0.013059
515500 -- (-510.522) (-511.648) (-512.653) [-509.802] * (-509.095) (-511.640) [-509.237] (-508.615) -- 0:00:31
516000 -- (-510.767) (-512.782) [-512.704] (-511.069) * (-514.322) (-510.097) (-509.085) [-510.680] -- 0:00:30
516500 -- (-510.398) [-511.719] (-509.558) (-509.827) * [-513.736] (-511.795) (-511.822) (-508.998) -- 0:00:30
517000 -- [-509.950] (-508.990) (-510.031) (-511.305) * [-508.145] (-512.700) (-511.956) (-512.880) -- 0:00:30
517500 -- [-510.540] (-511.505) (-509.649) (-517.347) * (-510.297) (-508.869) (-511.982) [-511.692] -- 0:00:30
518000 -- (-510.308) (-509.509) (-513.512) [-509.142] * (-510.265) (-509.674) [-508.470] (-509.088) -- 0:00:30
518500 -- (-510.475) (-509.731) (-514.318) [-509.698] * (-511.300) [-508.846] (-512.332) (-509.464) -- 0:00:30
519000 -- (-508.871) [-514.028] (-513.609) (-510.372) * (-509.949) [-509.196] (-515.409) (-510.587) -- 0:00:30
519500 -- (-511.446) (-510.702) [-509.231] (-508.824) * (-508.802) (-511.150) (-509.850) [-509.606] -- 0:00:30
520000 -- (-509.739) [-511.997] (-512.410) (-511.427) * (-511.140) [-512.100] (-514.015) (-511.453) -- 0:00:30
Average standard deviation of split frequencies: 0.012942
520500 -- [-508.761] (-509.479) (-508.919) (-510.377) * (-510.418) (-509.616) (-511.121) [-514.244] -- 0:00:30
521000 -- (-511.848) (-511.175) [-508.720] (-510.237) * (-511.183) (-509.517) (-509.711) [-511.576] -- 0:00:30
521500 -- (-511.665) (-511.519) (-512.146) [-510.189] * [-511.355] (-511.273) (-509.550) (-511.553) -- 0:00:30
522000 -- (-509.059) [-509.394] (-515.862) (-508.858) * (-512.779) (-510.454) (-508.373) [-509.837] -- 0:00:30
522500 -- (-509.124) (-509.182) (-512.314) [-509.616] * (-510.664) (-514.788) [-509.188] (-509.793) -- 0:00:30
523000 -- (-509.140) [-509.828] (-510.210) (-510.008) * (-516.168) [-510.810] (-511.173) (-509.599) -- 0:00:30
523500 -- [-509.026] (-509.609) (-510.607) (-509.561) * [-509.834] (-510.332) (-510.667) (-508.774) -- 0:00:30
524000 -- [-512.297] (-512.573) (-509.677) (-511.872) * (-509.934) [-512.047] (-512.193) (-514.893) -- 0:00:29
524500 -- (-509.489) (-512.573) (-511.118) [-511.193] * (-510.228) (-510.901) (-510.933) [-511.107] -- 0:00:29
525000 -- (-511.331) [-509.778] (-510.658) (-511.655) * [-511.687] (-515.541) (-511.754) (-509.168) -- 0:00:29
Average standard deviation of split frequencies: 0.012389
525500 -- (-510.226) (-509.228) (-510.364) [-509.520] * [-509.891] (-514.309) (-511.373) (-511.581) -- 0:00:29
526000 -- (-509.779) (-512.440) [-508.843] (-511.673) * [-510.061] (-512.354) (-510.906) (-512.599) -- 0:00:29
526500 -- (-511.675) (-514.369) [-509.372] (-510.116) * [-512.450] (-512.910) (-514.573) (-509.262) -- 0:00:29
527000 -- (-512.195) (-508.453) [-509.366] (-510.848) * [-509.725] (-509.666) (-509.822) (-510.611) -- 0:00:30
527500 -- (-510.948) (-508.472) [-511.734] (-509.500) * (-509.055) (-510.424) [-510.034] (-512.033) -- 0:00:30
528000 -- (-509.999) [-510.856] (-510.092) (-510.665) * (-510.308) [-509.775] (-510.276) (-512.115) -- 0:00:30
528500 -- (-511.593) (-513.397) (-510.278) [-510.625] * [-511.871] (-509.098) (-510.122) (-515.029) -- 0:00:30
529000 -- [-510.511] (-508.919) (-509.278) (-512.126) * (-511.751) [-510.586] (-511.541) (-512.200) -- 0:00:30
529500 -- (-510.301) (-510.340) (-510.974) [-511.799] * (-511.175) (-510.553) (-510.212) [-510.621] -- 0:00:30
530000 -- [-509.567] (-513.950) (-511.607) (-508.818) * (-522.420) [-510.450] (-510.468) (-513.976) -- 0:00:30
Average standard deviation of split frequencies: 0.012959
530500 -- (-509.335) (-513.303) (-510.986) [-509.497] * (-508.961) (-512.300) (-511.639) [-508.292] -- 0:00:30
531000 -- (-513.104) (-513.102) (-511.021) [-508.894] * [-510.971] (-513.599) (-511.288) (-515.907) -- 0:00:30
531500 -- [-509.749] (-513.703) (-510.427) (-511.336) * (-510.649) (-509.182) [-510.641] (-510.805) -- 0:00:29
532000 -- (-509.601) (-513.893) (-510.667) [-510.067] * (-509.027) (-512.854) (-512.341) [-510.140] -- 0:00:29
532500 -- [-509.856] (-513.285) (-511.451) (-509.454) * [-512.181] (-508.461) (-509.945) (-509.849) -- 0:00:29
533000 -- (-508.737) (-514.638) [-510.426] (-513.309) * (-511.827) (-510.656) [-512.591] (-509.448) -- 0:00:29
533500 -- (-509.854) [-509.149] (-511.031) (-509.566) * (-511.810) (-509.526) [-509.999] (-510.505) -- 0:00:29
534000 -- (-509.849) [-508.936] (-509.336) (-513.373) * [-508.870] (-516.213) (-511.940) (-509.888) -- 0:00:29
534500 -- (-511.498) (-511.688) (-509.052) [-513.486] * [-509.841] (-513.803) (-512.909) (-510.608) -- 0:00:29
535000 -- (-512.849) (-513.725) (-510.157) [-510.110] * (-510.487) (-516.600) [-513.250] (-515.531) -- 0:00:29
Average standard deviation of split frequencies: 0.013037
535500 -- (-508.723) (-511.276) [-512.172] (-510.322) * (-512.518) (-513.519) (-512.033) [-509.248] -- 0:00:29
536000 -- [-511.053] (-514.485) (-510.274) (-511.112) * [-513.279] (-511.341) (-513.552) (-510.874) -- 0:00:29
536500 -- (-516.172) [-511.243] (-510.249) (-510.489) * (-509.361) (-510.734) (-512.851) [-509.278] -- 0:00:29
537000 -- (-514.430) (-510.417) (-510.301) [-509.663] * (-509.735) (-517.518) [-510.905] (-510.069) -- 0:00:29
537500 -- (-509.466) (-510.889) (-510.036) [-509.396] * (-511.259) (-510.174) [-509.483] (-510.274) -- 0:00:29
538000 -- [-510.578] (-508.512) (-512.006) (-509.900) * (-510.418) (-509.899) [-512.136] (-509.352) -- 0:00:29
538500 -- (-510.594) (-508.688) (-513.812) [-508.195] * (-510.939) [-512.252] (-511.266) (-508.723) -- 0:00:29
539000 -- (-509.309) [-511.686] (-513.426) (-518.468) * (-511.863) [-509.463] (-510.540) (-511.231) -- 0:00:29
539500 -- [-511.059] (-511.222) (-509.185) (-511.800) * [-514.174] (-511.703) (-510.809) (-514.386) -- 0:00:29
540000 -- (-510.795) (-510.197) [-508.988] (-509.785) * (-513.844) (-509.916) (-512.912) [-512.006] -- 0:00:28
Average standard deviation of split frequencies: 0.012360
540500 -- [-510.120] (-511.134) (-509.395) (-511.051) * (-512.519) [-510.115] (-515.671) (-509.518) -- 0:00:28
541000 -- (-511.192) (-511.679) (-508.964) [-509.961] * (-512.001) [-511.352] (-513.115) (-508.904) -- 0:00:29
541500 -- (-510.951) (-509.880) [-513.180] (-511.003) * [-511.070] (-511.340) (-509.021) (-509.401) -- 0:00:29
542000 -- (-510.270) (-509.422) (-512.632) [-510.697] * (-511.505) [-510.384] (-509.470) (-510.830) -- 0:00:29
542500 -- [-511.544] (-509.463) (-515.607) (-508.802) * (-509.161) [-510.601] (-513.362) (-512.194) -- 0:00:29
543000 -- [-508.415] (-509.499) (-513.213) (-508.943) * (-515.604) [-511.219] (-509.923) (-513.055) -- 0:00:29
543500 -- (-514.492) (-512.682) [-514.527] (-509.160) * (-509.868) [-509.382] (-508.507) (-509.356) -- 0:00:29
544000 -- (-508.926) [-509.789] (-510.314) (-509.708) * (-509.737) [-513.697] (-508.256) (-508.729) -- 0:00:29
544500 -- (-511.960) (-509.079) (-509.498) [-509.095] * (-509.437) (-509.766) (-511.981) [-509.515] -- 0:00:29
545000 -- (-510.195) (-509.203) [-510.234] (-511.902) * [-511.222] (-509.596) (-510.344) (-508.751) -- 0:00:29
Average standard deviation of split frequencies: 0.012595
545500 -- [-509.165] (-512.436) (-510.602) (-508.800) * [-511.071] (-511.093) (-512.304) (-508.663) -- 0:00:29
546000 -- (-511.329) [-508.893] (-509.991) (-509.238) * (-513.826) [-511.909] (-508.816) (-509.720) -- 0:00:29
546500 -- (-508.634) [-511.893] (-509.392) (-513.121) * (-509.914) (-511.139) (-508.691) [-510.814] -- 0:00:29
547000 -- (-511.532) [-509.906] (-513.474) (-514.128) * (-511.769) (-513.297) (-511.267) [-511.551] -- 0:00:28
547500 -- (-515.404) (-510.895) (-509.638) [-509.866] * (-511.610) [-510.063] (-511.222) (-510.559) -- 0:00:28
548000 -- (-510.846) (-512.336) [-508.794] (-513.330) * (-510.452) [-508.679] (-511.161) (-514.148) -- 0:00:28
548500 -- (-510.329) [-511.932] (-509.071) (-510.139) * [-511.837] (-508.645) (-509.808) (-514.309) -- 0:00:28
549000 -- [-513.088] (-510.398) (-509.517) (-509.241) * (-512.213) (-509.816) [-511.886] (-512.714) -- 0:00:28
549500 -- (-511.970) (-516.634) [-509.440] (-510.866) * (-509.442) (-511.139) (-514.775) [-509.769] -- 0:00:28
550000 -- (-514.641) [-512.798] (-510.021) (-515.965) * (-510.381) (-508.715) (-508.789) [-509.553] -- 0:00:28
Average standard deviation of split frequencies: 0.011935
550500 -- [-509.661] (-514.936) (-509.527) (-510.419) * [-509.227] (-511.233) (-509.249) (-510.499) -- 0:00:28
551000 -- (-510.281) (-513.662) (-509.158) [-510.504] * (-512.888) (-513.883) (-509.893) [-509.010] -- 0:00:28
551500 -- (-513.516) (-510.943) [-516.619] (-513.894) * (-510.360) [-510.829] (-510.621) (-510.178) -- 0:00:28
552000 -- (-517.728) (-509.691) [-511.868] (-511.165) * [-510.546] (-510.011) (-510.256) (-512.987) -- 0:00:28
552500 -- (-510.983) [-510.081] (-508.594) (-510.413) * (-509.210) (-509.939) [-509.565] (-509.285) -- 0:00:28
553000 -- (-510.600) (-510.112) [-509.795] (-511.495) * (-510.518) [-510.085] (-510.274) (-510.546) -- 0:00:28
553500 -- (-511.911) (-511.158) [-510.263] (-510.413) * (-519.872) (-508.911) [-510.986] (-513.774) -- 0:00:28
554000 -- (-512.895) [-513.018] (-514.836) (-511.719) * [-511.648] (-511.484) (-511.962) (-514.253) -- 0:00:28
554500 -- (-511.215) (-511.866) (-510.919) [-510.102] * (-508.660) (-508.676) (-510.483) [-510.381] -- 0:00:28
555000 -- (-514.659) (-511.581) [-509.553] (-510.533) * [-511.678] (-509.915) (-511.441) (-509.659) -- 0:00:28
Average standard deviation of split frequencies: 0.012119
555500 -- (-511.944) (-509.975) (-510.863) [-510.481] * (-509.583) (-509.990) (-509.280) [-508.875] -- 0:00:28
556000 -- [-511.893] (-510.597) (-510.607) (-512.705) * (-509.365) (-515.241) (-511.798) [-509.929] -- 0:00:28
556500 -- (-508.706) [-509.235] (-510.728) (-508.847) * (-516.006) (-510.764) (-512.453) [-509.634] -- 0:00:28
557000 -- (-513.690) (-510.712) (-510.293) [-509.049] * (-510.281) (-515.040) (-511.655) [-510.228] -- 0:00:28
557500 -- (-513.273) [-512.383] (-509.388) (-508.937) * (-512.629) (-511.749) (-512.956) [-515.162] -- 0:00:28
558000 -- (-511.638) [-510.225] (-509.008) (-509.924) * [-509.542] (-512.845) (-511.066) (-514.179) -- 0:00:28
558500 -- [-508.690] (-511.624) (-510.248) (-509.949) * [-510.572] (-509.232) (-511.710) (-510.414) -- 0:00:28
559000 -- (-511.297) (-510.959) (-510.730) [-511.077] * [-509.178] (-512.870) (-512.642) (-511.539) -- 0:00:28
559500 -- (-509.421) (-515.303) [-514.554] (-512.514) * (-517.230) (-512.385) (-509.777) [-509.013] -- 0:00:28
560000 -- [-509.489] (-508.889) (-509.043) (-509.576) * [-511.352] (-509.463) (-510.220) (-509.225) -- 0:00:28
Average standard deviation of split frequencies: 0.012909
560500 -- (-510.157) (-509.254) [-509.129] (-511.054) * [-510.027] (-510.377) (-510.966) (-513.771) -- 0:00:28
561000 -- (-510.737) [-511.557] (-508.698) (-509.996) * (-508.964) [-509.834] (-509.057) (-512.291) -- 0:00:28
561500 -- (-510.745) (-510.144) [-509.100] (-512.943) * (-510.676) (-514.083) [-509.168] (-509.364) -- 0:00:28
562000 -- (-509.152) (-509.975) (-510.023) [-508.379] * (-514.777) (-509.678) (-514.331) [-508.784] -- 0:00:28
562500 -- (-510.348) (-509.358) (-511.526) [-511.555] * [-511.371] (-509.122) (-508.624) (-509.810) -- 0:00:28
563000 -- (-514.236) [-508.932] (-510.277) (-509.511) * (-511.642) [-509.357] (-508.709) (-509.444) -- 0:00:27
563500 -- (-512.160) (-509.607) [-509.954] (-510.890) * [-509.863] (-511.916) (-511.572) (-514.548) -- 0:00:27
564000 -- [-509.679] (-511.069) (-510.507) (-510.128) * (-509.742) (-509.834) (-513.917) [-510.250] -- 0:00:27
564500 -- (-513.508) (-511.866) (-510.619) [-508.760] * (-508.638) (-510.233) [-512.231] (-510.412) -- 0:00:27
565000 -- (-511.106) (-510.152) [-511.969] (-509.594) * [-508.346] (-511.050) (-511.819) (-510.043) -- 0:00:27
Average standard deviation of split frequencies: 0.012591
565500 -- [-510.266] (-512.915) (-510.994) (-510.162) * (-510.103) [-512.426] (-514.529) (-509.918) -- 0:00:27
566000 -- (-510.328) [-510.873] (-511.560) (-511.596) * [-510.674] (-509.145) (-517.188) (-510.588) -- 0:00:27
566500 -- (-515.598) [-510.606] (-512.152) (-514.856) * (-508.848) (-515.799) [-510.017] (-511.159) -- 0:00:27
567000 -- (-513.047) [-514.167] (-511.057) (-510.615) * [-512.393] (-515.841) (-512.408) (-510.977) -- 0:00:27
567500 -- (-517.569) (-514.814) (-508.497) [-512.633] * (-510.183) (-510.633) (-510.306) [-510.485] -- 0:00:27
568000 -- (-511.716) [-509.131] (-513.167) (-510.649) * (-512.869) [-516.696] (-509.785) (-511.435) -- 0:00:27
568500 -- (-513.935) [-515.171] (-512.267) (-510.949) * (-509.630) (-511.850) (-510.220) [-513.110] -- 0:00:27
569000 -- (-509.561) (-511.680) (-509.007) [-512.609] * (-509.204) (-511.543) (-509.384) [-510.458] -- 0:00:27
569500 -- [-510.281] (-513.262) (-509.384) (-509.890) * (-509.718) (-511.854) (-510.735) [-509.512] -- 0:00:27
570000 -- (-511.591) (-511.460) (-509.140) [-510.301] * (-509.027) (-510.038) [-512.011] (-513.266) -- 0:00:27
Average standard deviation of split frequencies: 0.011954
570500 -- (-513.778) (-509.381) (-511.306) [-508.689] * (-510.157) (-509.593) (-511.658) [-509.891] -- 0:00:27
571000 -- [-512.299] (-509.624) (-517.152) (-512.026) * (-509.828) [-508.687] (-510.326) (-510.672) -- 0:00:27
571500 -- [-509.882] (-508.891) (-509.478) (-510.332) * (-510.278) [-511.420] (-511.773) (-509.069) -- 0:00:27
572000 -- (-510.071) (-511.482) [-511.027] (-511.690) * (-510.497) [-511.897] (-508.603) (-510.334) -- 0:00:27
572500 -- (-511.020) (-512.419) (-510.646) [-509.746] * [-509.722] (-509.854) (-508.814) (-508.961) -- 0:00:27
573000 -- (-512.494) (-511.338) (-511.238) [-510.971] * (-512.984) (-509.621) (-512.834) [-510.340] -- 0:00:27
573500 -- (-511.376) (-512.075) (-509.944) [-509.180] * (-509.571) (-516.340) (-511.911) [-510.795] -- 0:00:27
574000 -- [-511.475] (-515.147) (-509.682) (-509.749) * (-511.865) (-512.395) (-509.911) [-510.131] -- 0:00:27
574500 -- (-511.257) [-512.025] (-510.796) (-511.936) * (-509.297) [-508.901] (-511.950) (-509.842) -- 0:00:27
575000 -- (-510.514) (-512.556) [-509.553] (-510.102) * (-509.623) (-513.449) [-513.434] (-510.011) -- 0:00:27
Average standard deviation of split frequencies: 0.012228
575500 -- (-511.731) (-511.266) [-509.511] (-509.544) * [-509.887] (-513.964) (-511.215) (-510.084) -- 0:00:27
576000 -- (-510.479) [-513.568] (-512.498) (-511.545) * (-510.353) (-511.518) (-515.536) [-510.836] -- 0:00:27
576500 -- (-510.397) (-512.053) (-515.800) [-511.173] * (-509.939) [-510.812] (-510.522) (-511.333) -- 0:00:27
577000 -- [-510.393] (-515.669) (-511.188) (-508.766) * (-509.252) [-509.072] (-509.366) (-509.727) -- 0:00:27
577500 -- (-511.233) (-512.714) (-508.631) [-509.847] * [-510.624] (-511.664) (-510.685) (-508.636) -- 0:00:27
578000 -- (-510.888) [-512.781] (-512.103) (-516.747) * (-511.632) (-510.931) (-512.628) [-509.128] -- 0:00:27
578500 -- (-512.169) (-509.132) [-510.346] (-510.679) * [-509.801] (-512.317) (-509.869) (-511.387) -- 0:00:26
579000 -- (-514.491) (-511.003) (-510.245) [-510.845] * [-510.924] (-509.503) (-508.376) (-511.254) -- 0:00:26
579500 -- (-519.301) (-510.749) [-510.280] (-511.107) * [-509.403] (-511.016) (-508.409) (-510.622) -- 0:00:26
580000 -- (-510.025) [-510.379] (-508.600) (-510.458) * (-510.226) (-513.833) (-510.021) [-508.931] -- 0:00:26
Average standard deviation of split frequencies: 0.012703
580500 -- [-510.761] (-513.730) (-510.474) (-510.767) * [-509.629] (-508.521) (-509.982) (-511.031) -- 0:00:26
581000 -- (-509.838) [-509.704] (-511.730) (-509.842) * (-508.984) (-514.826) (-512.078) [-509.227] -- 0:00:26
581500 -- [-511.043] (-510.008) (-509.124) (-514.087) * (-510.060) (-508.912) [-509.599] (-508.967) -- 0:00:26
582000 -- [-511.010] (-510.201) (-511.692) (-511.871) * (-510.413) (-508.718) (-513.743) [-508.701] -- 0:00:26
582500 -- (-511.759) (-512.101) (-508.496) [-508.364] * (-511.374) (-508.911) [-513.205] (-509.482) -- 0:00:26
583000 -- (-510.954) (-509.999) [-509.370] (-510.413) * (-509.129) [-508.523] (-509.044) (-510.141) -- 0:00:26
583500 -- (-513.284) [-509.730] (-509.469) (-512.701) * (-509.270) [-508.516] (-509.102) (-510.275) -- 0:00:26
584000 -- [-511.865] (-512.550) (-510.700) (-512.599) * (-511.284) [-509.622] (-509.547) (-509.535) -- 0:00:26
584500 -- (-513.516) (-508.711) [-511.607] (-510.000) * (-509.932) (-511.188) (-513.493) [-509.843] -- 0:00:26
585000 -- [-511.141] (-511.897) (-510.717) (-509.986) * (-509.675) [-510.216] (-514.376) (-511.502) -- 0:00:26
Average standard deviation of split frequencies: 0.012824
585500 -- (-510.168) (-513.995) (-508.575) [-511.541] * (-514.636) [-512.526] (-512.270) (-510.513) -- 0:00:26
586000 -- (-508.603) (-510.577) (-510.788) [-510.173] * (-508.376) (-510.222) (-510.961) [-510.554] -- 0:00:26
586500 -- [-508.662] (-508.641) (-511.704) (-513.649) * (-508.462) [-510.478] (-512.587) (-516.744) -- 0:00:26
587000 -- (-513.545) (-512.711) (-511.697) [-509.444] * (-508.712) [-510.396] (-510.834) (-511.442) -- 0:00:26
587500 -- [-511.714] (-512.820) (-510.407) (-509.533) * (-510.371) [-510.813] (-511.808) (-510.776) -- 0:00:26
588000 -- (-511.061) [-511.330] (-510.031) (-509.725) * (-511.154) [-512.729] (-514.452) (-517.510) -- 0:00:26
588500 -- (-513.650) [-509.880] (-515.015) (-514.009) * (-512.137) (-512.196) [-515.301] (-511.274) -- 0:00:26
589000 -- (-511.070) (-515.248) (-518.221) [-509.301] * (-513.345) (-509.468) (-513.199) [-508.889] -- 0:00:26
589500 -- (-509.255) (-513.614) (-513.708) [-509.901] * (-509.267) (-509.417) [-511.862] (-508.661) -- 0:00:26
590000 -- (-509.367) (-514.156) [-508.662] (-509.807) * [-509.913] (-510.908) (-512.990) (-512.163) -- 0:00:26
Average standard deviation of split frequencies: 0.012957
590500 -- (-509.873) [-510.220] (-509.809) (-510.171) * (-508.562) (-508.956) [-513.749] (-511.959) -- 0:00:26
591000 -- (-509.892) (-510.139) (-509.895) [-511.395] * (-510.775) (-512.070) [-511.406] (-510.908) -- 0:00:26
591500 -- (-511.366) (-509.902) [-510.843] (-511.153) * (-510.499) (-512.530) [-511.172] (-510.232) -- 0:00:26
592000 -- (-509.981) [-510.622] (-509.417) (-511.334) * (-510.420) [-513.176] (-509.082) (-515.241) -- 0:00:26
592500 -- [-510.423] (-513.476) (-511.823) (-511.166) * (-508.740) (-511.767) [-509.978] (-511.370) -- 0:00:26
593000 -- [-512.236] (-509.404) (-512.136) (-510.292) * (-509.616) [-511.443] (-510.621) (-511.943) -- 0:00:26
593500 -- [-509.352] (-510.107) (-509.884) (-511.751) * (-509.794) [-516.033] (-509.054) (-510.535) -- 0:00:26
594000 -- [-510.009] (-510.615) (-509.024) (-510.376) * [-511.825] (-515.776) (-508.878) (-510.506) -- 0:00:25
594500 -- [-508.612] (-511.603) (-509.676) (-510.272) * (-508.480) [-513.719] (-508.576) (-509.351) -- 0:00:25
595000 -- (-510.166) (-509.384) (-510.429) [-508.935] * (-508.824) (-510.911) (-510.179) [-509.618] -- 0:00:25
Average standard deviation of split frequencies: 0.012562
595500 -- [-510.443] (-508.702) (-510.484) (-508.943) * (-509.193) [-510.114] (-511.244) (-512.355) -- 0:00:25
596000 -- (-511.185) (-511.127) [-509.929] (-511.935) * [-509.685] (-509.592) (-512.203) (-514.636) -- 0:00:25
596500 -- (-509.687) [-509.041] (-508.883) (-510.982) * (-510.222) (-511.908) [-509.492] (-509.587) -- 0:00:25
597000 -- (-510.897) [-512.092] (-509.215) (-510.298) * (-509.946) [-512.795] (-509.837) (-510.395) -- 0:00:25
597500 -- (-509.563) [-509.850] (-509.784) (-513.822) * (-509.163) (-509.000) [-511.698] (-511.845) -- 0:00:25
598000 -- (-510.315) (-509.076) [-509.549] (-511.040) * [-509.736] (-509.322) (-509.179) (-510.974) -- 0:00:25
598500 -- [-510.799] (-513.845) (-511.008) (-511.599) * (-513.526) (-509.054) [-510.111] (-511.658) -- 0:00:25
599000 -- [-508.688] (-511.301) (-508.691) (-510.090) * (-512.439) [-510.016] (-511.888) (-510.402) -- 0:00:25
599500 -- (-512.715) (-511.460) [-509.916] (-509.911) * (-514.488) (-509.681) [-510.609] (-509.303) -- 0:00:25
600000 -- (-509.131) (-515.208) (-510.222) [-509.019] * (-512.533) (-510.179) [-509.699] (-509.942) -- 0:00:25
Average standard deviation of split frequencies: 0.011625
600500 -- [-509.749] (-512.015) (-512.510) (-510.145) * (-509.302) (-509.257) (-509.213) [-508.987] -- 0:00:25
601000 -- [-508.638] (-512.116) (-511.683) (-510.732) * (-511.267) [-515.452] (-509.061) (-512.239) -- 0:00:25
601500 -- [-509.885] (-511.715) (-510.168) (-510.122) * (-510.852) [-509.444] (-510.827) (-509.902) -- 0:00:25
602000 -- [-511.388] (-509.911) (-508.512) (-510.057) * (-508.825) (-512.615) (-509.417) [-509.853] -- 0:00:25
602500 -- (-509.334) (-509.500) [-510.028] (-511.167) * (-510.637) (-514.438) [-511.238] (-509.664) -- 0:00:25
603000 -- (-508.407) (-510.753) [-511.654] (-510.063) * (-511.251) (-511.914) (-514.504) [-511.676] -- 0:00:25
603500 -- (-509.833) [-512.190] (-508.488) (-511.486) * (-511.141) [-508.926] (-509.462) (-510.286) -- 0:00:25
604000 -- (-510.024) (-510.917) (-510.662) [-514.109] * [-510.279] (-512.743) (-511.001) (-509.777) -- 0:00:25
604500 -- [-509.661] (-510.301) (-508.665) (-514.944) * [-514.169] (-515.203) (-512.593) (-511.196) -- 0:00:25
605000 -- (-509.070) (-509.752) [-510.438] (-515.755) * (-515.794) (-515.604) [-509.177] (-512.138) -- 0:00:25
Average standard deviation of split frequencies: 0.012034
605500 -- (-509.152) (-509.289) [-508.317] (-514.364) * (-510.027) (-513.081) (-508.476) [-510.303] -- 0:00:25
606000 -- (-508.960) (-511.003) (-510.731) [-508.480] * (-509.125) (-509.446) [-509.324] (-511.561) -- 0:00:25
606500 -- [-509.643] (-510.957) (-515.312) (-508.982) * [-510.683] (-514.834) (-509.854) (-509.560) -- 0:00:25
607000 -- (-508.719) (-509.191) (-513.407) [-512.178] * (-511.601) (-512.270) [-510.684] (-510.069) -- 0:00:25
607500 -- (-509.249) (-509.494) [-508.999] (-513.941) * (-513.020) (-515.455) (-512.613) [-511.066] -- 0:00:25
608000 -- (-512.007) (-508.335) (-510.575) [-508.515] * (-510.549) (-510.496) [-510.894] (-510.731) -- 0:00:25
608500 -- (-514.109) [-509.245] (-509.228) (-511.697) * (-508.905) (-511.083) [-512.026] (-508.896) -- 0:00:25
609000 -- [-509.019] (-509.991) (-512.349) (-510.201) * (-510.645) [-511.829] (-515.643) (-510.175) -- 0:00:25
609500 -- [-512.215] (-508.829) (-516.082) (-511.033) * (-510.817) [-508.991] (-509.379) (-509.256) -- 0:00:24
610000 -- [-511.455] (-510.614) (-509.186) (-510.727) * [-509.559] (-510.589) (-510.253) (-508.958) -- 0:00:24
Average standard deviation of split frequencies: 0.012669
610500 -- (-511.102) (-514.936) (-513.128) [-510.911] * (-510.981) [-510.685] (-511.683) (-513.184) -- 0:00:24
611000 -- [-508.866] (-509.883) (-513.682) (-511.200) * [-511.328] (-511.558) (-511.189) (-511.930) -- 0:00:24
611500 -- (-509.288) [-509.666] (-510.145) (-509.138) * (-510.001) (-514.655) (-511.086) [-510.452] -- 0:00:24
612000 -- (-511.753) (-509.009) (-508.754) [-510.029] * [-512.024] (-510.070) (-515.351) (-510.616) -- 0:00:24
612500 -- (-510.910) [-508.802] (-512.646) (-511.652) * (-511.642) (-510.998) (-511.072) [-512.349] -- 0:00:24
613000 -- (-510.828) (-512.831) (-511.224) [-508.800] * [-515.905] (-510.079) (-513.707) (-511.556) -- 0:00:24
613500 -- (-516.898) (-509.278) [-512.791] (-510.773) * [-509.666] (-511.329) (-511.344) (-510.441) -- 0:00:24
614000 -- [-515.295] (-512.520) (-510.122) (-510.045) * (-509.603) (-510.576) [-510.470] (-509.655) -- 0:00:24
614500 -- (-511.635) [-513.740] (-510.468) (-509.329) * (-509.332) (-510.467) (-509.242) [-509.647] -- 0:00:24
615000 -- (-515.373) (-510.677) (-508.701) [-513.060] * (-511.577) (-513.207) [-509.206] (-508.744) -- 0:00:24
Average standard deviation of split frequencies: 0.012829
615500 -- (-511.498) (-509.863) [-511.750] (-511.487) * (-509.443) (-509.971) (-510.854) [-511.203] -- 0:00:24
616000 -- (-509.768) [-510.615] (-510.534) (-509.111) * (-509.621) (-511.500) (-510.850) [-509.258] -- 0:00:24
616500 -- (-513.802) (-510.846) [-513.629] (-508.783) * (-510.010) (-509.748) [-509.789] (-509.627) -- 0:00:24
617000 -- (-508.832) (-511.134) (-509.024) [-512.627] * (-510.539) (-510.083) [-513.214] (-508.812) -- 0:00:24
617500 -- [-510.494] (-511.071) (-510.297) (-510.450) * [-511.587] (-508.669) (-512.540) (-512.945) -- 0:00:24
618000 -- (-509.406) [-516.240] (-509.045) (-511.548) * (-509.912) [-509.378] (-514.430) (-515.203) -- 0:00:24
618500 -- (-509.164) (-511.359) (-511.117) [-510.326] * (-509.086) (-509.231) [-509.563] (-511.855) -- 0:00:24
619000 -- (-511.888) [-509.867] (-510.844) (-512.596) * (-509.082) (-508.850) (-510.073) [-508.632] -- 0:00:24
619500 -- (-508.592) (-509.363) (-509.042) [-510.830] * (-511.003) (-511.408) (-510.942) [-508.877] -- 0:00:24
620000 -- (-508.571) (-511.140) (-509.090) [-508.936] * (-511.979) (-514.365) [-509.744] (-509.355) -- 0:00:24
Average standard deviation of split frequencies: 0.012599
620500 -- [-508.556] (-512.366) (-511.257) (-510.455) * (-509.988) (-508.823) [-511.817] (-509.837) -- 0:00:24
621000 -- (-508.820) (-511.251) (-510.047) [-509.187] * (-514.157) (-514.869) [-511.484] (-513.767) -- 0:00:24
621500 -- (-509.181) (-511.592) [-509.323] (-510.561) * [-511.627] (-509.103) (-511.513) (-510.426) -- 0:00:24
622000 -- (-512.166) (-510.118) [-510.437] (-512.939) * [-511.916] (-509.135) (-511.393) (-511.323) -- 0:00:24
622500 -- (-513.458) (-517.494) (-516.222) [-509.376] * [-508.737] (-511.840) (-511.628) (-513.173) -- 0:00:24
623000 -- [-513.007] (-513.156) (-508.913) (-509.930) * (-508.505) (-509.076) (-510.308) [-509.193] -- 0:00:24
623500 -- (-514.748) (-510.308) [-509.421] (-509.421) * (-508.539) (-512.439) [-509.794] (-515.977) -- 0:00:24
624000 -- [-511.999] (-511.225) (-509.445) (-509.312) * (-509.957) [-513.243] (-512.219) (-509.326) -- 0:00:24
624500 -- (-512.429) (-511.120) [-510.122] (-510.238) * (-511.481) (-509.588) [-511.265] (-508.979) -- 0:00:24
625000 -- (-510.241) (-516.537) (-513.491) [-511.736] * [-510.468] (-512.166) (-513.118) (-509.407) -- 0:00:24
Average standard deviation of split frequencies: 0.012216
625500 -- (-510.884) (-513.679) (-510.322) [-511.349] * (-508.446) [-512.252] (-511.875) (-509.326) -- 0:00:23
626000 -- (-513.280) (-512.737) (-510.803) [-511.422] * [-511.052] (-512.294) (-512.334) (-510.515) -- 0:00:23
626500 -- (-512.458) (-509.822) [-510.343] (-510.042) * (-512.680) (-512.110) [-510.236] (-513.195) -- 0:00:23
627000 -- [-511.730] (-509.929) (-511.529) (-513.710) * (-511.295) (-509.280) [-508.922] (-510.571) -- 0:00:23
627500 -- (-509.645) (-510.698) (-509.453) [-512.666] * [-508.546] (-510.035) (-514.016) (-510.207) -- 0:00:23
628000 -- [-509.636] (-509.466) (-511.407) (-508.769) * (-512.766) [-511.366] (-508.679) (-512.033) -- 0:00:23
628500 -- (-509.697) (-514.770) (-510.655) [-510.206] * [-510.751] (-512.972) (-509.166) (-510.409) -- 0:00:23
629000 -- [-508.940] (-516.572) (-511.394) (-509.141) * (-511.186) (-511.588) (-509.762) [-509.430] -- 0:00:23
629500 -- (-508.684) (-510.663) [-512.897] (-511.781) * (-516.559) [-509.752] (-509.173) (-510.768) -- 0:00:23
630000 -- (-508.704) [-510.869] (-508.607) (-508.962) * (-511.141) [-510.248] (-513.870) (-509.422) -- 0:00:23
Average standard deviation of split frequencies: 0.013415
630500 -- (-513.372) (-513.599) (-510.102) [-510.817] * (-511.019) (-512.938) [-510.981] (-510.420) -- 0:00:23
631000 -- (-509.873) [-514.128] (-510.713) (-510.530) * (-510.383) (-513.836) [-510.141] (-509.119) -- 0:00:23
631500 -- [-514.186] (-509.892) (-511.453) (-512.650) * (-509.194) (-512.231) (-511.398) [-512.315] -- 0:00:23
632000 -- (-509.603) [-508.838] (-509.429) (-509.918) * [-509.755] (-514.611) (-510.517) (-510.852) -- 0:00:23
632500 -- [-509.895] (-509.108) (-508.424) (-509.666) * (-509.526) (-508.577) [-508.930] (-509.733) -- 0:00:23
633000 -- (-510.723) (-509.418) [-510.408] (-509.022) * (-512.124) (-512.259) (-508.969) [-510.673] -- 0:00:23
633500 -- [-511.223] (-510.740) (-511.845) (-512.352) * (-508.398) (-514.664) [-511.081] (-510.837) -- 0:00:23
634000 -- [-511.724] (-511.094) (-512.003) (-509.839) * (-509.254) (-510.749) [-508.560] (-509.258) -- 0:00:23
634500 -- (-510.626) [-509.520] (-509.002) (-510.141) * (-511.160) (-509.584) [-509.623] (-508.425) -- 0:00:23
635000 -- [-509.602] (-510.023) (-510.765) (-510.788) * (-509.867) (-511.690) (-509.006) [-510.528] -- 0:00:23
Average standard deviation of split frequencies: 0.014200
635500 -- (-513.192) [-509.361] (-511.190) (-512.180) * [-509.238] (-508.988) (-509.846) (-511.691) -- 0:00:23
636000 -- (-510.550) [-509.790] (-516.978) (-513.467) * [-514.088] (-510.071) (-508.668) (-511.070) -- 0:00:23
636500 -- (-512.023) [-509.595] (-511.291) (-510.528) * (-510.074) (-511.823) [-510.374] (-511.352) -- 0:00:23
637000 -- (-509.658) [-509.730] (-510.276) (-510.710) * (-510.117) (-511.177) (-512.720) [-509.827] -- 0:00:23
637500 -- (-513.637) (-510.762) [-513.407] (-510.386) * (-508.879) (-510.107) [-510.642] (-509.452) -- 0:00:23
638000 -- (-513.044) (-509.621) (-510.242) [-509.329] * (-511.253) (-510.240) [-511.533] (-509.371) -- 0:00:23
638500 -- (-512.789) [-512.466] (-510.607) (-511.362) * (-511.442) [-512.322] (-510.719) (-509.636) -- 0:00:23
639000 -- (-511.156) (-517.226) (-509.239) [-510.145] * [-510.320] (-510.464) (-510.438) (-511.120) -- 0:00:23
639500 -- [-510.055] (-515.600) (-509.240) (-513.433) * (-509.477) (-508.953) (-512.443) [-515.534] -- 0:00:23
640000 -- (-508.876) (-510.273) [-509.265] (-510.672) * (-509.065) [-509.858] (-510.297) (-517.191) -- 0:00:23
Average standard deviation of split frequencies: 0.014677
640500 -- [-510.182] (-516.260) (-511.958) (-509.272) * [-511.022] (-515.398) (-509.253) (-516.844) -- 0:00:23
641000 -- [-510.372] (-510.833) (-511.627) (-512.485) * (-508.453) (-511.982) (-509.464) [-516.128] -- 0:00:22
641500 -- (-509.721) (-509.930) (-509.112) [-509.799] * (-511.014) (-509.784) (-513.147) [-510.737] -- 0:00:22
642000 -- (-511.582) (-510.460) (-510.556) [-511.168] * [-509.487] (-509.555) (-513.435) (-508.446) -- 0:00:22
642500 -- (-509.453) (-508.751) [-511.026] (-511.700) * [-512.635] (-509.332) (-510.166) (-509.667) -- 0:00:22
643000 -- (-511.962) (-512.782) (-515.535) [-509.425] * (-509.949) (-510.225) (-510.768) [-510.138] -- 0:00:22
643500 -- (-509.273) (-520.402) (-512.745) [-508.921] * (-511.164) (-509.970) (-513.407) [-514.661] -- 0:00:22
644000 -- (-510.148) (-510.003) (-510.437) [-508.567] * [-510.084] (-512.132) (-511.156) (-510.135) -- 0:00:22
644500 -- (-509.961) (-510.397) [-509.678] (-510.821) * (-510.871) (-509.808) [-509.497] (-510.085) -- 0:00:22
645000 -- [-509.395] (-511.225) (-510.339) (-508.828) * [-510.162] (-509.537) (-510.043) (-509.993) -- 0:00:22
Average standard deviation of split frequencies: 0.014018
645500 -- (-514.196) (-513.097) (-512.907) [-508.803] * (-510.223) (-524.470) [-509.355] (-513.698) -- 0:00:22
646000 -- [-508.433] (-511.834) (-513.189) (-513.345) * (-509.900) (-519.154) [-508.655] (-510.827) -- 0:00:22
646500 -- (-509.651) [-509.083] (-509.565) (-512.287) * [-509.213] (-512.937) (-508.909) (-512.838) -- 0:00:22
647000 -- (-512.551) [-508.974] (-509.927) (-509.226) * [-509.122] (-511.629) (-511.533) (-509.947) -- 0:00:22
647500 -- (-512.591) (-512.949) [-508.565] (-510.122) * (-515.239) (-508.536) (-513.497) [-509.407] -- 0:00:22
648000 -- (-509.731) (-508.645) [-510.366] (-511.822) * (-512.708) (-511.539) [-512.324] (-512.383) -- 0:00:22
648500 -- (-509.053) (-509.166) [-510.972] (-509.549) * (-511.711) (-510.445) (-513.753) [-512.675] -- 0:00:22
649000 -- [-509.411] (-510.263) (-511.234) (-509.307) * (-510.342) (-510.691) (-512.580) [-512.144] -- 0:00:22
649500 -- (-510.000) [-511.217] (-516.977) (-510.517) * (-510.216) (-514.064) (-514.339) [-510.299] -- 0:00:22
650000 -- [-510.854] (-511.181) (-515.094) (-509.575) * (-509.325) [-510.962] (-511.717) (-510.272) -- 0:00:22
Average standard deviation of split frequencies: 0.013537
650500 -- (-509.569) [-508.496] (-510.702) (-512.946) * (-510.209) (-511.339) (-513.284) [-509.127] -- 0:00:22
651000 -- [-512.429] (-510.275) (-509.529) (-518.651) * (-511.635) (-510.469) [-509.248] (-508.426) -- 0:00:22
651500 -- (-510.802) (-511.745) [-510.367] (-510.905) * [-509.624] (-510.175) (-509.696) (-511.979) -- 0:00:22
652000 -- (-509.389) (-510.259) (-510.468) [-509.702] * [-509.972] (-508.779) (-510.261) (-515.201) -- 0:00:22
652500 -- (-509.876) [-510.714] (-512.319) (-510.118) * (-510.267) (-510.009) (-509.660) [-510.176] -- 0:00:22
653000 -- (-510.422) [-511.295] (-513.151) (-509.659) * (-511.977) (-512.478) [-510.518] (-512.798) -- 0:00:22
653500 -- (-511.575) [-511.881] (-511.751) (-510.063) * (-509.026) (-509.865) [-509.720] (-511.944) -- 0:00:22
654000 -- (-511.352) (-511.272) (-511.607) [-509.541] * (-512.258) [-508.341] (-510.333) (-511.626) -- 0:00:22
654500 -- (-513.764) (-509.789) (-511.403) [-510.659] * (-514.177) [-510.380] (-508.848) (-511.473) -- 0:00:22
655000 -- (-510.473) [-509.131] (-511.722) (-510.519) * (-515.684) (-509.745) (-511.000) [-517.283] -- 0:00:22
Average standard deviation of split frequencies: 0.013614
655500 -- (-509.066) (-514.115) (-509.990) [-510.777] * (-512.442) [-510.128] (-509.774) (-511.962) -- 0:00:22
656000 -- (-510.297) (-511.027) (-509.892) [-510.956] * (-509.056) (-512.046) (-510.720) [-511.388] -- 0:00:22
656500 -- (-511.844) (-515.142) [-510.874] (-510.226) * (-510.763) (-511.292) (-511.080) [-509.840] -- 0:00:21
657000 -- (-511.330) (-510.183) (-510.726) [-511.995] * (-509.501) [-511.504] (-510.704) (-509.710) -- 0:00:21
657500 -- [-510.010] (-509.144) (-516.670) (-509.292) * (-510.415) (-513.441) [-509.798] (-510.932) -- 0:00:21
658000 -- (-511.241) (-509.738) (-509.186) [-511.492] * [-511.699] (-509.264) (-509.352) (-509.607) -- 0:00:21
658500 -- (-511.231) [-510.509] (-511.594) (-511.965) * [-512.534] (-508.688) (-509.848) (-512.856) -- 0:00:21
659000 -- (-513.494) (-509.090) (-509.957) [-510.002] * (-512.720) (-510.413) [-510.417] (-508.654) -- 0:00:21
659500 -- (-511.003) (-508.806) [-508.956] (-512.660) * (-508.619) (-510.011) (-514.567) [-509.423] -- 0:00:21
660000 -- (-510.075) (-510.539) (-511.285) [-511.006] * (-514.245) (-508.827) (-511.243) [-510.050] -- 0:00:21
Average standard deviation of split frequencies: 0.012804
660500 -- [-511.628] (-508.832) (-509.543) (-510.651) * (-509.531) (-508.702) [-508.886] (-511.810) -- 0:00:21
661000 -- [-511.234] (-510.250) (-509.684) (-515.782) * (-511.250) (-508.925) [-511.992] (-510.903) -- 0:00:21
661500 -- (-510.265) (-512.901) [-510.221] (-512.412) * (-511.356) (-513.171) [-511.389] (-511.494) -- 0:00:21
662000 -- [-511.562] (-515.179) (-511.638) (-508.939) * (-509.371) (-508.931) [-511.975] (-510.279) -- 0:00:21
662500 -- (-512.683) (-511.166) [-511.049] (-508.636) * (-511.146) [-509.244] (-518.039) (-516.225) -- 0:00:21
663000 -- [-508.958] (-511.559) (-509.782) (-510.181) * (-513.069) (-513.495) [-516.898] (-509.868) -- 0:00:21
663500 -- (-509.349) (-509.302) (-510.546) [-512.072] * (-511.167) (-509.743) [-509.548] (-511.254) -- 0:00:21
664000 -- (-516.034) [-512.493] (-510.010) (-510.434) * (-510.377) (-512.391) [-508.853] (-514.812) -- 0:00:21
664500 -- (-511.821) (-509.385) [-509.258] (-511.557) * [-511.133] (-511.270) (-509.343) (-510.233) -- 0:00:21
665000 -- (-511.534) (-511.680) (-510.954) [-510.185] * [-508.722] (-510.784) (-509.746) (-514.045) -- 0:00:21
Average standard deviation of split frequencies: 0.012741
665500 -- (-511.743) (-511.221) (-512.133) [-510.279] * (-509.102) [-510.229] (-513.518) (-512.376) -- 0:00:21
666000 -- (-510.614) (-510.018) [-510.641] (-510.867) * [-509.151] (-512.618) (-509.572) (-508.680) -- 0:00:21
666500 -- (-510.845) [-509.954] (-509.012) (-511.549) * [-509.702] (-509.467) (-509.112) (-513.380) -- 0:00:21
667000 -- (-511.835) (-511.358) (-509.877) [-511.239] * (-509.388) (-512.713) [-508.812] (-510.764) -- 0:00:21
667500 -- [-509.759] (-514.205) (-511.720) (-510.921) * (-509.643) [-512.303] (-512.019) (-509.839) -- 0:00:21
668000 -- (-513.303) [-510.327] (-509.448) (-510.821) * (-510.305) (-512.110) (-509.874) [-509.096] -- 0:00:21
668500 -- (-512.331) [-511.325] (-508.454) (-512.398) * [-512.672] (-512.086) (-512.967) (-509.384) -- 0:00:21
669000 -- (-512.510) (-510.431) [-514.325] (-510.340) * [-509.027] (-511.577) (-511.406) (-511.148) -- 0:00:21
669500 -- (-510.155) [-509.703] (-511.774) (-513.692) * (-509.544) [-510.746] (-510.282) (-511.637) -- 0:00:21
670000 -- (-509.473) (-510.579) [-513.859] (-512.041) * [-508.799] (-511.379) (-511.150) (-512.390) -- 0:00:21
Average standard deviation of split frequencies: 0.012363
670500 -- (-513.383) (-514.232) (-510.814) [-512.909] * (-511.796) [-510.620] (-509.055) (-512.352) -- 0:00:21
671000 -- (-509.909) (-513.560) (-510.915) [-510.388] * (-511.693) [-510.897] (-509.301) (-514.298) -- 0:00:21
671500 -- (-509.917) [-509.364] (-511.672) (-510.157) * (-509.854) (-513.935) (-509.061) [-512.133] -- 0:00:21
672000 -- [-513.860] (-510.063) (-510.896) (-509.827) * [-510.852] (-510.956) (-509.442) (-509.426) -- 0:00:20
672500 -- [-510.422] (-510.299) (-513.211) (-511.832) * (-510.093) [-511.275] (-510.025) (-509.896) -- 0:00:20
673000 -- [-508.639] (-510.428) (-509.378) (-511.945) * [-510.763] (-511.608) (-511.450) (-510.197) -- 0:00:20
673500 -- (-513.547) [-510.691] (-510.565) (-512.433) * (-508.861) (-513.267) [-513.697] (-508.598) -- 0:00:20
674000 -- [-513.806] (-511.924) (-512.295) (-510.220) * (-510.255) (-511.933) [-512.936] (-513.709) -- 0:00:20
674500 -- [-510.320] (-511.338) (-510.400) (-510.414) * (-511.205) [-509.203] (-512.654) (-509.918) -- 0:00:20
675000 -- (-511.547) (-512.029) (-511.418) [-508.956] * [-510.316] (-509.272) (-508.332) (-511.692) -- 0:00:20
Average standard deviation of split frequencies: 0.011506
675500 -- (-514.241) (-510.889) (-509.482) [-509.685] * (-510.449) [-509.441] (-509.087) (-511.080) -- 0:00:20
676000 -- (-511.150) (-508.808) [-512.515] (-509.947) * [-510.628] (-509.249) (-513.309) (-509.503) -- 0:00:20
676500 -- (-509.345) (-508.520) [-509.235] (-510.113) * (-509.643) (-511.757) (-509.820) [-510.734] -- 0:00:20
677000 -- (-510.414) (-509.564) [-510.685] (-509.612) * (-510.458) [-509.606] (-509.448) (-508.537) -- 0:00:20
677500 -- (-512.866) (-511.215) (-512.204) [-509.694] * (-509.506) (-511.192) [-510.948] (-512.055) -- 0:00:20
678000 -- (-508.738) [-511.813] (-510.094) (-513.278) * (-510.151) (-513.558) [-508.320] (-512.680) -- 0:00:20
678500 -- [-513.664] (-508.362) (-512.971) (-509.546) * (-511.005) (-509.821) [-508.332] (-510.187) -- 0:00:20
679000 -- (-509.021) (-509.962) (-510.888) [-509.868] * (-510.863) (-511.874) [-509.213] (-515.423) -- 0:00:20
679500 -- (-510.633) (-509.266) [-509.781] (-508.839) * [-511.335] (-515.385) (-510.403) (-510.312) -- 0:00:20
680000 -- (-516.704) (-512.156) (-510.495) [-509.932] * (-515.332) (-509.210) [-513.981] (-510.140) -- 0:00:20
Average standard deviation of split frequencies: 0.012140
680500 -- (-511.463) (-512.765) [-510.444] (-515.517) * (-512.349) (-509.449) (-516.819) [-511.747] -- 0:00:20
681000 -- (-512.662) [-508.924] (-510.101) (-517.299) * (-510.420) (-511.250) [-511.843] (-515.599) -- 0:00:20
681500 -- [-511.394] (-512.300) (-512.508) (-510.751) * (-517.783) (-516.177) (-513.126) [-510.819] -- 0:00:20
682000 -- (-509.185) [-511.140] (-509.989) (-511.545) * [-509.588] (-511.123) (-509.152) (-513.081) -- 0:00:20
682500 -- (-510.152) (-511.382) (-512.097) [-512.593] * (-513.285) [-509.663] (-511.891) (-517.665) -- 0:00:20
683000 -- [-510.741] (-512.007) (-512.469) (-509.935) * (-509.780) [-510.054] (-510.064) (-512.178) -- 0:00:20
683500 -- (-509.905) (-516.075) [-509.764] (-509.825) * [-510.884] (-510.173) (-510.746) (-512.122) -- 0:00:20
684000 -- (-509.793) (-517.597) (-509.419) [-512.488] * (-510.577) [-509.942] (-508.983) (-511.354) -- 0:00:20
684500 -- (-509.411) [-509.992] (-508.217) (-509.728) * (-509.705) [-509.385] (-510.753) (-511.925) -- 0:00:20
685000 -- (-508.903) (-509.154) (-510.428) [-508.517] * [-509.663] (-510.760) (-510.283) (-510.777) -- 0:00:20
Average standard deviation of split frequencies: 0.012450
685500 -- (-514.933) (-511.331) [-508.842] (-512.080) * [-508.962] (-512.532) (-509.811) (-511.301) -- 0:00:20
686000 -- [-512.696] (-509.264) (-509.176) (-511.850) * (-508.876) [-512.145] (-512.139) (-512.371) -- 0:00:20
686500 -- (-515.354) [-511.376] (-510.418) (-509.293) * [-509.308] (-511.840) (-511.545) (-508.964) -- 0:00:20
687000 -- [-512.278] (-512.806) (-517.237) (-510.823) * (-510.258) [-512.291] (-510.911) (-509.156) -- 0:00:20
687500 -- (-510.481) (-510.750) (-510.335) [-510.880] * [-513.212] (-513.020) (-516.110) (-510.582) -- 0:00:20
688000 -- (-512.206) (-510.285) [-511.680] (-514.303) * (-513.304) [-511.928] (-512.539) (-511.314) -- 0:00:19
688500 -- (-511.811) (-509.065) (-510.524) [-511.911] * [-508.926] (-510.026) (-510.336) (-510.434) -- 0:00:19
689000 -- [-510.845] (-510.793) (-509.965) (-512.536) * (-510.369) (-510.356) [-510.173] (-509.692) -- 0:00:19
689500 -- [-509.079] (-512.403) (-511.781) (-511.294) * (-510.377) [-510.836] (-510.854) (-512.814) -- 0:00:19
690000 -- (-510.690) (-512.081) (-509.690) [-510.886] * (-510.772) (-510.166) (-509.828) [-513.610] -- 0:00:19
Average standard deviation of split frequencies: 0.012567
690500 -- (-510.672) (-511.567) (-509.703) [-510.225] * (-513.080) (-510.610) (-514.273) [-510.122] -- 0:00:19
691000 -- (-511.670) (-510.704) (-509.778) [-508.827] * (-510.027) (-509.985) (-514.782) [-510.791] -- 0:00:19
691500 -- (-513.622) (-509.905) [-510.771] (-513.610) * (-509.676) (-509.318) [-509.872] (-510.316) -- 0:00:19
692000 -- (-511.894) (-509.695) [-508.888] (-510.294) * [-511.167] (-515.066) (-511.213) (-510.878) -- 0:00:19
692500 -- (-511.016) (-509.930) (-511.156) [-510.019] * (-510.386) (-509.961) [-510.124] (-509.904) -- 0:00:19
693000 -- (-510.204) (-510.177) [-511.112] (-510.587) * (-509.836) (-510.468) (-511.660) [-508.452] -- 0:00:19
693500 -- (-508.713) [-510.138] (-513.389) (-514.709) * [-511.406] (-510.135) (-511.387) (-509.852) -- 0:00:19
694000 -- (-511.248) (-514.463) [-512.067] (-512.206) * [-512.021] (-508.941) (-510.164) (-512.625) -- 0:00:19
694500 -- (-511.920) [-511.368] (-511.103) (-510.808) * (-511.306) (-510.337) (-511.293) [-509.974] -- 0:00:19
695000 -- (-510.982) (-509.317) (-511.473) [-508.971] * [-510.344] (-511.151) (-510.391) (-509.707) -- 0:00:19
Average standard deviation of split frequencies: 0.012032
695500 -- (-512.915) [-511.206] (-508.769) (-510.404) * (-510.677) (-509.784) (-509.358) [-510.940] -- 0:00:19
696000 -- [-510.850] (-509.943) (-508.881) (-510.448) * [-512.636] (-509.448) (-510.345) (-509.885) -- 0:00:19
696500 -- (-511.349) [-510.050] (-512.922) (-509.072) * (-511.291) (-511.988) [-509.835] (-513.181) -- 0:00:19
697000 -- (-509.412) [-513.005] (-508.919) (-511.440) * [-509.825] (-512.099) (-512.358) (-508.938) -- 0:00:19
697500 -- [-508.953] (-512.379) (-510.458) (-510.563) * (-510.601) (-508.646) (-515.294) [-509.354] -- 0:00:19
698000 -- [-509.933] (-511.795) (-513.641) (-510.857) * (-509.744) (-508.491) (-512.644) [-509.384] -- 0:00:19
698500 -- (-509.896) (-509.881) [-511.275] (-509.133) * (-511.700) (-513.722) (-509.573) [-509.161] -- 0:00:19
699000 -- (-508.916) (-508.653) [-510.764] (-509.236) * [-510.288] (-513.223) (-511.945) (-509.249) -- 0:00:19
699500 -- (-508.281) (-510.229) [-511.555] (-514.100) * [-511.462] (-513.226) (-513.446) (-512.775) -- 0:00:19
700000 -- (-512.606) (-509.115) [-510.818] (-512.224) * [-511.516] (-515.122) (-510.743) (-513.397) -- 0:00:19
Average standard deviation of split frequencies: 0.012427
700500 -- (-510.916) (-509.732) (-512.181) [-508.680] * (-513.407) (-509.083) [-512.440] (-513.057) -- 0:00:19
701000 -- (-516.431) [-508.932] (-509.540) (-514.359) * [-509.705] (-511.347) (-510.944) (-509.902) -- 0:00:19
701500 -- (-513.011) (-519.333) (-511.920) [-510.237] * [-508.999] (-512.307) (-510.939) (-511.978) -- 0:00:19
702000 -- (-509.800) [-514.930] (-513.212) (-509.097) * (-509.855) (-515.938) [-509.915] (-510.859) -- 0:00:19
702500 -- (-510.611) (-511.034) (-510.647) [-509.762] * (-509.902) (-509.777) (-509.640) [-509.854] -- 0:00:19
703000 -- (-511.064) (-511.263) (-509.882) [-512.206] * (-509.904) [-510.246] (-508.762) (-511.102) -- 0:00:19
703500 -- (-510.413) (-512.107) (-513.890) [-510.455] * [-509.617] (-509.973) (-512.116) (-512.971) -- 0:00:18
704000 -- [-510.330] (-511.854) (-512.212) (-508.326) * (-509.843) (-510.015) (-511.825) [-509.796] -- 0:00:18
704500 -- (-509.383) (-509.276) (-512.137) [-509.068] * (-511.252) (-514.063) (-512.574) [-509.181] -- 0:00:18
705000 -- [-509.427] (-514.014) (-511.784) (-510.491) * (-509.568) (-510.140) [-513.571] (-510.349) -- 0:00:18
Average standard deviation of split frequencies: 0.012215
705500 -- [-509.873] (-510.176) (-510.360) (-510.379) * [-509.843] (-511.850) (-513.054) (-510.424) -- 0:00:18
706000 -- (-510.125) (-509.714) [-508.972] (-511.601) * [-513.880] (-514.807) (-514.724) (-511.440) -- 0:00:18
706500 -- (-511.631) (-510.568) (-512.202) [-509.900] * (-510.296) (-513.235) [-510.869] (-508.216) -- 0:00:18
707000 -- (-514.132) (-510.970) [-513.195] (-512.129) * (-509.338) (-509.678) (-509.646) [-508.414] -- 0:00:18
707500 -- (-510.371) (-510.496) [-513.489] (-513.338) * (-509.313) (-508.551) (-509.934) [-510.864] -- 0:00:18
708000 -- (-510.030) (-512.391) [-509.810] (-510.506) * [-512.412] (-511.785) (-509.152) (-508.745) -- 0:00:18
708500 -- (-516.569) [-509.634] (-510.196) (-515.498) * (-509.564) (-509.552) (-510.433) [-508.747] -- 0:00:18
709000 -- [-509.910] (-510.852) (-512.560) (-510.213) * (-513.960) (-510.494) (-509.779) [-510.481] -- 0:00:18
709500 -- (-511.128) [-510.976] (-512.593) (-509.945) * (-511.744) [-509.482] (-508.695) (-515.011) -- 0:00:18
710000 -- (-510.305) (-509.916) (-512.280) [-514.234] * (-511.522) [-509.282] (-510.320) (-510.526) -- 0:00:18
Average standard deviation of split frequencies: 0.012252
710500 -- (-512.969) [-508.853] (-508.737) (-509.896) * (-508.680) (-511.488) [-508.562] (-509.315) -- 0:00:18
711000 -- [-509.561] (-508.841) (-513.356) (-515.593) * (-510.290) (-514.834) [-508.730] (-509.585) -- 0:00:18
711500 -- [-511.163] (-509.512) (-516.118) (-509.699) * (-510.388) (-510.212) (-511.567) [-512.305] -- 0:00:18
712000 -- (-510.017) (-510.695) [-509.181] (-510.151) * (-510.061) [-510.556] (-511.990) (-512.650) -- 0:00:18
712500 -- (-511.098) [-511.922] (-508.594) (-513.367) * (-513.113) [-509.051] (-514.822) (-512.379) -- 0:00:18
713000 -- [-510.839] (-512.211) (-509.060) (-511.946) * [-508.917] (-509.200) (-511.921) (-511.569) -- 0:00:18
713500 -- (-510.839) (-509.479) [-510.783] (-510.519) * [-508.839] (-510.770) (-510.686) (-509.093) -- 0:00:18
714000 -- (-510.219) (-510.169) (-510.584) [-509.911] * (-508.673) [-515.708] (-511.513) (-509.003) -- 0:00:18
714500 -- (-510.553) [-511.040] (-512.315) (-512.434) * [-511.508] (-514.890) (-510.057) (-511.876) -- 0:00:18
715000 -- (-511.737) [-512.626] (-509.920) (-512.680) * [-511.858] (-512.190) (-508.829) (-512.760) -- 0:00:18
Average standard deviation of split frequencies: 0.011234
715500 -- (-511.147) (-512.627) (-510.903) [-514.587] * [-508.760] (-511.851) (-508.873) (-515.371) -- 0:00:18
716000 -- (-509.651) (-509.894) (-512.853) [-512.319] * (-509.870) (-509.789) [-508.398] (-512.898) -- 0:00:18
716500 -- (-511.727) [-510.196] (-510.056) (-511.618) * (-510.854) (-509.622) [-509.248] (-510.771) -- 0:00:18
717000 -- (-511.534) (-510.202) (-510.115) [-512.624] * [-509.717] (-513.156) (-510.688) (-509.431) -- 0:00:18
717500 -- [-510.571] (-510.873) (-510.734) (-510.507) * (-513.019) (-510.405) [-509.787] (-509.774) -- 0:00:18
718000 -- [-513.576] (-511.990) (-511.738) (-509.691) * (-509.204) (-509.706) [-508.987] (-509.949) -- 0:00:18
718500 -- (-509.973) (-512.380) [-509.814] (-515.483) * (-512.219) [-509.024] (-509.654) (-508.413) -- 0:00:18
719000 -- [-509.636] (-511.815) (-510.996) (-508.603) * (-511.342) [-512.245] (-512.211) (-510.553) -- 0:00:17
719500 -- (-508.967) (-509.004) (-511.401) [-509.662] * (-510.980) [-508.914] (-512.287) (-509.455) -- 0:00:17
720000 -- (-515.557) (-510.320) [-509.653] (-511.084) * (-509.045) (-508.903) (-517.309) [-509.551] -- 0:00:17
Average standard deviation of split frequencies: 0.011202
720500 -- (-509.223) (-510.106) [-510.407] (-509.490) * (-510.686) [-510.419] (-514.880) (-510.100) -- 0:00:17
721000 -- (-510.674) [-515.442] (-510.304) (-509.675) * (-515.018) (-509.973) [-510.742] (-511.506) -- 0:00:17
721500 -- (-510.752) (-511.257) (-509.371) [-510.249] * (-510.782) [-510.772] (-515.366) (-509.571) -- 0:00:17
722000 -- (-511.890) [-513.000] (-509.949) (-511.189) * (-513.146) (-512.184) (-517.296) [-509.046] -- 0:00:17
722500 -- (-509.181) (-510.357) [-509.824] (-509.715) * (-514.080) (-509.696) (-518.373) [-512.936] -- 0:00:18
723000 -- (-512.033) [-511.138] (-510.276) (-511.018) * (-509.204) (-510.049) (-510.237) [-510.209] -- 0:00:18
723500 -- [-511.197] (-510.595) (-509.857) (-510.563) * (-509.579) [-509.738] (-509.782) (-509.797) -- 0:00:17
724000 -- (-513.079) [-508.672] (-509.095) (-510.948) * (-508.756) (-509.407) [-511.576] (-511.300) -- 0:00:17
724500 -- (-511.150) (-510.160) (-509.167) [-510.504] * [-509.598] (-509.414) (-513.196) (-509.841) -- 0:00:17
725000 -- (-510.714) (-513.099) (-509.755) [-509.964] * [-509.832] (-510.674) (-510.999) (-515.051) -- 0:00:17
Average standard deviation of split frequencies: 0.011322
725500 -- (-512.269) (-511.059) (-511.922) [-510.665] * (-512.347) [-511.404] (-510.580) (-516.104) -- 0:00:17
726000 -- (-510.505) (-512.140) (-511.207) [-509.703] * (-512.445) (-509.218) (-515.995) [-511.048] -- 0:00:17
726500 -- (-512.681) (-514.626) (-509.960) [-510.034] * (-510.924) (-509.565) (-511.386) [-509.381] -- 0:00:17
727000 -- [-511.847] (-520.975) (-511.218) (-511.616) * (-509.957) [-511.306] (-509.522) (-511.151) -- 0:00:17
727500 -- (-510.075) [-509.079] (-510.695) (-508.921) * (-511.467) (-512.075) [-508.747] (-513.769) -- 0:00:17
728000 -- (-509.234) (-510.447) (-510.024) [-509.233] * (-510.183) (-508.913) [-510.504] (-512.569) -- 0:00:17
728500 -- [-510.051] (-509.099) (-508.952) (-512.912) * (-509.778) (-512.662) [-510.490] (-512.405) -- 0:00:17
729000 -- [-514.144] (-510.700) (-520.370) (-511.611) * (-512.206) (-508.988) (-511.805) [-509.389] -- 0:00:17
729500 -- (-509.774) (-510.650) (-509.383) [-512.180] * (-513.293) [-509.524] (-513.276) (-511.740) -- 0:00:17
730000 -- (-509.260) [-511.268] (-513.089) (-508.726) * (-513.149) [-511.415] (-512.305) (-512.575) -- 0:00:17
Average standard deviation of split frequencies: 0.012031
730500 -- (-508.250) (-516.330) [-511.938] (-511.328) * (-508.989) (-510.103) [-512.209] (-517.321) -- 0:00:17
731000 -- [-510.396] (-514.669) (-512.592) (-509.015) * (-511.254) (-509.534) (-518.179) [-509.672] -- 0:00:17
731500 -- (-511.138) (-511.907) (-511.684) [-508.595] * (-511.030) (-511.837) [-511.140] (-510.979) -- 0:00:17
732000 -- (-511.287) (-508.703) [-511.050] (-510.320) * (-510.797) (-510.058) [-509.851] (-512.678) -- 0:00:17
732500 -- (-510.927) (-511.473) (-509.829) [-510.570] * (-509.526) (-509.327) [-510.307] (-510.800) -- 0:00:17
733000 -- (-510.134) [-509.794] (-511.653) (-510.191) * (-508.807) (-516.052) (-511.665) [-510.557] -- 0:00:17
733500 -- (-510.131) [-511.894] (-509.385) (-510.309) * (-509.025) (-510.550) (-513.340) [-514.345] -- 0:00:17
734000 -- (-510.733) (-512.823) (-510.445) [-512.068] * (-514.732) [-510.222] (-509.482) (-510.482) -- 0:00:17
734500 -- (-513.036) (-510.248) (-511.601) [-511.060] * [-508.522] (-508.819) (-510.315) (-508.944) -- 0:00:16
735000 -- [-510.631] (-509.103) (-509.976) (-509.416) * [-508.909] (-509.494) (-512.215) (-511.354) -- 0:00:16
Average standard deviation of split frequencies: 0.011906
735500 -- [-509.285] (-511.280) (-519.457) (-510.851) * (-511.634) [-508.959] (-510.288) (-511.420) -- 0:00:16
736000 -- (-509.053) (-511.136) (-512.638) [-510.813] * (-511.276) (-512.236) (-511.587) [-509.215] -- 0:00:16
736500 -- (-509.498) (-509.466) (-510.198) [-509.232] * (-510.022) (-510.164) (-511.301) [-508.911] -- 0:00:16
737000 -- [-510.080] (-510.891) (-512.969) (-512.137) * (-513.032) (-509.720) (-510.745) [-511.500] -- 0:00:16
737500 -- (-509.984) [-509.176] (-510.954) (-511.302) * (-512.643) [-509.478] (-510.536) (-511.260) -- 0:00:17
738000 -- (-510.647) [-508.920] (-514.581) (-510.625) * [-510.261] (-508.330) (-509.713) (-513.894) -- 0:00:17
738500 -- (-510.159) [-509.080] (-512.021) (-510.396) * [-510.451] (-508.996) (-510.170) (-514.137) -- 0:00:16
739000 -- [-511.779] (-509.131) (-510.223) (-509.692) * (-511.000) (-510.014) [-510.097] (-510.325) -- 0:00:16
739500 -- (-512.198) [-511.178] (-510.544) (-515.042) * (-516.952) [-509.643] (-509.839) (-509.976) -- 0:00:16
740000 -- [-509.741] (-512.366) (-510.855) (-508.862) * (-508.712) (-512.896) [-509.861] (-510.882) -- 0:00:16
Average standard deviation of split frequencies: 0.011044
740500 -- (-514.059) (-511.933) (-509.312) [-511.053] * [-509.322] (-512.661) (-508.496) (-510.863) -- 0:00:16
741000 -- [-511.705] (-510.892) (-510.264) (-510.549) * (-509.306) [-509.650] (-511.004) (-510.773) -- 0:00:16
741500 -- (-512.681) (-513.439) (-511.148) [-510.202] * (-511.565) [-512.352] (-509.688) (-512.804) -- 0:00:16
742000 -- (-511.295) (-510.388) (-509.776) [-511.169] * [-509.660] (-509.697) (-509.928) (-510.243) -- 0:00:16
742500 -- (-514.427) [-511.951] (-508.688) (-509.050) * (-511.108) (-514.093) (-511.505) [-510.155] -- 0:00:16
743000 -- (-511.167) (-511.414) (-510.079) [-515.572] * [-509.807] (-513.386) (-512.377) (-509.630) -- 0:00:16
743500 -- [-511.471] (-510.069) (-512.800) (-513.491) * [-509.590] (-511.801) (-513.896) (-510.483) -- 0:00:16
744000 -- (-512.744) [-510.740] (-512.546) (-513.667) * [-509.990] (-512.743) (-516.200) (-512.068) -- 0:00:16
744500 -- [-510.716] (-511.826) (-510.648) (-509.462) * (-516.880) [-513.049] (-512.469) (-511.535) -- 0:00:16
745000 -- (-513.278) [-510.073] (-511.549) (-510.205) * [-512.782] (-511.247) (-512.548) (-511.099) -- 0:00:16
Average standard deviation of split frequencies: 0.010778
745500 -- (-513.320) (-509.762) (-511.270) [-508.776] * (-513.938) [-512.405] (-510.511) (-511.132) -- 0:00:16
746000 -- (-511.874) (-513.150) [-510.348] (-508.318) * (-509.869) (-514.721) (-518.723) [-511.326] -- 0:00:16
746500 -- (-509.068) (-510.987) [-509.249] (-510.060) * (-509.250) (-511.897) (-511.324) [-510.507] -- 0:00:16
747000 -- [-508.939] (-509.773) (-511.638) (-511.444) * (-511.549) (-511.308) [-508.642] (-510.248) -- 0:00:16
747500 -- (-511.075) [-508.914] (-510.248) (-510.724) * (-513.482) [-510.282] (-510.924) (-509.234) -- 0:00:16
748000 -- (-511.525) (-509.241) (-510.820) [-511.419] * (-521.031) [-511.779] (-512.242) (-510.312) -- 0:00:16
748500 -- [-511.993] (-509.289) (-511.568) (-508.948) * (-511.524) (-512.844) [-511.159] (-511.315) -- 0:00:16
749000 -- (-513.439) [-510.835] (-509.868) (-513.079) * (-511.417) [-509.780] (-511.591) (-513.598) -- 0:00:16
749500 -- (-510.556) (-509.415) (-509.344) [-513.254] * (-508.182) (-508.936) (-512.237) [-509.480] -- 0:00:16
750000 -- (-509.583) [-511.516] (-509.230) (-510.682) * (-509.290) (-509.706) [-509.331] (-511.963) -- 0:00:16
Average standard deviation of split frequencies: 0.010479
750500 -- (-509.134) (-512.858) [-510.500] (-510.361) * [-509.279] (-508.923) (-512.998) (-510.871) -- 0:00:15
751000 -- (-510.867) (-509.069) [-509.451] (-509.674) * [-508.779] (-510.466) (-509.511) (-511.538) -- 0:00:15
751500 -- (-512.134) (-509.598) [-512.172] (-509.349) * (-510.959) [-510.033] (-508.742) (-511.277) -- 0:00:15
752000 -- [-511.144] (-513.628) (-510.014) (-510.033) * (-511.169) (-511.162) (-511.644) [-510.236] -- 0:00:15
752500 -- (-511.809) (-510.613) (-508.256) [-509.212] * [-508.951] (-510.320) (-510.472) (-510.355) -- 0:00:15
753000 -- (-509.552) (-509.273) [-509.020] (-511.046) * [-511.632] (-512.953) (-513.755) (-513.271) -- 0:00:15
753500 -- (-510.164) (-510.554) [-509.479] (-511.986) * [-509.078] (-508.470) (-512.934) (-510.540) -- 0:00:16
754000 -- (-512.578) [-509.743] (-509.349) (-509.541) * [-511.512] (-508.719) (-510.347) (-513.516) -- 0:00:15
754500 -- (-511.081) (-509.743) [-509.178] (-510.020) * (-513.138) (-514.117) (-513.938) [-515.041] -- 0:00:15
755000 -- (-511.191) (-511.173) (-511.727) [-509.590] * (-510.924) [-508.959] (-512.487) (-511.174) -- 0:00:15
Average standard deviation of split frequencies: 0.010289
755500 -- (-508.452) [-510.566] (-508.843) (-510.934) * (-512.692) (-509.386) [-509.393] (-509.274) -- 0:00:15
756000 -- [-512.496] (-510.880) (-512.989) (-510.260) * (-514.698) [-513.581] (-509.695) (-509.609) -- 0:00:15
756500 -- (-510.924) (-510.380) [-510.153] (-509.896) * (-514.561) [-511.020] (-511.103) (-511.454) -- 0:00:15
757000 -- (-512.093) (-509.471) (-508.425) [-508.924] * (-514.574) (-510.159) (-510.712) [-509.935] -- 0:00:15
757500 -- [-508.543] (-516.316) (-510.563) (-512.329) * [-513.864] (-511.327) (-512.117) (-510.961) -- 0:00:15
758000 -- (-509.287) (-510.643) [-511.275] (-510.738) * (-510.015) [-509.206] (-516.392) (-508.732) -- 0:00:15
758500 -- [-513.373] (-510.963) (-512.627) (-515.982) * (-513.624) (-511.398) (-509.849) [-508.545] -- 0:00:15
759000 -- [-509.889] (-512.865) (-511.512) (-512.128) * (-508.702) (-508.642) (-509.492) [-511.276] -- 0:00:15
759500 -- (-514.513) (-514.768) (-511.607) [-509.770] * [-509.642] (-510.793) (-509.793) (-510.607) -- 0:00:15
760000 -- [-510.393] (-513.612) (-512.691) (-509.130) * (-509.342) (-513.885) (-509.697) [-511.891] -- 0:00:15
Average standard deviation of split frequencies: 0.010754
760500 -- [-512.367] (-515.331) (-510.108) (-510.704) * [-510.159] (-511.284) (-510.626) (-509.919) -- 0:00:15
761000 -- (-517.864) (-511.407) (-510.241) [-508.783] * [-508.858] (-516.199) (-510.582) (-510.020) -- 0:00:15
761500 -- (-514.595) (-510.910) [-510.446] (-510.256) * (-509.867) [-515.682] (-508.816) (-512.105) -- 0:00:15
762000 -- (-513.026) (-511.484) (-509.281) [-510.262] * [-508.870] (-511.134) (-511.978) (-509.946) -- 0:00:15
762500 -- (-508.468) (-510.711) (-510.110) [-512.810] * (-511.633) (-512.887) [-510.422] (-510.336) -- 0:00:15
763000 -- (-508.483) (-510.892) [-509.948] (-510.779) * (-511.462) (-512.019) [-509.309] (-511.845) -- 0:00:15
763500 -- (-511.400) (-510.846) (-508.901) [-511.174] * (-509.823) (-509.843) [-509.198] (-514.485) -- 0:00:15
764000 -- (-509.386) (-513.780) [-511.222] (-512.059) * (-509.262) (-511.718) [-509.448] (-510.569) -- 0:00:15
764500 -- (-509.265) (-515.520) (-512.189) [-509.926] * [-511.645] (-511.671) (-511.450) (-510.272) -- 0:00:15
765000 -- (-509.264) [-512.010] (-509.253) (-513.417) * (-510.437) (-511.854) (-512.439) [-509.570] -- 0:00:15
Average standard deviation of split frequencies: 0.010245
765500 -- [-510.807] (-513.121) (-508.950) (-510.147) * (-511.092) [-515.083] (-510.576) (-509.956) -- 0:00:15
766000 -- [-513.436] (-510.009) (-509.324) (-513.321) * [-510.032] (-509.285) (-512.601) (-509.509) -- 0:00:14
766500 -- [-510.259] (-509.881) (-509.324) (-513.373) * (-509.434) (-509.349) [-511.625] (-511.362) -- 0:00:14
767000 -- [-509.237] (-509.772) (-510.626) (-509.822) * (-510.378) [-512.896] (-509.848) (-511.561) -- 0:00:14
767500 -- (-512.410) [-519.826] (-509.769) (-509.218) * [-510.073] (-511.344) (-509.712) (-510.827) -- 0:00:14
768000 -- (-510.930) (-512.473) [-509.809] (-508.282) * (-510.679) [-508.675] (-510.416) (-515.479) -- 0:00:14
768500 -- (-510.291) (-511.780) (-509.474) [-508.266] * (-510.298) [-509.534] (-509.611) (-509.950) -- 0:00:14
769000 -- (-508.457) [-509.904] (-511.950) (-508.803) * (-510.556) (-513.975) (-509.617) [-514.676] -- 0:00:14
769500 -- (-510.069) (-511.021) [-511.373] (-511.483) * [-509.766] (-511.471) (-512.936) (-513.247) -- 0:00:14
770000 -- (-510.880) (-509.647) (-511.611) [-510.806] * (-508.888) (-509.275) (-509.611) [-509.631] -- 0:00:14
Average standard deviation of split frequencies: 0.010207
770500 -- (-510.500) [-509.723] (-509.685) (-513.184) * (-511.057) [-510.754] (-510.037) (-509.612) -- 0:00:14
771000 -- (-509.547) [-509.787] (-508.714) (-510.914) * (-508.867) [-510.680] (-509.856) (-513.897) -- 0:00:14
771500 -- (-510.617) (-512.239) (-514.202) [-509.100] * (-510.961) (-511.018) (-508.610) [-509.640] -- 0:00:14
772000 -- (-510.127) (-510.662) [-510.062] (-510.137) * (-510.102) (-511.552) (-511.113) [-509.531] -- 0:00:14
772500 -- (-509.418) (-510.864) (-512.405) [-509.858] * (-510.904) (-509.735) (-514.429) [-509.293] -- 0:00:14
773000 -- [-510.738] (-512.165) (-509.926) (-509.224) * (-510.272) (-510.491) (-509.499) [-510.883] -- 0:00:14
773500 -- (-514.357) [-509.868] (-510.123) (-510.084) * (-509.599) [-515.608] (-509.173) (-513.692) -- 0:00:14
774000 -- (-510.540) (-509.504) [-511.601] (-508.929) * [-509.627] (-514.700) (-509.681) (-510.451) -- 0:00:14
774500 -- [-510.812] (-509.213) (-509.742) (-511.333) * [-514.139] (-513.735) (-510.149) (-509.141) -- 0:00:14
775000 -- (-512.288) (-510.436) [-511.354] (-511.529) * (-512.162) (-514.002) (-509.903) [-508.589] -- 0:00:14
Average standard deviation of split frequencies: 0.010792
775500 -- (-512.020) (-509.364) [-511.482] (-509.986) * (-510.119) (-513.254) [-509.327] (-514.005) -- 0:00:14
776000 -- (-516.026) [-508.817] (-512.568) (-508.810) * (-509.662) [-511.086] (-509.430) (-512.410) -- 0:00:14
776500 -- (-512.409) (-511.493) (-508.865) [-508.293] * [-509.888] (-508.898) (-512.363) (-510.999) -- 0:00:14
777000 -- (-509.836) [-508.734] (-509.800) (-509.063) * [-509.954] (-516.915) (-511.415) (-510.057) -- 0:00:14
777500 -- (-510.979) [-513.570] (-509.612) (-513.946) * [-509.124] (-513.600) (-509.229) (-511.241) -- 0:00:14
778000 -- (-510.745) (-509.710) (-512.703) [-509.613] * (-508.775) [-515.411] (-509.192) (-510.283) -- 0:00:14
778500 -- (-511.340) (-509.104) [-509.515] (-510.138) * [-509.819] (-510.209) (-512.631) (-511.188) -- 0:00:14
779000 -- (-509.074) (-509.732) [-513.402] (-511.226) * [-512.701] (-512.601) (-510.962) (-512.998) -- 0:00:14
779500 -- (-513.878) (-512.713) [-508.973] (-519.460) * (-509.418) (-509.909) [-510.292] (-511.427) -- 0:00:14
780000 -- (-511.778) (-510.475) [-509.029] (-511.627) * (-510.219) [-510.680] (-512.418) (-510.979) -- 0:00:14
Average standard deviation of split frequencies: 0.010454
780500 -- (-509.733) (-510.107) [-509.556] (-508.991) * (-511.543) [-509.647] (-509.809) (-511.387) -- 0:00:14
781000 -- [-508.871] (-514.148) (-514.349) (-511.250) * (-512.802) (-508.857) [-510.826] (-511.457) -- 0:00:14
781500 -- (-509.745) (-510.076) (-511.797) [-510.723] * (-510.385) (-508.717) [-509.468] (-511.879) -- 0:00:13
782000 -- (-510.095) (-511.242) [-513.012] (-513.461) * [-510.000] (-512.191) (-510.833) (-511.891) -- 0:00:13
782500 -- (-512.742) [-511.611] (-515.555) (-509.901) * (-508.670) [-510.545] (-511.072) (-513.736) -- 0:00:13
783000 -- (-510.254) [-508.319] (-512.287) (-510.047) * [-510.042] (-509.003) (-509.222) (-511.864) -- 0:00:13
783500 -- (-510.765) [-508.335] (-510.230) (-513.588) * (-509.275) [-511.834] (-509.236) (-513.082) -- 0:00:13
784000 -- (-509.914) (-510.227) [-512.156] (-512.931) * (-510.593) [-510.515] (-510.594) (-512.109) -- 0:00:13
784500 -- (-509.969) [-509.152] (-509.138) (-508.756) * (-510.991) [-510.711] (-517.446) (-510.265) -- 0:00:13
785000 -- (-512.134) [-508.890] (-512.049) (-509.126) * [-510.460] (-510.165) (-509.974) (-511.145) -- 0:00:13
Average standard deviation of split frequencies: 0.010683
785500 -- [-511.866] (-508.839) (-510.565) (-509.130) * [-509.171] (-511.173) (-509.095) (-508.772) -- 0:00:13
786000 -- [-511.099] (-512.174) (-509.854) (-508.299) * (-517.801) (-510.186) [-508.514] (-510.914) -- 0:00:13
786500 -- [-509.992] (-510.695) (-512.037) (-512.118) * (-511.190) [-508.892] (-509.186) (-512.489) -- 0:00:13
787000 -- (-511.191) (-519.915) [-508.851] (-509.465) * (-509.274) [-511.373] (-509.804) (-512.236) -- 0:00:13
787500 -- (-510.159) (-512.205) (-508.835) [-509.137] * (-511.234) (-510.522) [-510.119] (-512.685) -- 0:00:13
788000 -- [-511.195] (-512.274) (-509.087) (-509.675) * (-512.115) [-508.358] (-509.966) (-511.844) -- 0:00:13
788500 -- (-511.269) (-512.719) (-508.841) [-513.120] * (-512.024) (-508.455) [-509.626] (-510.468) -- 0:00:13
789000 -- (-510.330) (-513.918) [-509.175] (-508.339) * [-514.263] (-512.994) (-510.353) (-510.482) -- 0:00:13
789500 -- (-513.238) [-514.272] (-508.894) (-508.714) * (-510.806) [-508.419] (-514.298) (-509.391) -- 0:00:13
790000 -- (-511.410) [-510.057] (-510.611) (-508.893) * (-508.588) (-508.694) (-511.408) [-509.831] -- 0:00:13
Average standard deviation of split frequencies: 0.010545
790500 -- (-512.372) (-509.477) [-514.219] (-510.067) * [-510.120] (-509.018) (-512.849) (-513.005) -- 0:00:13
791000 -- (-511.782) [-508.729] (-515.493) (-511.360) * (-509.900) [-509.532] (-510.322) (-510.383) -- 0:00:13
791500 -- (-511.464) [-511.742] (-517.465) (-509.293) * (-509.929) (-509.817) (-510.264) [-509.576] -- 0:00:13
792000 -- [-510.803] (-510.843) (-513.298) (-510.618) * (-514.923) (-510.970) [-510.881] (-514.182) -- 0:00:13
792500 -- (-520.338) [-510.010] (-510.475) (-512.414) * (-509.560) [-510.036] (-510.445) (-512.882) -- 0:00:13
793000 -- (-511.507) (-511.497) (-508.567) [-510.021] * (-514.735) [-510.080] (-510.180) (-509.999) -- 0:00:13
793500 -- [-509.663] (-510.307) (-509.497) (-511.329) * (-510.333) (-511.218) (-513.085) [-508.641] -- 0:00:13
794000 -- [-513.692] (-513.804) (-509.668) (-509.133) * [-509.141] (-514.466) (-515.821) (-510.097) -- 0:00:13
794500 -- (-511.565) (-509.125) [-510.243] (-511.794) * (-510.206) [-512.330] (-513.395) (-511.039) -- 0:00:13
795000 -- (-509.223) (-508.238) (-510.911) [-508.680] * [-509.443] (-510.911) (-512.451) (-510.028) -- 0:00:13
Average standard deviation of split frequencies: 0.010290
795500 -- [-509.596] (-511.688) (-511.172) (-512.445) * (-509.051) (-508.964) (-511.098) [-510.654] -- 0:00:13
796000 -- (-510.468) (-513.695) (-510.187) [-509.687] * (-511.465) (-509.360) (-509.724) [-514.360] -- 0:00:13
796500 -- [-509.072] (-516.847) (-509.620) (-508.940) * [-508.678] (-509.906) (-509.999) (-512.305) -- 0:00:13
797000 -- (-509.063) [-510.291] (-508.841) (-511.604) * (-510.431) [-510.709] (-512.054) (-512.196) -- 0:00:12
797500 -- [-508.475] (-508.703) (-511.346) (-512.881) * (-509.823) (-512.874) (-509.610) [-512.957] -- 0:00:12
798000 -- (-511.308) (-510.187) [-510.391] (-508.901) * (-511.115) (-509.288) [-510.787] (-511.005) -- 0:00:12
798500 -- (-509.709) (-512.869) [-510.414] (-510.246) * (-509.703) [-514.604] (-510.009) (-514.542) -- 0:00:12
799000 -- [-509.557] (-513.821) (-509.258) (-509.579) * (-508.761) (-511.482) (-511.186) [-511.526] -- 0:00:12
799500 -- (-508.387) (-510.585) [-509.957] (-510.347) * (-508.863) (-511.412) (-510.639) [-509.671] -- 0:00:12
800000 -- (-516.049) (-511.730) (-511.239) [-511.621] * (-509.020) [-510.618] (-509.807) (-510.820) -- 0:00:12
Average standard deviation of split frequencies: 0.010487
800500 -- (-509.659) (-509.516) [-514.019] (-510.505) * [-509.099] (-509.191) (-509.015) (-509.442) -- 0:00:12
801000 -- (-512.555) (-509.876) (-510.785) [-511.768] * (-512.296) (-510.587) [-510.638] (-512.006) -- 0:00:12
801500 -- (-511.847) [-513.484] (-509.203) (-510.566) * (-509.154) [-509.773] (-510.008) (-510.950) -- 0:00:12
802000 -- (-510.259) [-513.482] (-508.758) (-510.034) * (-508.573) (-509.511) [-509.479] (-511.006) -- 0:00:12
802500 -- (-510.569) (-508.807) (-510.303) [-509.929] * (-511.843) (-510.147) (-508.991) [-509.244] -- 0:00:12
803000 -- (-511.099) (-511.293) (-512.139) [-509.727] * [-512.823] (-511.768) (-510.181) (-509.228) -- 0:00:12
803500 -- (-511.275) (-517.407) (-508.573) [-512.596] * (-510.718) (-511.938) (-511.901) [-510.915] -- 0:00:12
804000 -- [-508.548] (-511.628) (-508.680) (-510.029) * (-510.349) (-512.516) (-511.851) [-510.154] -- 0:00:12
804500 -- (-509.767) (-508.938) (-508.814) [-509.970] * (-517.279) [-511.275] (-514.204) (-510.002) -- 0:00:12
805000 -- [-509.387] (-512.206) (-515.099) (-509.888) * (-513.049) (-514.742) (-509.638) [-510.009] -- 0:00:12
Average standard deviation of split frequencies: 0.010665
805500 -- [-513.065] (-512.509) (-513.669) (-509.339) * (-508.982) [-509.456] (-514.105) (-512.342) -- 0:00:12
806000 -- (-510.759) [-512.188] (-511.189) (-509.673) * (-508.669) [-509.943] (-509.554) (-512.404) -- 0:00:12
806500 -- (-510.790) (-511.818) [-512.085] (-514.624) * (-509.365) [-508.877] (-514.056) (-509.424) -- 0:00:12
807000 -- (-511.953) (-513.083) [-510.793] (-511.102) * (-509.275) (-510.711) [-510.565] (-510.274) -- 0:00:12
807500 -- (-512.168) (-511.161) [-510.583] (-511.468) * (-509.591) (-512.406) (-510.937) [-510.655] -- 0:00:12
808000 -- (-510.614) [-509.454] (-514.527) (-509.474) * (-509.626) (-509.495) [-509.276] (-510.064) -- 0:00:12
808500 -- (-510.735) (-514.425) (-508.688) [-510.635] * [-510.874] (-508.250) (-509.840) (-509.771) -- 0:00:12
809000 -- [-509.381] (-509.810) (-509.912) (-510.608) * (-509.798) (-509.182) (-510.977) [-510.457] -- 0:00:12
809500 -- (-509.742) (-511.098) [-511.845] (-509.754) * [-508.787] (-510.635) (-508.573) (-511.631) -- 0:00:12
810000 -- (-511.247) (-513.097) [-512.998] (-511.289) * (-508.290) (-511.751) [-509.977] (-509.861) -- 0:00:12
Average standard deviation of split frequencies: 0.010501
810500 -- [-509.371] (-511.506) (-510.920) (-512.821) * (-509.001) (-511.562) [-511.154] (-509.081) -- 0:00:12
811000 -- (-510.655) (-510.322) [-510.740] (-513.023) * (-510.777) (-511.537) (-510.499) [-511.058] -- 0:00:12
811500 -- (-511.412) [-509.319] (-514.918) (-511.601) * (-510.482) (-512.355) [-510.508] (-511.945) -- 0:00:12
812000 -- (-512.467) (-511.801) [-510.526] (-509.944) * (-509.942) (-511.604) [-509.818] (-510.671) -- 0:00:12
812500 -- (-517.760) (-511.713) [-511.147] (-512.758) * (-511.042) (-516.109) (-509.857) [-510.495] -- 0:00:12
813000 -- [-510.044] (-509.890) (-509.819) (-512.546) * (-509.449) [-508.453] (-514.600) (-511.936) -- 0:00:11
813500 -- [-511.375] (-511.503) (-513.345) (-510.727) * (-508.970) [-511.089] (-512.735) (-510.558) -- 0:00:11
814000 -- [-512.775] (-510.110) (-511.279) (-511.765) * [-508.968] (-509.213) (-513.568) (-510.607) -- 0:00:11
814500 -- (-511.154) [-512.006] (-512.376) (-511.629) * (-511.355) (-510.787) (-515.898) [-512.031] -- 0:00:11
815000 -- (-509.813) (-515.587) (-512.888) [-510.356] * [-513.833] (-512.434) (-513.569) (-513.592) -- 0:00:11
Average standard deviation of split frequencies: 0.010806
815500 -- (-509.482) [-508.994] (-514.622) (-509.267) * (-512.045) [-511.143] (-511.463) (-510.778) -- 0:00:11
816000 -- (-509.807) (-509.655) [-511.856] (-509.414) * [-511.591] (-512.975) (-510.783) (-509.347) -- 0:00:11
816500 -- [-510.122] (-512.600) (-512.040) (-510.194) * (-510.525) (-510.999) (-515.490) [-511.195] -- 0:00:11
817000 -- (-511.116) [-510.209] (-514.336) (-509.808) * (-508.740) (-511.880) (-509.707) [-508.682] -- 0:00:11
817500 -- [-509.044] (-517.160) (-511.186) (-510.405) * (-510.289) (-515.893) (-509.987) [-509.956] -- 0:00:11
818000 -- (-508.923) (-514.344) [-511.106] (-512.592) * (-511.760) [-512.359] (-512.419) (-511.458) -- 0:00:11
818500 -- [-509.496] (-513.886) (-512.383) (-511.911) * (-509.751) [-517.424] (-509.602) (-509.986) -- 0:00:11
819000 -- [-509.900] (-509.643) (-510.948) (-510.222) * [-510.175] (-516.623) (-510.919) (-513.662) -- 0:00:11
819500 -- (-509.418) [-511.277] (-515.270) (-514.695) * (-510.963) (-512.803) [-516.388] (-510.710) -- 0:00:11
820000 -- (-509.593) (-511.010) (-510.320) [-509.805] * [-510.789] (-508.970) (-515.134) (-512.359) -- 0:00:11
Average standard deviation of split frequencies: 0.010627
820500 -- [-511.524] (-509.908) (-511.236) (-512.338) * [-515.179] (-509.434) (-509.016) (-510.915) -- 0:00:11
821000 -- [-512.310] (-512.198) (-508.809) (-510.783) * (-512.572) (-510.883) [-513.819] (-509.487) -- 0:00:11
821500 -- (-510.810) [-510.493] (-511.236) (-509.557) * (-511.657) [-509.625] (-511.359) (-510.002) -- 0:00:11
822000 -- (-509.605) (-509.983) (-512.074) [-512.523] * (-513.498) [-512.542] (-509.538) (-508.559) -- 0:00:11
822500 -- (-509.221) (-510.347) (-511.199) [-508.873] * (-510.098) [-511.007] (-509.939) (-510.270) -- 0:00:11
823000 -- (-510.297) [-510.616] (-509.653) (-509.566) * [-511.418] (-509.468) (-511.772) (-509.895) -- 0:00:11
823500 -- [-509.012] (-513.709) (-509.339) (-509.813) * (-509.412) (-510.264) [-513.800] (-508.999) -- 0:00:11
824000 -- [-511.568] (-512.927) (-508.962) (-512.347) * (-511.526) (-511.983) (-516.509) [-511.810] -- 0:00:11
824500 -- (-510.398) [-512.053] (-508.936) (-512.611) * (-513.082) (-509.604) [-510.567] (-509.405) -- 0:00:11
825000 -- (-510.369) (-512.205) (-511.782) [-511.770] * (-514.577) (-511.733) (-514.475) [-510.598] -- 0:00:11
Average standard deviation of split frequencies: 0.010487
825500 -- [-512.442] (-517.515) (-510.658) (-509.271) * [-510.323] (-511.031) (-515.031) (-510.828) -- 0:00:11
826000 -- (-513.512) [-509.002] (-511.646) (-515.929) * (-509.875) (-513.646) (-508.679) [-509.246] -- 0:00:11
826500 -- (-513.054) (-508.949) [-511.521] (-511.993) * (-509.711) [-509.605] (-513.600) (-509.165) -- 0:00:11
827000 -- [-510.376] (-513.525) (-510.788) (-512.248) * (-510.832) (-509.721) [-510.848] (-510.023) -- 0:00:11
827500 -- [-511.974] (-511.424) (-510.608) (-514.499) * [-510.527] (-514.721) (-510.401) (-509.473) -- 0:00:11
828000 -- (-513.155) [-511.059] (-510.490) (-512.857) * (-509.161) [-509.715] (-508.944) (-508.811) -- 0:00:11
828500 -- (-512.162) (-509.899) [-509.662] (-511.915) * (-510.401) (-509.160) [-511.134] (-509.148) -- 0:00:10
829000 -- (-513.906) [-511.894] (-509.518) (-508.257) * (-509.820) (-511.619) (-514.920) [-510.453] -- 0:00:10
829500 -- [-509.772] (-508.931) (-509.234) (-508.955) * (-509.340) [-512.969] (-513.404) (-509.374) -- 0:00:10
830000 -- (-509.309) (-512.796) (-514.438) [-511.682] * (-510.290) [-511.464] (-512.104) (-509.363) -- 0:00:10
Average standard deviation of split frequencies: 0.010534
830500 -- (-511.699) (-511.066) [-510.658] (-510.555) * (-511.904) [-511.817] (-512.118) (-508.766) -- 0:00:10
831000 -- (-509.642) [-510.136] (-510.689) (-510.066) * (-509.541) (-510.616) (-511.061) [-509.236] -- 0:00:10
831500 -- [-510.921] (-510.975) (-511.017) (-511.680) * (-511.826) (-511.439) (-509.776) [-510.923] -- 0:00:10
832000 -- (-510.067) [-511.865] (-511.760) (-510.678) * [-510.784] (-509.220) (-509.723) (-510.377) -- 0:00:10
832500 -- (-511.454) (-510.290) (-509.730) [-511.788] * (-510.299) [-509.623] (-512.262) (-509.778) -- 0:00:10
833000 -- (-513.617) (-509.094) (-511.627) [-511.300] * (-510.743) [-511.818] (-511.574) (-509.863) -- 0:00:10
833500 -- (-511.559) (-508.831) [-512.518] (-512.872) * (-511.148) (-513.750) [-510.777] (-512.446) -- 0:00:10
834000 -- (-512.980) (-513.459) (-512.788) [-508.846] * (-509.260) (-510.192) (-510.800) [-511.224] -- 0:00:10
834500 -- [-512.270] (-509.622) (-510.895) (-509.505) * (-510.601) (-511.726) (-509.679) [-510.515] -- 0:00:10
835000 -- (-510.275) (-508.776) [-511.860] (-511.033) * (-512.583) (-510.746) (-508.720) [-509.567] -- 0:00:10
Average standard deviation of split frequencies: 0.010714
835500 -- (-509.256) (-508.860) (-514.789) [-511.766] * [-508.924] (-509.211) (-512.460) (-513.751) -- 0:00:10
836000 -- [-510.874] (-515.286) (-521.012) (-513.147) * [-509.519] (-511.230) (-510.566) (-511.523) -- 0:00:10
836500 -- (-513.677) [-511.126] (-512.062) (-510.126) * [-508.713] (-511.376) (-513.130) (-511.752) -- 0:00:10
837000 -- (-515.332) [-511.686] (-509.088) (-514.398) * (-510.550) (-512.585) (-508.511) [-510.248] -- 0:00:10
837500 -- (-514.033) (-509.569) (-511.577) [-513.859] * (-513.105) (-510.338) (-508.240) [-511.779] -- 0:00:10
838000 -- [-509.315] (-512.016) (-509.969) (-510.456) * (-512.193) [-510.596] (-510.409) (-510.379) -- 0:00:10
838500 -- (-513.140) (-511.771) (-509.081) [-510.777] * (-513.486) [-514.656] (-508.981) (-510.223) -- 0:00:10
839000 -- (-511.632) (-512.558) (-509.576) [-510.396] * (-510.747) (-510.722) [-508.969] (-516.286) -- 0:00:10
839500 -- (-518.377) (-510.258) [-508.527] (-511.597) * (-509.418) [-508.695] (-510.457) (-517.217) -- 0:00:10
840000 -- (-510.994) (-513.680) (-512.449) [-511.594] * [-513.467] (-510.500) (-511.120) (-512.388) -- 0:00:10
Average standard deviation of split frequencies: 0.010619
840500 -- (-512.004) (-509.684) [-510.657] (-513.050) * (-510.429) (-514.731) [-509.941] (-510.360) -- 0:00:10
841000 -- (-511.327) (-509.967) [-512.705] (-509.042) * (-516.593) [-510.081] (-509.483) (-512.316) -- 0:00:10
841500 -- [-517.775] (-513.430) (-510.743) (-509.572) * (-509.735) (-512.382) (-511.898) [-509.884] -- 0:00:10
842000 -- (-512.539) [-512.099] (-510.632) (-508.783) * [-510.193] (-509.847) (-510.350) (-508.632) -- 0:00:10
842500 -- (-515.617) (-511.991) (-511.414) [-509.639] * (-509.584) [-509.241] (-509.486) (-508.705) -- 0:00:10
843000 -- (-513.890) (-513.300) [-508.980] (-511.617) * (-510.847) [-508.630] (-512.303) (-509.851) -- 0:00:10
843500 -- (-510.853) [-508.906] (-512.256) (-513.165) * (-511.192) (-509.763) [-510.907] (-511.309) -- 0:00:10
844000 -- [-513.315] (-510.865) (-509.286) (-513.165) * (-512.821) [-510.037] (-509.324) (-512.774) -- 0:00:09
844500 -- (-512.404) [-511.447] (-510.130) (-510.073) * (-512.290) (-510.451) [-510.021] (-511.413) -- 0:00:09
845000 -- [-510.591] (-513.965) (-511.637) (-508.744) * (-512.393) (-510.675) (-511.824) [-508.978] -- 0:00:09
Average standard deviation of split frequencies: 0.010292
845500 -- (-509.188) [-510.945] (-509.401) (-508.399) * (-512.545) (-508.937) [-511.297] (-509.516) -- 0:00:09
846000 -- (-509.296) [-510.530] (-514.436) (-508.392) * (-511.975) (-512.168) (-510.206) [-512.265] -- 0:00:09
846500 -- [-513.247] (-509.387) (-512.938) (-510.363) * (-510.448) (-509.255) (-508.517) [-509.909] -- 0:00:09
847000 -- (-511.707) (-509.274) (-515.034) [-513.418] * (-512.263) (-511.596) [-509.715] (-509.652) -- 0:00:09
847500 -- [-509.560] (-510.060) (-514.320) (-511.944) * [-510.409] (-511.997) (-511.921) (-511.381) -- 0:00:09
848000 -- (-509.734) [-510.511] (-511.259) (-510.653) * (-510.369) (-511.331) (-513.724) [-509.115] -- 0:00:09
848500 -- (-512.318) (-510.892) (-511.941) [-508.673] * (-509.073) [-513.648] (-509.747) (-509.802) -- 0:00:09
849000 -- (-509.074) (-510.362) (-511.646) [-509.632] * (-514.067) (-510.461) (-512.980) [-510.514] -- 0:00:09
849500 -- (-510.098) [-510.141] (-511.700) (-510.841) * (-515.409) (-509.666) [-511.235] (-510.181) -- 0:00:09
850000 -- (-510.951) (-509.722) (-509.270) [-512.461] * (-520.195) [-510.003] (-508.584) (-510.407) -- 0:00:09
Average standard deviation of split frequencies: 0.010494
850500 -- [-509.282] (-510.213) (-508.870) (-513.787) * [-509.591] (-509.215) (-512.320) (-509.789) -- 0:00:09
851000 -- (-510.368) (-512.008) [-510.694] (-510.176) * (-510.169) (-510.799) (-512.597) [-510.700] -- 0:00:09
851500 -- (-512.721) (-512.760) (-511.669) [-510.044] * (-508.667) (-513.102) (-510.261) [-511.253] -- 0:00:09
852000 -- [-510.293] (-511.679) (-510.211) (-510.144) * (-509.580) (-509.187) (-510.248) [-511.048] -- 0:00:09
852500 -- (-510.856) (-513.587) (-509.166) [-513.050] * (-509.725) (-516.194) (-510.061) [-508.912] -- 0:00:09
853000 -- (-509.327) (-511.081) (-509.176) [-511.151] * (-516.381) (-510.713) [-511.274] (-509.861) -- 0:00:09
853500 -- (-509.761) (-514.322) [-509.182] (-512.138) * (-511.412) (-510.703) (-510.510) [-509.314] -- 0:00:09
854000 -- [-511.974] (-514.450) (-513.850) (-510.021) * (-512.612) (-510.288) (-512.328) [-509.788] -- 0:00:09
854500 -- [-509.433] (-509.540) (-510.841) (-510.514) * (-509.890) (-508.976) [-511.214] (-509.947) -- 0:00:09
855000 -- (-510.260) (-510.234) (-510.452) [-510.328] * (-510.814) (-510.483) [-510.402] (-511.299) -- 0:00:09
Average standard deviation of split frequencies: 0.010050
855500 -- (-508.793) (-509.687) [-509.496] (-509.694) * [-508.727] (-509.825) (-512.766) (-512.676) -- 0:00:09
856000 -- (-512.291) [-509.349] (-512.021) (-509.153) * [-510.705] (-510.635) (-512.133) (-511.566) -- 0:00:09
856500 -- [-509.781] (-509.410) (-510.951) (-513.396) * (-509.926) (-510.079) (-509.636) [-512.854] -- 0:00:09
857000 -- (-509.580) [-508.960] (-515.248) (-509.193) * (-514.034) (-510.018) (-510.434) [-513.038] -- 0:00:09
857500 -- (-511.621) (-511.971) [-509.919] (-510.437) * (-511.647) (-509.406) [-511.027] (-510.150) -- 0:00:09
858000 -- [-511.731] (-509.719) (-510.980) (-510.006) * [-510.548] (-508.658) (-510.839) (-511.002) -- 0:00:09
858500 -- (-509.473) [-510.375] (-509.531) (-509.536) * [-510.833] (-510.678) (-510.515) (-511.422) -- 0:00:09
859000 -- (-508.727) [-510.411] (-509.936) (-509.010) * (-509.119) (-509.710) [-513.021] (-509.859) -- 0:00:09
859500 -- [-509.969] (-510.602) (-510.311) (-509.621) * (-509.676) [-509.714] (-511.558) (-510.193) -- 0:00:08
860000 -- (-511.194) [-508.975] (-511.765) (-511.082) * (-510.283) (-511.190) [-509.058] (-509.285) -- 0:00:08
Average standard deviation of split frequencies: 0.009996
860500 -- (-511.992) [-509.638] (-510.781) (-515.120) * [-508.640] (-508.665) (-508.487) (-510.863) -- 0:00:08
861000 -- [-510.678] (-509.063) (-509.665) (-514.217) * [-508.681] (-509.122) (-510.626) (-512.651) -- 0:00:08
861500 -- (-512.465) [-508.884] (-511.638) (-512.230) * [-509.259] (-513.615) (-509.213) (-509.395) -- 0:00:08
862000 -- (-514.645) (-511.187) [-510.596] (-509.879) * (-511.181) (-510.407) (-508.984) [-513.572] -- 0:00:08
862500 -- (-513.330) (-511.504) [-510.142] (-509.392) * [-511.260] (-510.222) (-510.199) (-511.591) -- 0:00:08
863000 -- [-512.971] (-510.927) (-517.592) (-510.892) * (-508.820) (-511.337) (-511.727) [-509.810] -- 0:00:08
863500 -- (-512.826) (-511.091) [-508.988] (-511.244) * [-511.010] (-509.677) (-512.143) (-510.380) -- 0:00:08
864000 -- [-511.135] (-509.117) (-510.239) (-512.530) * (-508.868) (-509.748) [-510.263] (-509.834) -- 0:00:08
864500 -- (-510.030) (-510.207) [-510.181] (-509.840) * (-511.381) [-510.193] (-510.259) (-510.720) -- 0:00:08
865000 -- (-510.302) [-512.364] (-508.294) (-510.523) * (-510.527) (-511.216) (-509.501) [-512.281] -- 0:00:08
Average standard deviation of split frequencies: 0.010054
865500 -- (-509.536) [-511.306] (-512.207) (-509.701) * [-510.332] (-517.609) (-509.321) (-511.434) -- 0:00:08
866000 -- (-510.418) (-511.272) (-508.992) [-510.851] * (-511.162) [-509.634] (-512.473) (-510.314) -- 0:00:08
866500 -- (-508.764) (-513.190) [-512.934] (-510.803) * [-508.761] (-509.862) (-509.570) (-509.307) -- 0:00:08
867000 -- [-511.065] (-509.428) (-510.417) (-510.932) * (-511.404) (-508.998) (-510.303) [-512.498] -- 0:00:08
867500 -- (-510.745) [-508.888] (-509.849) (-509.177) * (-516.382) (-509.867) [-509.116] (-510.062) -- 0:00:08
868000 -- [-509.827] (-511.955) (-510.093) (-520.822) * [-510.083] (-510.555) (-509.509) (-510.568) -- 0:00:08
868500 -- (-516.970) (-511.763) [-510.185] (-514.090) * (-509.906) (-511.996) [-509.553] (-511.216) -- 0:00:08
869000 -- (-510.306) (-511.423) [-511.506] (-512.218) * (-510.342) (-510.775) (-509.384) [-511.072] -- 0:00:08
869500 -- (-509.756) [-510.766] (-509.830) (-512.508) * (-512.190) (-512.935) [-508.870] (-510.016) -- 0:00:08
870000 -- (-513.119) (-509.521) (-509.022) [-510.485] * (-511.935) (-511.015) [-508.826] (-511.693) -- 0:00:08
Average standard deviation of split frequencies: 0.009373
870500 -- [-508.564] (-513.372) (-510.980) (-509.316) * (-508.875) [-511.089] (-511.486) (-512.688) -- 0:00:08
871000 -- (-512.034) (-512.738) (-510.114) [-514.323] * (-513.527) [-508.740] (-510.006) (-509.486) -- 0:00:08
871500 -- (-510.574) (-509.196) (-511.411) [-510.855] * (-510.954) [-509.521] (-513.310) (-509.388) -- 0:00:08
872000 -- (-509.972) [-511.102] (-510.682) (-509.845) * (-510.851) (-508.713) [-508.963] (-510.429) -- 0:00:08
872500 -- (-508.947) (-511.214) [-508.755] (-509.603) * (-508.982) (-509.494) [-510.178] (-508.307) -- 0:00:08
873000 -- (-512.939) [-509.964] (-509.651) (-509.713) * (-513.992) [-509.506] (-509.513) (-508.445) -- 0:00:08
873500 -- (-509.181) (-510.359) [-511.022] (-508.537) * (-514.968) [-510.842] (-508.906) (-509.721) -- 0:00:08
874000 -- (-516.536) (-511.515) (-513.036) [-511.380] * (-515.055) (-511.254) [-509.122] (-509.759) -- 0:00:08
874500 -- (-514.688) [-511.030] (-513.017) (-510.273) * [-509.640] (-509.755) (-510.546) (-509.927) -- 0:00:08
875000 -- (-508.764) [-509.659] (-513.697) (-510.091) * (-508.934) (-510.237) (-510.389) [-510.976] -- 0:00:08
Average standard deviation of split frequencies: 0.009485
875500 -- (-509.238) (-513.032) (-515.272) [-510.822] * (-510.181) [-510.030] (-511.102) (-510.394) -- 0:00:07
876000 -- [-509.768] (-510.018) (-509.863) (-508.992) * (-511.519) (-509.249) [-511.088] (-511.058) -- 0:00:07
876500 -- (-511.431) [-509.643] (-510.590) (-509.155) * (-512.974) (-511.015) [-509.891] (-515.280) -- 0:00:07
877000 -- (-511.496) (-512.462) [-512.236] (-512.127) * (-509.456) (-512.861) [-510.020] (-513.165) -- 0:00:07
877500 -- (-509.781) (-519.145) (-511.078) [-512.891] * (-509.630) (-513.687) (-512.539) [-509.447] -- 0:00:07
878000 -- [-509.750] (-509.810) (-513.286) (-510.417) * (-515.208) (-510.776) [-510.373] (-509.507) -- 0:00:07
878500 -- (-510.873) [-508.852] (-513.745) (-509.253) * (-509.768) [-510.735] (-510.571) (-508.735) -- 0:00:07
879000 -- (-515.234) [-510.320] (-512.848) (-510.366) * (-515.324) [-510.816] (-510.552) (-510.897) -- 0:00:07
879500 -- [-509.658] (-512.236) (-514.450) (-511.563) * (-511.045) (-511.880) [-509.620] (-510.715) -- 0:00:07
880000 -- [-510.566] (-509.883) (-512.747) (-512.777) * (-510.624) [-510.922] (-510.217) (-509.563) -- 0:00:07
Average standard deviation of split frequencies: 0.009167
880500 -- (-509.982) [-508.821] (-511.852) (-510.184) * (-510.014) (-509.701) (-511.846) [-511.972] -- 0:00:07
881000 -- (-509.687) [-514.216] (-510.037) (-512.040) * [-509.296] (-513.626) (-509.427) (-511.056) -- 0:00:07
881500 -- (-510.001) [-510.622] (-510.586) (-511.930) * (-511.069) [-509.400] (-509.585) (-509.026) -- 0:00:07
882000 -- (-508.863) (-511.086) (-511.993) [-510.764] * (-509.789) (-515.147) [-510.417] (-512.392) -- 0:00:07
882500 -- (-509.104) [-510.849] (-513.152) (-511.612) * (-509.362) (-510.074) [-511.036] (-508.874) -- 0:00:07
883000 -- (-510.294) [-511.735] (-513.130) (-509.653) * (-511.611) (-508.917) (-515.002) [-510.498] -- 0:00:07
883500 -- (-509.221) (-508.790) [-510.227] (-510.374) * (-511.639) [-510.323] (-515.967) (-509.520) -- 0:00:07
884000 -- (-509.243) (-515.848) [-510.749] (-511.509) * (-511.513) (-510.589) [-509.378] (-510.408) -- 0:00:07
884500 -- [-509.235] (-511.998) (-510.257) (-510.537) * (-509.614) (-510.836) [-508.950] (-511.431) -- 0:00:07
885000 -- (-516.393) (-508.958) (-511.279) [-510.581] * (-513.599) (-509.997) (-510.914) [-512.800] -- 0:00:07
Average standard deviation of split frequencies: 0.008979
885500 -- [-509.339] (-509.076) (-513.829) (-510.431) * [-509.253] (-509.319) (-509.322) (-513.061) -- 0:00:07
886000 -- (-509.862) [-511.491] (-508.828) (-513.350) * (-515.688) [-512.727] (-511.510) (-515.306) -- 0:00:07
886500 -- (-515.826) (-509.912) (-511.593) [-516.088] * (-510.461) (-512.402) (-508.530) [-512.672] -- 0:00:07
887000 -- (-510.556) (-511.703) [-509.489] (-510.858) * [-511.138] (-515.399) (-509.620) (-512.724) -- 0:00:07
887500 -- (-515.955) (-511.524) [-511.864] (-514.485) * (-510.684) (-510.397) [-514.181] (-511.403) -- 0:00:07
888000 -- (-511.482) (-509.984) (-510.470) [-514.531] * (-509.294) (-511.445) [-509.110] (-512.005) -- 0:00:07
888500 -- (-509.082) (-508.507) (-511.135) [-511.065] * (-511.464) [-509.718] (-508.275) (-517.222) -- 0:00:07
889000 -- (-511.781) (-511.255) [-510.316] (-510.594) * (-512.722) (-509.527) (-508.268) [-508.809] -- 0:00:07
889500 -- (-509.923) (-511.683) [-512.142] (-515.777) * (-509.851) [-509.188] (-509.708) (-511.184) -- 0:00:07
890000 -- (-513.251) (-510.859) [-509.747] (-518.427) * [-515.310] (-508.875) (-512.809) (-515.735) -- 0:00:07
Average standard deviation of split frequencies: 0.008998
890500 -- (-511.438) [-511.706] (-514.223) (-511.046) * (-512.458) [-511.754] (-509.278) (-511.969) -- 0:00:07
891000 -- (-511.186) (-512.636) [-509.062] (-510.695) * (-510.343) (-510.590) (-509.832) [-509.622] -- 0:00:06
891500 -- (-513.088) [-512.602] (-510.001) (-510.051) * [-509.547] (-511.811) (-511.314) (-510.362) -- 0:00:06
892000 -- (-513.821) (-512.691) (-509.856) [-511.026] * [-509.482] (-511.044) (-511.909) (-510.480) -- 0:00:06
892500 -- (-512.348) [-511.678] (-513.452) (-512.844) * (-509.335) (-510.559) [-509.116] (-509.574) -- 0:00:06
893000 -- (-511.820) (-512.071) [-511.418] (-510.899) * (-510.843) [-510.050] (-509.678) (-513.845) -- 0:00:06
893500 -- (-511.757) [-514.214] (-510.596) (-508.804) * [-511.101] (-509.507) (-509.588) (-509.232) -- 0:00:06
894000 -- (-512.729) (-511.761) (-511.005) [-508.888] * (-510.122) [-514.805] (-511.053) (-508.843) -- 0:00:06
894500 -- (-508.500) [-508.889] (-509.031) (-509.430) * (-510.754) [-509.672] (-510.376) (-510.550) -- 0:00:06
895000 -- [-510.451] (-513.880) (-509.341) (-511.851) * (-510.524) (-511.451) [-509.067] (-509.910) -- 0:00:06
Average standard deviation of split frequencies: 0.008911
895500 -- (-510.354) (-509.732) (-511.338) [-510.076] * (-510.968) (-509.791) (-509.886) [-508.598] -- 0:00:06
896000 -- (-509.425) [-508.465] (-509.412) (-508.769) * (-509.010) (-509.839) (-513.738) [-510.766] -- 0:00:06
896500 -- [-508.844] (-511.114) (-511.825) (-511.767) * (-514.818) (-510.540) (-517.227) [-513.322] -- 0:00:06
897000 -- (-509.521) (-510.841) [-510.183] (-512.036) * (-511.028) [-512.758] (-518.520) (-510.692) -- 0:00:06
897500 -- (-509.556) [-511.892] (-511.207) (-509.241) * [-511.162] (-509.097) (-512.036) (-511.859) -- 0:00:06
898000 -- (-509.102) (-510.342) (-511.991) [-509.246] * (-512.341) [-514.941] (-514.427) (-510.795) -- 0:00:06
898500 -- (-513.695) [-512.486] (-512.094) (-513.518) * (-512.754) [-509.647] (-510.640) (-510.491) -- 0:00:06
899000 -- (-513.004) (-513.038) (-510.558) [-509.046] * (-510.429) [-509.495] (-511.466) (-510.168) -- 0:00:06
899500 -- (-509.725) [-513.017] (-512.099) (-513.360) * (-512.040) (-510.319) [-511.148] (-510.599) -- 0:00:06
900000 -- (-508.667) (-512.002) (-512.208) [-513.197] * (-513.138) [-509.710] (-509.638) (-515.633) -- 0:00:06
Average standard deviation of split frequencies: 0.009094
900500 -- (-509.160) (-510.996) [-509.441] (-510.703) * [-511.081] (-514.185) (-510.109) (-510.809) -- 0:00:06
901000 -- (-510.853) (-511.410) (-510.447) [-510.538] * [-508.383] (-510.872) (-511.485) (-512.103) -- 0:00:06
901500 -- (-509.356) (-511.409) [-512.197] (-515.294) * (-511.241) (-512.127) (-510.636) [-510.278] -- 0:00:06
902000 -- [-510.163] (-511.111) (-510.486) (-516.943) * (-509.425) (-511.006) [-515.494] (-510.788) -- 0:00:06
902500 -- [-510.025] (-513.318) (-510.281) (-510.326) * (-510.517) (-509.401) [-512.174] (-512.353) -- 0:00:06
903000 -- [-509.633] (-510.972) (-510.338) (-513.899) * [-509.827] (-509.952) (-509.006) (-508.994) -- 0:00:06
903500 -- [-510.989] (-511.744) (-509.989) (-513.594) * (-510.929) [-509.470] (-511.363) (-509.016) -- 0:00:06
904000 -- (-515.058) [-512.740] (-510.096) (-512.916) * [-510.524] (-508.799) (-510.241) (-509.357) -- 0:00:06
904500 -- (-510.638) (-512.606) [-509.110] (-510.408) * (-509.154) (-511.912) (-512.748) [-510.425] -- 0:00:06
905000 -- (-513.160) (-512.405) [-510.966] (-510.082) * [-509.712] (-513.230) (-510.466) (-513.076) -- 0:00:06
Average standard deviation of split frequencies: 0.008585
905500 -- (-518.525) (-509.267) (-510.039) [-509.821] * [-508.863] (-515.344) (-511.035) (-509.175) -- 0:00:06
906000 -- [-510.096] (-509.851) (-510.559) (-509.299) * (-509.658) [-513.108] (-510.451) (-510.132) -- 0:00:06
906500 -- (-509.202) (-514.369) [-510.667] (-509.553) * [-510.049] (-508.308) (-511.043) (-509.071) -- 0:00:05
907000 -- (-509.580) (-515.178) (-510.722) [-509.229] * [-509.341] (-508.406) (-512.180) (-510.506) -- 0:00:05
907500 -- (-509.449) (-513.944) [-509.065] (-511.974) * (-511.403) (-509.143) [-509.820] (-511.749) -- 0:00:05
908000 -- (-508.864) [-510.938] (-509.573) (-508.972) * (-509.868) [-508.340] (-510.119) (-509.327) -- 0:00:05
908500 -- [-514.634] (-510.865) (-510.541) (-512.135) * (-510.732) (-508.340) [-508.850] (-510.179) -- 0:00:05
909000 -- (-510.948) (-510.398) (-509.849) [-511.787] * (-511.546) (-511.229) [-509.093] (-510.366) -- 0:00:05
909500 -- (-510.035) [-511.880] (-510.799) (-510.245) * (-511.378) (-510.647) (-510.088) [-509.656] -- 0:00:05
910000 -- (-510.994) (-513.219) (-510.853) [-509.027] * (-511.951) (-508.688) [-512.597] (-508.735) -- 0:00:05
Average standard deviation of split frequencies: 0.008218
910500 -- (-514.829) (-510.622) [-509.976] (-515.598) * (-514.309) [-512.321] (-509.253) (-508.813) -- 0:00:05
911000 -- (-512.797) (-511.814) [-509.618] (-513.808) * (-510.993) [-510.187] (-514.643) (-510.183) -- 0:00:05
911500 -- (-509.820) (-510.496) (-510.513) [-508.789] * [-510.444] (-509.681) (-509.741) (-511.413) -- 0:00:05
912000 -- (-512.633) [-510.564] (-513.442) (-509.357) * (-509.625) (-512.398) [-509.567] (-512.533) -- 0:00:05
912500 -- (-512.201) (-508.852) (-512.793) [-510.052] * (-509.637) [-515.362] (-510.331) (-508.208) -- 0:00:05
913000 -- [-518.357] (-511.469) (-510.012) (-510.822) * (-520.139) (-514.741) (-513.598) [-509.746] -- 0:00:05
913500 -- (-513.197) (-508.983) [-509.635] (-509.446) * [-515.032] (-513.998) (-515.281) (-510.003) -- 0:00:05
914000 -- (-509.494) [-510.433] (-511.165) (-511.047) * (-509.549) [-511.206] (-512.745) (-509.131) -- 0:00:05
914500 -- (-513.106) (-512.472) [-510.140] (-511.398) * (-513.104) (-511.485) (-510.478) [-508.764] -- 0:00:05
915000 -- (-512.839) [-510.398] (-510.388) (-513.184) * (-511.734) (-510.858) (-511.035) [-514.855] -- 0:00:05
Average standard deviation of split frequencies: 0.008041
915500 -- (-509.117) (-510.298) [-510.971] (-509.154) * (-510.658) [-511.685] (-513.347) (-513.609) -- 0:00:05
916000 -- (-515.636) (-509.916) (-510.134) [-508.442] * (-509.505) [-510.805] (-510.179) (-513.300) -- 0:00:05
916500 -- [-510.588] (-511.079) (-509.269) (-510.804) * (-511.849) [-510.249] (-514.116) (-510.018) -- 0:00:05
917000 -- [-509.220] (-511.300) (-509.635) (-515.800) * (-510.456) (-512.244) [-510.828] (-508.428) -- 0:00:05
917500 -- [-512.029] (-509.755) (-510.372) (-510.580) * (-510.602) [-509.307] (-510.486) (-511.423) -- 0:00:05
918000 -- (-512.946) [-512.358] (-513.070) (-511.387) * (-515.029) (-510.047) (-510.245) [-509.653] -- 0:00:05
918500 -- (-512.663) (-511.316) (-513.299) [-508.643] * [-509.453] (-509.248) (-515.459) (-508.774) -- 0:00:05
919000 -- (-511.335) (-510.831) [-509.319] (-509.159) * (-516.104) (-509.726) (-510.520) [-510.387] -- 0:00:05
919500 -- (-510.942) (-513.003) (-513.289) [-508.671] * (-509.654) (-509.942) (-512.369) [-508.311] -- 0:00:05
920000 -- [-510.289] (-509.807) (-513.940) (-511.147) * (-509.631) (-515.313) [-511.208] (-509.508) -- 0:00:05
Average standard deviation of split frequencies: 0.008224
920500 -- (-514.394) (-515.401) (-511.247) [-509.500] * [-511.720] (-511.378) (-511.440) (-509.004) -- 0:00:05
921000 -- (-511.073) (-508.291) (-509.034) [-509.226] * (-511.283) (-511.089) [-510.311] (-510.734) -- 0:00:05
921500 -- (-510.942) (-509.469) (-511.068) [-509.376] * [-512.032] (-511.079) (-509.112) (-511.482) -- 0:00:05
922000 -- (-514.725) [-510.286] (-511.689) (-511.003) * (-512.666) (-512.830) [-511.006] (-513.130) -- 0:00:04
922500 -- (-511.076) (-515.114) (-511.597) [-510.183] * (-512.356) (-513.939) [-508.777] (-514.614) -- 0:00:04
923000 -- (-509.407) [-510.518] (-510.499) (-511.095) * (-511.815) (-512.882) [-510.288] (-511.028) -- 0:00:04
923500 -- (-510.446) (-512.164) [-509.355] (-508.691) * (-510.628) (-512.531) (-511.054) [-509.254] -- 0:00:04
924000 -- (-509.549) [-510.496] (-509.906) (-508.520) * (-508.392) [-510.205] (-514.520) (-510.025) -- 0:00:04
924500 -- [-509.492] (-509.173) (-510.566) (-511.229) * (-510.528) [-511.655] (-510.589) (-513.017) -- 0:00:04
925000 -- (-512.040) (-513.921) (-509.632) [-509.267] * (-508.496) (-511.674) (-512.576) [-510.468] -- 0:00:04
Average standard deviation of split frequencies: 0.008241
925500 -- (-512.191) (-510.465) [-509.556] (-510.792) * (-508.351) (-511.320) [-511.502] (-509.748) -- 0:00:04
926000 -- (-511.994) (-515.941) [-511.252] (-514.165) * [-509.216] (-509.674) (-511.228) (-510.611) -- 0:00:04
926500 -- (-509.950) (-512.177) (-511.174) [-509.177] * (-511.744) [-511.944] (-514.195) (-511.248) -- 0:00:04
927000 -- (-509.758) (-511.735) (-510.828) [-509.215] * (-514.201) (-511.971) [-509.805] (-512.783) -- 0:00:04
927500 -- (-510.839) (-509.109) (-513.690) [-509.899] * [-509.624] (-509.648) (-509.559) (-510.033) -- 0:00:04
928000 -- [-511.734] (-512.377) (-511.422) (-511.109) * (-512.398) (-510.413) (-509.885) [-511.500] -- 0:00:04
928500 -- (-515.949) [-511.203] (-515.580) (-509.733) * (-514.291) (-508.592) (-509.266) [-510.444] -- 0:00:04
929000 -- [-508.532] (-510.406) (-508.894) (-510.725) * [-511.649] (-509.554) (-510.666) (-511.218) -- 0:00:04
929500 -- [-510.232] (-511.097) (-513.397) (-510.725) * (-514.932) (-509.143) (-510.079) [-509.723] -- 0:00:04
930000 -- (-514.225) [-510.332] (-511.368) (-509.004) * (-512.503) (-510.449) (-508.931) [-508.303] -- 0:00:04
Average standard deviation of split frequencies: 0.008421
930500 -- (-512.987) [-510.558] (-510.151) (-514.377) * (-508.957) (-513.388) [-511.056] (-510.983) -- 0:00:04
931000 -- (-511.549) [-512.023] (-510.315) (-509.533) * (-510.005) [-509.293] (-509.710) (-510.377) -- 0:00:04
931500 -- (-512.432) [-510.325] (-509.703) (-512.798) * [-512.759] (-509.709) (-510.527) (-509.869) -- 0:00:04
932000 -- (-514.645) (-511.469) (-508.933) [-510.964] * (-510.916) (-516.738) (-515.529) [-512.970] -- 0:00:04
932500 -- (-514.725) (-512.830) (-511.138) [-510.465] * [-510.764] (-512.147) (-520.225) (-512.062) -- 0:00:04
933000 -- [-512.851] (-510.618) (-512.602) (-509.855) * (-508.809) (-510.152) (-514.663) [-510.522] -- 0:00:04
933500 -- [-514.474] (-513.197) (-511.785) (-512.602) * (-509.796) (-508.545) [-510.681] (-511.227) -- 0:00:04
934000 -- [-514.534] (-510.899) (-510.586) (-510.470) * (-515.437) [-508.981] (-510.442) (-510.579) -- 0:00:04
934500 -- [-516.946] (-512.875) (-511.996) (-511.247) * (-511.275) (-509.504) [-511.505] (-511.818) -- 0:00:04
935000 -- (-512.358) (-514.133) (-509.079) [-510.563] * [-512.402] (-511.860) (-510.291) (-510.012) -- 0:00:04
Average standard deviation of split frequencies: 0.008310
935500 -- (-513.395) (-514.416) [-508.700] (-509.525) * (-512.316) [-512.042] (-510.806) (-512.108) -- 0:00:04
936000 -- (-511.809) (-509.789) [-508.757] (-509.729) * (-510.967) [-509.927] (-509.082) (-511.232) -- 0:00:04
936500 -- (-509.148) [-508.769] (-510.303) (-511.786) * (-511.998) (-509.132) (-508.399) [-511.823] -- 0:00:04
937000 -- (-509.007) (-509.032) (-511.537) [-512.147] * (-511.339) (-511.122) (-508.704) [-509.958] -- 0:00:04
937500 -- (-510.813) (-508.482) [-509.207] (-510.651) * (-515.107) (-509.771) (-512.732) [-508.938] -- 0:00:04
938000 -- (-510.862) [-509.183] (-515.479) (-514.453) * [-512.871] (-510.053) (-513.508) (-509.522) -- 0:00:03
938500 -- (-510.552) (-511.676) (-512.491) [-511.623] * (-509.679) (-510.757) (-510.369) [-510.201] -- 0:00:03
939000 -- [-511.601] (-510.296) (-514.454) (-510.629) * (-510.307) [-511.960] (-510.929) (-510.091) -- 0:00:03
939500 -- (-512.475) (-508.860) (-520.849) [-509.695] * (-509.841) (-511.484) [-513.576] (-509.878) -- 0:00:03
940000 -- [-510.189] (-512.260) (-510.065) (-510.965) * (-509.599) [-509.383] (-512.480) (-513.769) -- 0:00:03
Average standard deviation of split frequencies: 0.008300
940500 -- [-509.818] (-511.913) (-508.567) (-509.004) * (-511.451) (-512.966) [-510.543] (-512.648) -- 0:00:03
941000 -- (-512.243) (-513.485) (-511.245) [-510.295] * (-510.264) (-510.626) [-509.458] (-510.099) -- 0:00:03
941500 -- (-511.338) [-510.674] (-513.729) (-510.024) * (-514.078) (-509.279) [-509.556] (-511.004) -- 0:00:03
942000 -- (-510.722) [-509.748] (-512.577) (-509.719) * [-510.484] (-511.098) (-509.138) (-513.828) -- 0:00:03
942500 -- (-510.047) [-510.985] (-513.415) (-510.400) * (-512.352) (-511.579) [-510.433] (-509.371) -- 0:00:03
943000 -- (-514.695) [-510.577] (-510.566) (-511.165) * (-512.790) (-512.254) [-512.909] (-511.525) -- 0:00:03
943500 -- [-515.044] (-510.858) (-511.971) (-510.612) * (-512.548) [-513.782] (-510.039) (-515.555) -- 0:00:03
944000 -- (-511.302) (-510.324) [-509.887] (-511.013) * (-512.567) (-508.814) [-510.033] (-512.525) -- 0:00:03
944500 -- (-508.832) (-510.898) (-509.651) [-513.014] * (-508.386) (-508.905) [-509.639] (-511.490) -- 0:00:03
945000 -- (-513.842) (-510.569) (-517.168) [-510.541] * (-510.612) (-508.330) [-510.706] (-510.524) -- 0:00:03
Average standard deviation of split frequencies: 0.008149
945500 -- (-510.223) [-509.493] (-513.217) (-512.906) * (-513.280) (-514.346) (-509.919) [-508.877] -- 0:00:03
946000 -- [-509.153] (-509.513) (-512.800) (-508.630) * (-512.092) (-513.999) [-508.804] (-508.925) -- 0:00:03
946500 -- (-510.086) (-513.038) [-510.013] (-513.987) * [-510.824] (-511.689) (-510.091) (-513.239) -- 0:00:03
947000 -- (-514.991) (-509.588) [-510.122] (-509.697) * (-511.124) [-509.087] (-512.165) (-508.843) -- 0:00:03
947500 -- [-511.029] (-512.629) (-508.705) (-510.408) * (-511.792) [-512.099] (-510.324) (-510.605) -- 0:00:03
948000 -- (-510.922) (-520.787) [-509.989] (-509.413) * (-510.078) (-510.100) [-511.539] (-511.677) -- 0:00:03
948500 -- [-511.929] (-516.966) (-511.599) (-509.383) * (-514.708) [-509.601] (-509.866) (-512.111) -- 0:00:03
949000 -- [-509.775] (-513.153) (-512.467) (-509.239) * (-509.762) (-511.487) [-511.358] (-512.931) -- 0:00:03
949500 -- [-509.990] (-510.211) (-514.750) (-510.237) * (-509.348) (-509.877) [-510.255] (-510.837) -- 0:00:03
950000 -- (-510.164) (-510.298) [-511.864] (-508.760) * [-508.620] (-510.179) (-511.497) (-510.106) -- 0:00:03
Average standard deviation of split frequencies: 0.007992
950500 -- (-508.760) (-510.726) (-510.983) [-509.472] * (-510.639) [-512.332] (-512.850) (-511.444) -- 0:00:03
951000 -- (-510.572) [-510.341] (-510.521) (-511.437) * [-510.073] (-511.310) (-512.115) (-511.300) -- 0:00:03
951500 -- (-511.594) (-509.927) (-508.909) [-512.511] * (-510.544) (-513.087) [-510.721] (-510.264) -- 0:00:03
952000 -- [-509.159] (-512.252) (-509.794) (-512.124) * [-509.794] (-512.839) (-512.836) (-511.400) -- 0:00:03
952500 -- (-510.280) [-510.646] (-511.479) (-509.971) * (-512.575) [-510.847] (-514.126) (-509.256) -- 0:00:02
953000 -- (-511.713) (-512.490) (-511.241) [-509.732] * [-512.930] (-509.957) (-511.820) (-509.266) -- 0:00:02
953500 -- (-509.324) [-510.276] (-509.734) (-509.415) * (-514.251) [-509.595] (-511.789) (-510.607) -- 0:00:02
954000 -- [-511.214] (-510.846) (-513.114) (-508.710) * [-511.969] (-508.755) (-512.426) (-508.513) -- 0:00:02
954500 -- (-509.868) (-508.734) [-510.255] (-511.255) * [-509.699] (-509.552) (-511.701) (-510.596) -- 0:00:02
955000 -- (-509.996) [-509.490] (-511.047) (-512.318) * (-512.106) (-511.282) [-509.293] (-512.264) -- 0:00:02
Average standard deviation of split frequencies: 0.007890
955500 -- (-513.871) [-511.848] (-513.641) (-511.246) * (-511.214) (-512.190) (-513.043) [-508.350] -- 0:00:02
956000 -- [-511.839] (-509.731) (-511.966) (-510.914) * (-510.189) (-509.507) (-512.582) [-509.169] -- 0:00:02
956500 -- (-515.152) (-510.140) [-510.463] (-510.757) * (-508.867) (-511.106) [-515.654] (-508.312) -- 0:00:02
957000 -- (-510.795) (-510.804) [-508.944] (-509.854) * (-511.445) (-509.561) (-509.738) [-509.831] -- 0:00:02
957500 -- [-508.858] (-511.802) (-509.288) (-509.290) * (-515.562) (-509.474) [-511.954] (-510.787) -- 0:00:02
958000 -- (-511.279) [-510.595] (-509.324) (-509.250) * [-511.754] (-512.514) (-511.033) (-511.521) -- 0:00:02
958500 -- [-509.704] (-509.492) (-510.503) (-508.495) * (-509.986) [-513.386] (-512.412) (-514.839) -- 0:00:02
959000 -- (-508.791) [-510.743] (-509.743) (-510.485) * [-509.105] (-510.537) (-512.340) (-512.006) -- 0:00:02
959500 -- (-508.864) [-508.424] (-510.142) (-509.580) * [-509.642] (-513.155) (-510.529) (-511.447) -- 0:00:02
960000 -- (-510.788) (-512.300) (-509.786) [-509.429] * [-509.117] (-515.557) (-511.073) (-509.340) -- 0:00:02
Average standard deviation of split frequencies: 0.007967
960500 -- (-512.375) (-511.014) [-508.993] (-510.827) * (-511.162) [-511.144] (-509.341) (-511.614) -- 0:00:02
961000 -- [-509.333] (-509.666) (-513.856) (-511.383) * (-509.758) (-511.041) [-509.269] (-511.423) -- 0:00:02
961500 -- (-510.764) (-508.241) (-512.001) [-509.965] * (-511.584) (-510.754) (-511.739) [-510.447] -- 0:00:02
962000 -- (-510.137) [-511.394] (-510.218) (-511.953) * (-512.351) (-512.761) (-509.519) [-512.622] -- 0:00:02
962500 -- (-510.557) (-509.065) (-519.241) [-509.818] * (-512.652) (-510.744) [-508.818] (-512.819) -- 0:00:02
963000 -- [-510.711] (-511.830) (-509.084) (-514.690) * (-510.663) (-513.750) [-513.010] (-510.375) -- 0:00:02
963500 -- (-512.147) (-508.893) (-509.959) [-512.205] * (-509.936) (-515.474) [-508.248] (-511.514) -- 0:00:02
964000 -- (-512.172) (-508.693) [-511.939] (-513.125) * (-511.349) (-511.366) [-508.432] (-508.540) -- 0:00:02
964500 -- (-511.071) (-512.384) [-510.967] (-512.356) * [-509.394] (-509.690) (-510.508) (-511.365) -- 0:00:02
965000 -- (-511.134) (-510.447) (-511.327) [-509.626] * [-508.935] (-509.331) (-511.235) (-513.743) -- 0:00:02
Average standard deviation of split frequencies: 0.007865
965500 -- (-508.974) (-514.104) (-509.439) [-510.717] * (-511.112) (-511.921) [-510.427] (-512.249) -- 0:00:02
966000 -- (-512.475) (-512.755) (-510.042) [-512.189] * [-510.546] (-514.617) (-509.943) (-513.113) -- 0:00:02
966500 -- (-511.876) [-509.712] (-509.353) (-510.670) * [-514.981] (-513.402) (-509.939) (-511.136) -- 0:00:02
967000 -- [-508.826] (-509.448) (-511.424) (-509.577) * (-510.661) (-511.770) [-510.432] (-508.817) -- 0:00:02
967500 -- (-508.795) (-510.430) (-515.300) [-510.808] * (-512.282) [-511.046] (-513.527) (-511.252) -- 0:00:02
968000 -- (-512.929) [-510.054] (-509.957) (-510.729) * [-511.099] (-509.377) (-513.477) (-509.391) -- 0:00:02
968500 -- (-514.283) [-508.664] (-510.222) (-512.641) * (-509.004) [-513.071] (-510.376) (-509.100) -- 0:00:02
969000 -- (-513.291) (-508.789) (-511.990) [-509.875] * (-509.460) (-509.675) (-513.038) [-508.739] -- 0:00:01
969500 -- (-509.216) [-511.141] (-510.397) (-509.846) * (-509.768) (-509.843) (-509.205) [-510.361] -- 0:00:01
970000 -- (-508.795) [-508.366] (-509.830) (-509.992) * [-509.919] (-509.699) (-514.349) (-510.217) -- 0:00:01
Average standard deviation of split frequencies: 0.007656
970500 -- (-509.912) [-509.622] (-513.584) (-510.648) * (-511.728) [-513.767] (-512.125) (-510.117) -- 0:00:01
971000 -- (-511.890) (-510.464) [-509.108] (-511.577) * (-509.945) (-518.718) (-509.580) [-509.728] -- 0:00:01
971500 -- (-510.585) (-511.777) (-508.583) [-510.257] * (-513.521) (-512.267) (-510.644) [-514.271] -- 0:00:01
972000 -- (-511.240) (-509.175) [-510.387] (-509.286) * [-511.303] (-510.039) (-509.838) (-513.033) -- 0:00:01
972500 -- [-512.196] (-511.159) (-508.945) (-510.042) * (-513.756) (-510.019) [-511.811] (-517.997) -- 0:00:01
973000 -- (-512.218) [-510.108] (-509.852) (-514.609) * (-510.267) (-510.920) (-509.228) [-516.645] -- 0:00:01
973500 -- (-510.778) (-514.411) [-510.897] (-516.696) * (-509.649) (-509.660) [-511.627] (-511.635) -- 0:00:01
974000 -- (-508.973) [-513.318] (-509.348) (-514.051) * (-510.460) [-510.494] (-510.104) (-513.315) -- 0:00:01
974500 -- (-508.711) [-509.561] (-508.660) (-512.995) * [-510.251] (-514.129) (-512.761) (-510.842) -- 0:00:01
975000 -- (-509.336) (-510.327) [-508.947] (-514.102) * (-512.258) (-515.635) (-513.512) [-508.792] -- 0:00:01
Average standard deviation of split frequencies: 0.007614
975500 -- [-511.610] (-509.897) (-510.973) (-510.484) * (-509.940) [-511.365] (-510.466) (-509.274) -- 0:00:01
976000 -- (-509.295) (-511.338) [-510.502] (-511.241) * (-512.279) (-509.479) (-512.385) [-511.076] -- 0:00:01
976500 -- (-508.870) [-510.436] (-512.855) (-509.527) * [-509.239] (-509.833) (-515.802) (-510.361) -- 0:00:01
977000 -- [-509.300] (-511.573) (-510.020) (-508.485) * (-511.729) (-517.988) [-513.103] (-509.197) -- 0:00:01
977500 -- (-512.989) (-511.187) (-511.173) [-509.768] * (-509.957) (-508.959) (-515.482) [-509.709] -- 0:00:01
978000 -- (-511.607) (-513.978) [-511.103] (-508.687) * [-510.546] (-508.992) (-508.893) (-509.688) -- 0:00:01
978500 -- (-511.423) (-513.344) [-512.313] (-513.773) * (-512.185) (-509.056) (-511.494) [-509.911] -- 0:00:01
979000 -- [-509.667] (-511.207) (-508.755) (-514.048) * (-510.493) [-511.259] (-510.760) (-508.868) -- 0:00:01
979500 -- (-510.755) (-516.965) (-515.182) [-511.632] * [-509.605] (-510.082) (-510.531) (-516.705) -- 0:00:01
980000 -- (-512.340) [-512.380] (-508.804) (-510.515) * [-509.409] (-509.520) (-509.822) (-511.456) -- 0:00:01
Average standard deviation of split frequencies: 0.007719
980500 -- (-512.121) [-512.623] (-510.266) (-508.761) * (-511.354) (-513.394) (-509.629) [-513.165] -- 0:00:01
981000 -- (-508.995) [-511.981] (-512.728) (-510.321) * (-510.036) [-510.752] (-508.647) (-509.195) -- 0:00:01
981500 -- (-509.772) [-511.496] (-509.502) (-509.875) * (-510.091) [-509.191] (-515.682) (-508.942) -- 0:00:01
982000 -- [-511.050] (-514.632) (-511.818) (-510.701) * (-513.287) [-511.792] (-513.132) (-508.705) -- 0:00:01
982500 -- (-509.803) [-510.128] (-508.272) (-513.795) * (-511.898) (-511.699) (-510.519) [-509.892] -- 0:00:01
983000 -- (-510.527) (-512.093) [-510.711] (-513.781) * [-511.537] (-510.002) (-510.507) (-510.950) -- 0:00:01
983500 -- [-513.417] (-511.923) (-514.474) (-511.929) * [-509.266] (-509.513) (-510.394) (-509.885) -- 0:00:01
984000 -- (-509.824) (-509.679) [-512.070] (-518.208) * (-515.676) (-511.230) [-512.150] (-512.722) -- 0:00:01
984500 -- (-510.200) [-510.225] (-510.135) (-510.737) * (-510.112) [-508.635] (-510.815) (-513.600) -- 0:00:00
985000 -- (-508.890) (-513.461) [-511.034] (-512.904) * [-513.839] (-509.523) (-510.369) (-511.497) -- 0:00:00
Average standard deviation of split frequencies: 0.007706
985500 -- (-511.986) (-509.669) (-511.118) [-509.882] * (-510.125) (-509.331) (-510.345) [-510.137] -- 0:00:00
986000 -- (-514.293) (-511.866) [-511.585] (-509.154) * (-511.294) (-509.633) (-510.301) [-509.743] -- 0:00:00
986500 -- [-508.304] (-510.464) (-518.811) (-510.430) * (-510.664) (-511.641) (-510.775) [-509.891] -- 0:00:00
987000 -- (-512.302) [-509.707] (-514.058) (-509.259) * (-510.092) (-512.143) (-508.369) [-510.416] -- 0:00:00
987500 -- (-511.106) (-510.503) [-509.906] (-509.976) * [-509.248] (-510.028) (-509.042) (-513.739) -- 0:00:00
988000 -- (-510.952) (-510.601) (-509.379) [-511.088] * [-510.311] (-509.981) (-511.907) (-509.255) -- 0:00:00
988500 -- (-513.818) [-509.812] (-508.907) (-509.477) * [-512.967] (-510.858) (-515.104) (-509.537) -- 0:00:00
989000 -- [-508.889] (-510.894) (-510.297) (-508.610) * (-511.904) [-509.216] (-509.892) (-511.522) -- 0:00:00
989500 -- (-511.172) (-511.778) [-509.200] (-510.867) * (-510.873) (-509.448) [-511.137] (-510.192) -- 0:00:00
990000 -- (-513.505) (-512.216) [-508.725] (-513.492) * (-513.849) (-510.405) (-510.724) [-511.529] -- 0:00:00
Average standard deviation of split frequencies: 0.007418
990500 -- (-511.357) [-509.830] (-511.654) (-510.394) * (-512.828) [-510.211] (-510.587) (-509.478) -- 0:00:00
991000 -- (-509.629) (-512.852) [-514.727] (-510.853) * (-514.637) [-508.753] (-511.912) (-512.253) -- 0:00:00
991500 -- [-513.634] (-513.349) (-513.516) (-510.214) * (-509.789) (-509.614) [-510.131] (-511.222) -- 0:00:00
992000 -- (-510.320) (-519.346) (-508.862) [-509.272] * [-509.695] (-508.969) (-508.958) (-509.344) -- 0:00:00
992500 -- [-509.785] (-515.799) (-512.179) (-513.034) * (-512.654) (-508.995) [-509.802] (-511.644) -- 0:00:00
993000 -- (-511.163) [-512.973] (-515.123) (-511.024) * (-511.667) [-509.036] (-511.197) (-510.121) -- 0:00:00
993500 -- (-515.279) (-512.618) [-512.704] (-513.300) * (-508.745) (-509.379) [-512.147] (-514.603) -- 0:00:00
994000 -- (-510.562) (-509.822) [-509.707] (-510.585) * (-511.032) (-509.249) [-515.291] (-513.553) -- 0:00:00
994500 -- (-509.170) (-509.735) [-508.550] (-509.498) * (-509.248) (-510.949) [-511.085] (-511.842) -- 0:00:00
995000 -- (-511.702) (-511.056) [-509.054] (-513.065) * (-509.979) (-512.848) (-511.150) [-510.660] -- 0:00:00
Average standard deviation of split frequencies: 0.007628
995500 -- (-514.752) [-508.818] (-511.160) (-511.407) * (-512.338) [-513.052] (-510.695) (-511.381) -- 0:00:00
996000 -- (-513.825) [-510.035] (-515.957) (-517.225) * (-510.916) [-509.460] (-512.421) (-510.015) -- 0:00:00
996500 -- (-511.149) [-509.320] (-512.249) (-516.793) * (-509.321) [-511.973] (-512.192) (-515.180) -- 0:00:00
997000 -- (-509.865) (-510.552) (-512.076) [-513.534] * (-508.967) (-510.832) (-511.332) [-510.504] -- 0:00:00
997500 -- (-509.129) (-514.086) [-511.105] (-511.240) * (-509.402) (-510.072) [-510.977] (-510.481) -- 0:00:00
998000 -- (-509.600) (-510.735) [-512.689] (-511.371) * (-511.099) (-510.544) [-509.734] (-511.185) -- 0:00:00
998500 -- (-512.009) (-509.449) [-508.600] (-509.716) * (-511.774) (-510.074) [-509.774] (-509.437) -- 0:00:00
999000 -- (-508.571) (-508.412) [-509.169] (-509.559) * (-513.187) (-508.908) [-509.123] (-511.045) -- 0:00:00
999500 -- (-508.300) (-510.805) [-511.595] (-511.452) * (-511.772) (-509.349) [-510.038] (-512.779) -- 0:00:00
1000000 -- [-508.570] (-511.989) (-514.298) (-512.616) * (-511.845) (-511.379) (-511.283) [-512.870] -- 0:00:00
Average standard deviation of split frequencies: 0.007565
Analysis completed in 1 mins 3 seconds
Analysis used 62.12 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -508.18
Likelihood of best state for "cold" chain of run 2 was -508.18
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
35.7 % ( 30 %) Dirichlet(Pi{all})
35.3 % ( 33 %) Slider(Pi{all})
79.0 % ( 52 %) Multiplier(Alpha{1,2})
78.1 % ( 55 %) Multiplier(Alpha{3})
24.9 % ( 27 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 94 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.3 % ( 99 %) Nodeslider(V{all})
30.5 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 57 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.3 % ( 32 %) Dirichlet(Pi{all})
36.3 % ( 21 %) Slider(Pi{all})
78.4 % ( 62 %) Multiplier(Alpha{1,2})
77.8 % ( 53 %) Multiplier(Alpha{3})
25.6 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 20 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.9 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167101 0.82 0.67
3 | 166162 166652 0.84
4 | 166938 166572 166575
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166429 0.82 0.67
3 | 166593 167087 0.84
4 | 166728 166572 166591
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -509.96
| 1 2 |
| 2 2 211 |
|1 1 1 22 1 2 1 1 1 |
| 2 11 2 1 2 2 2 1 2 2 2 1 1|
| **2 22 1 1 1 2 1 2 2 1 |
| 1 1 121 2*11112 * 1* 1 2 2 2 1 2 2 |
|2 11 2 1 22 2 1 1 1 2 2 2|
| * 2 2 * 1 * 1 * 21 1 |
| 2 2 *1 22 2 1 |
| 2 2 1 11 2 |
| 1 1 |
| |
| 1 2 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -511.77
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -509.87 -513.47
2 -509.86 -512.91
--------------------------------------
TOTAL -509.86 -513.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894710 0.087366 0.373048 1.498392 0.862599 1364.75 1379.16 1.001
r(A<->C){all} 0.168924 0.020803 0.000090 0.448568 0.131644 224.62 271.31 1.000
r(A<->G){all} 0.168631 0.020249 0.000007 0.451652 0.131921 164.26 234.54 1.000
r(A<->T){all} 0.164058 0.019897 0.000121 0.449329 0.124280 264.60 316.01 1.000
r(C<->G){all} 0.170478 0.021177 0.000026 0.465616 0.131938 150.65 278.33 1.000
r(C<->T){all} 0.165849 0.019213 0.000046 0.442972 0.130344 183.72 197.23 1.005
r(G<->T){all} 0.162061 0.020346 0.000073 0.455687 0.119664 147.82 228.18 1.005
pi(A){all} 0.238664 0.000483 0.199194 0.284302 0.237853 968.85 1161.28 1.000
pi(C){all} 0.269279 0.000522 0.224128 0.311308 0.269466 1286.91 1332.30 1.000
pi(G){all} 0.314374 0.000571 0.269201 0.362332 0.314434 1273.15 1295.00 1.000
pi(T){all} 0.177683 0.000397 0.139450 0.217588 0.177177 1398.83 1401.46 1.000
alpha{1,2} 0.430822 0.237119 0.000292 1.405344 0.266275 1138.04 1146.89 1.000
alpha{3} 0.464335 0.236609 0.000232 1.465119 0.302485 1214.79 1324.07 1.000
pinvar{all} 0.995788 0.000027 0.986541 0.999997 0.997526 1278.22 1332.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- ..*.*.
9 -- ..****
10 -- ...**.
11 -- .****.
12 -- .*.***
13 -- ...*.*
14 -- ....**
15 -- .*...*
16 -- ..**..
17 -- .**...
18 -- .**.**
19 -- .*.*..
20 -- .***.*
21 -- ..*..*
22 -- ..***.
23 -- .*.*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 452 0.150566 0.007537 0.145237 0.155896 2
8 437 0.145570 0.000471 0.145237 0.145903 2
9 436 0.145237 0.003769 0.142572 0.147901 2
10 435 0.144903 0.007066 0.139907 0.149900 2
11 434 0.144570 0.000942 0.143904 0.145237 2
12 432 0.143904 0.002827 0.141905 0.145903 2
13 432 0.143904 0.005653 0.139907 0.147901 2
14 431 0.143571 0.016488 0.131912 0.155230 2
15 429 0.142905 0.002355 0.141239 0.144570 2
16 428 0.142572 0.000942 0.141905 0.143238 2
17 428 0.142572 0.016959 0.130580 0.154564 2
18 420 0.139907 0.014133 0.129913 0.149900 2
19 413 0.137575 0.000471 0.137242 0.137908 2
20 408 0.135909 0.012248 0.127249 0.144570 2
21 402 0.133911 0.011306 0.125916 0.141905 2
22 297 0.098934 0.008009 0.093271 0.104597 2
23 275 0.091606 0.017430 0.079280 0.103931 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101699 0.010586 0.000024 0.304698 0.067410 1.001 2
length{all}[2] 0.099599 0.010190 0.000009 0.295390 0.067457 1.000 2
length{all}[3] 0.098543 0.010062 0.000062 0.296334 0.069472 1.000 2
length{all}[4] 0.102478 0.010292 0.000028 0.312093 0.071205 1.000 2
length{all}[5] 0.099201 0.009894 0.000031 0.290025 0.068695 1.002 2
length{all}[6] 0.098730 0.009923 0.000019 0.296254 0.067700 1.000 2
length{all}[7] 0.094292 0.008592 0.000234 0.275556 0.063731 0.998 2
length{all}[8] 0.094451 0.008927 0.001032 0.288605 0.065291 1.001 2
length{all}[9] 0.099563 0.012013 0.000517 0.294360 0.064190 0.998 2
length{all}[10] 0.098083 0.010216 0.000004 0.287786 0.063829 1.001 2
length{all}[11] 0.095465 0.008019 0.000142 0.278996 0.068997 1.005 2
length{all}[12] 0.093191 0.009411 0.000272 0.268601 0.060981 1.001 2
length{all}[13] 0.096640 0.011594 0.000325 0.293885 0.059041 0.998 2
length{all}[14] 0.100218 0.009659 0.000439 0.282446 0.070452 0.999 2
length{all}[15] 0.100268 0.009095 0.000256 0.287927 0.074208 0.998 2
length{all}[16] 0.097111 0.007343 0.000107 0.265180 0.073393 1.001 2
length{all}[17] 0.103819 0.010110 0.000040 0.308325 0.070817 1.006 2
length{all}[18] 0.098850 0.009146 0.000595 0.280855 0.071231 1.000 2
length{all}[19] 0.097454 0.009851 0.000514 0.301279 0.062052 1.004 2
length{all}[20] 0.094656 0.009140 0.001570 0.303678 0.061693 0.998 2
length{all}[21] 0.101590 0.009164 0.000102 0.287956 0.072121 0.999 2
length{all}[22] 0.099395 0.009067 0.000833 0.293122 0.071998 0.998 2
length{all}[23] 0.106499 0.011285 0.000476 0.341363 0.068484 0.996 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007565
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 372
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 124 / 124 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 124 / 124 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079857 0.029205 0.049658 0.021041 0.083027 0.089019 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -529.808529
Iterating by ming2
Initial: fx= 529.808529
x= 0.07986 0.02920 0.04966 0.02104 0.08303 0.08902 0.30000 1.30000
1 h-m-p 0.0000 0.0002 296.6915 +++ 514.594503 m 0.0002 14 | 1/8
2 h-m-p 0.0012 0.0128 38.8406 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 271.4941 ++ 509.649069 m 0.0001 45 | 2/8
4 h-m-p 0.0005 0.0174 31.0734 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 242.7815 +++ 499.693766 m 0.0002 77 | 3/8
6 h-m-p 0.0015 0.0241 24.3159 -----------.. | 3/8
7 h-m-p 0.0000 0.0003 210.7017 +++ 488.552063 m 0.0003 109 | 4/8
8 h-m-p 0.0026 0.0502 16.8002 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 172.9106 ++ 487.765823 m 0.0000 141 | 5/8
10 h-m-p 0.0003 0.1520 10.6307 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 122.2700 ++ 487.021690 m 0.0000 171 | 6/8
12 h-m-p 0.1638 8.0000 0.0000 +++ 487.021690 m 8.0000 183 | 6/8
13 h-m-p 0.7829 8.0000 0.0000 ++ 487.021690 m 8.0000 196 | 6/8
14 h-m-p 0.0160 8.0000 3.8427 +Y 487.021689 0 0.1266 210 | 6/8
15 h-m-p 0.1571 0.7854 1.0081 C 487.021689 0 0.0488 221 | 6/8
16 h-m-p 1.6000 8.0000 0.0076 ------Y 487.021689 0 0.0001 238 | 6/8
17 h-m-p 1.6000 8.0000 0.0000 +Y 487.021689 0 6.4000 252
Out..
lnL = -487.021689
253 lfun, 253 eigenQcodon, 1518 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.073188 0.026394 0.025331 0.107035 0.017101 0.079506 0.729362 0.545241 0.539439
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.001634
np = 9
lnL0 = -526.810223
Iterating by ming2
Initial: fx= 526.810223
x= 0.07319 0.02639 0.02533 0.10703 0.01710 0.07951 0.72936 0.54524 0.53944
1 h-m-p 0.0000 0.0001 293.0786 ++ 514.555955 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0004 131.9461 ++ 509.528542 m 0.0004 26 | 2/9
3 h-m-p 0.0000 0.0000 344.0455 ++ 509.065958 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 1539.9592 ++ 492.308873 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 1458.0655 ++ 490.653283 m 0.0000 62 | 5/9
6 h-m-p 0.0001 0.0004 630.2637 ++ 488.200959 m 0.0004 74 | 5/9
7 h-m-p 0.0030 0.0152 66.0050 ------------.. | 5/9
8 h-m-p 0.0000 0.0001 122.7388 ++ 487.021723 m 0.0001 108 | 6/9
9 h-m-p 0.0534 8.0000 0.0000 ++++ 487.021723 m 8.0000 122 | 6/9
10 h-m-p 0.0221 8.0000 0.0130 +++++ 487.021719 m 8.0000 140 | 6/9
11 h-m-p 0.0687 0.6051 1.5107 ++ 487.021696 m 0.6051 155 | 7/9
12 h-m-p 1.6000 8.0000 0.0021 ---------C 487.021696 0 0.0000 176 | 7/9
13 h-m-p 0.0941 8.0000 0.0000 -----C 487.021696 0 0.0000 195
Out..
lnL = -487.021696
196 lfun, 588 eigenQcodon, 2352 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036858 0.050413 0.094448 0.046107 0.098518 0.033595 0.587664 1.745813 0.293931 0.182848 1.529049
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.520600
np = 11
lnL0 = -527.593878
Iterating by ming2
Initial: fx= 527.593878
x= 0.03686 0.05041 0.09445 0.04611 0.09852 0.03360 0.58766 1.74581 0.29393 0.18285 1.52905
1 h-m-p 0.0000 0.0003 254.2004 +++ 505.851432 m 0.0003 17 | 1/11
2 h-m-p 0.0000 0.0001 132.2617 ++ 503.897304 m 0.0001 31 | 2/11
3 h-m-p 0.0000 0.0000 24869.6399 ++ 499.543401 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 112507527.9315 ++ 498.017069 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0000 5812.1339 ++ 491.944321 m 0.0000 73 | 5/11
6 h-m-p 0.0067 0.7761 6.0733 -------------.. | 5/11
7 h-m-p 0.0000 0.0002 167.0661 ++ 487.534007 m 0.0002 112 | 6/11
8 h-m-p 0.0160 8.0000 1.7373 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 123.3952 ++ 487.021731 m 0.0000 151 | 7/11
10 h-m-p 0.0395 8.0000 0.0000 ++++ 487.021731 m 8.0000 167 | 6/11
11 h-m-p 0.0451 8.0000 0.0010 ++++ 487.021731 m 8.0000 187 | 6/11
12 h-m-p 0.0071 0.5982 1.0895 ++++ 487.021725 m 0.5982 208 | 6/11
13 h-m-p -0.0000 -0.0000 1.6960
h-m-p: -0.00000000e+00 -0.00000000e+00 1.69601504e+00 487.021725
.. | 6/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 487.021725 m 8.0000 236 | 6/11
15 h-m-p 0.0024 0.0118 0.0449 -------C 487.021725 0 0.0000 262 | 6/11
16 h-m-p 0.0160 8.0000 0.0132 +++++ 487.021719 m 8.0000 284 | 6/11
17 h-m-p 0.2858 2.6301 0.3687 ++ 487.021696 m 2.6301 303 | 7/11
18 h-m-p 1.6000 8.0000 0.0318 ++ 487.021695 m 8.0000 322 | 7/11
19 h-m-p 0.0752 8.0000 3.3841 +Y 487.021694 0 0.7342 341 | 7/11
20 h-m-p 1.6000 8.0000 0.2598 C 487.021694 0 1.6000 355 | 7/11
21 h-m-p 1.6000 8.0000 0.0089 Y 487.021694 0 1.1106 373 | 7/11
22 h-m-p 0.8790 8.0000 0.0113 Y 487.021694 0 0.1207 391 | 7/11
23 h-m-p 1.6000 8.0000 0.0004 ++ 487.021694 m 8.0000 409 | 7/11
24 h-m-p 0.3616 8.0000 0.0095 ++Y 487.021694 0 4.4483 429 | 7/11
25 h-m-p 1.6000 8.0000 0.0031 ++ 487.021694 m 8.0000 447 | 7/11
26 h-m-p 0.4038 8.0000 0.0609 +C 487.021694 0 2.4784 466 | 7/11
27 h-m-p 1.6000 8.0000 0.0118 ++ 487.021694 m 8.0000 484 | 7/11
28 h-m-p 0.0002 0.0102 441.4396 ++C 487.021693 0 0.0033 504 | 7/11
29 h-m-p 1.6000 8.0000 0.0815 ++ 487.021692 m 8.0000 518 | 7/11
30 h-m-p 0.0667 8.0000 9.7728 ++Y 487.021684 0 0.8760 538 | 7/11
31 h-m-p 1.1660 5.8301 1.2437 +Y 487.021679 0 3.0771 553 | 7/11
32 h-m-p 0.1575 0.7875 3.8745 Y 487.021678 0 0.2768 567 | 7/11
33 h-m-p 0.1336 0.6678 5.0039 ++ 487.021676 m 0.6678 581 | 8/11
34 h-m-p 1.4019 8.0000 2.3172 Y 487.021661 0 2.3297 595 | 8/11
35 h-m-p 1.2068 8.0000 4.4735 ++ 487.021656 m 8.0000 609 | 8/11
36 h-m-p 1.6000 8.0000 0.5416 ++ 487.021655 m 8.0000 623 | 8/11
37 h-m-p 0.5463 8.0000 7.9316 ++ 487.021654 m 8.0000 640 | 8/11
38 h-m-p 1.6000 8.0000 0.0000 Y 487.021654 0 1.6000 654 | 8/11
39 h-m-p 0.0160 8.0000 0.0000 -C 487.021654 0 0.0010 672
Out..
lnL = -487.021654
673 lfun, 2692 eigenQcodon, 12114 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -487.018840 S = -487.018761 -0.000030
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:04
did 20 / 47 patterns 0:04
did 30 / 47 patterns 0:04
did 40 / 47 patterns 0:04
did 47 / 47 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031855 0.024560 0.044877 0.096070 0.109406 0.087330 0.000100 1.134340 1.914804
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.175193
np = 9
lnL0 = -533.858169
Iterating by ming2
Initial: fx= 533.858169
x= 0.03186 0.02456 0.04488 0.09607 0.10941 0.08733 0.00011 1.13434 1.91480
1 h-m-p 0.0000 0.0000 278.7794 ++ 533.133726 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0511 22.3457 ----------.. | 1/9
3 h-m-p 0.0000 0.0002 279.1812 +++ 517.003024 m 0.0002 47 | 2/9
4 h-m-p 0.0029 0.0653 17.5821 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 262.5094 ++ 512.723962 m 0.0001 81 | 3/9
6 h-m-p 0.0013 0.1013 11.5628 -----------.. | 3/9
7 h-m-p 0.0000 0.0001 236.1390 ++ 506.548231 m 0.0001 114 | 4/9
8 h-m-p 0.0026 0.1412 8.5067 ------------.. | 4/9
9 h-m-p 0.0000 0.0004 206.4450 +++ 490.939875 m 0.0004 149 | 5/9
10 h-m-p 0.0174 0.6183 3.4788 -------------.. | 5/9
11 h-m-p 0.0000 0.0001 174.5379 ++ 488.725761 m 0.0001 184 | 6/9
12 h-m-p 0.0023 0.8181 3.8138 ------------.. | 6/9
13 h-m-p 0.0000 0.0001 123.9098 ++ 487.021745 m 0.0001 218 | 7/9
14 h-m-p 1.1010 8.0000 0.0000 ++ 487.021745 m 8.0000 230 | 6/9
15 h-m-p 0.0216 8.0000 0.0007 +++++ 487.021745 m 8.0000 247 | 6/9
16 h-m-p 0.0160 8.0000 4.0283 +++++ 487.021717 m 8.0000 265 | 6/9
17 h-m-p 1.6000 8.0000 4.5569 ++ 487.021705 m 8.0000 277 | 6/9
18 h-m-p 0.1948 0.9742 49.3327 ++ 487.021698 m 0.9742 289 | 6/9
19 h-m-p 0.0000 0.0000 28.3446
h-m-p: 0.00000000e+00 0.00000000e+00 2.83446415e+01 487.021698
.. | 6/9
20 h-m-p 0.0160 8.0000 0.0000 +++++ 487.021698 m 8.0000 313 | 6/9
21 h-m-p 0.0042 0.0208 0.0010 ------------.. | 6/9
22 h-m-p 0.0160 8.0000 0.0000 +++++ 487.021698 m 8.0000 356 | 6/9
23 h-m-p 0.0160 8.0000 0.0828 +++++ 487.021697 m 8.0000 374 | 6/9
24 h-m-p 0.2162 8.0000 3.0639 +++ 487.021685 m 8.0000 390 | 6/9
25 h-m-p 1.6000 8.0000 1.3737 ++ 487.021684 m 8.0000 402 | 6/9
26 h-m-p 1.2968 8.0000 8.4748 ++ 487.021683 m 8.0000 414 | 6/9
27 h-m-p 1.6000 8.0000 4.5258 ++ 487.021683 m 8.0000 426 | 6/9
28 h-m-p 0.1798 4.2438 201.3228 Y 487.021683 0 0.3234 438 | 6/9
29 h-m-p 1.6000 8.0000 7.6412 C 487.021683 0 1.6000 450 | 6/9
30 h-m-p 0.8264 8.0000 14.7945 -----Y 487.021683 0 0.0002 467 | 6/9
31 h-m-p 1.6000 8.0000 0.0011 ----------------.. | 6/9
32 h-m-p 0.0160 8.0000 0.0000 --------C 487.021683 0 0.0000 516 | 6/9
33 h-m-p 0.0160 8.0000 0.0000 --------C 487.021683 0 0.0000 539
Out..
lnL = -487.021683
540 lfun, 5940 eigenQcodon, 32400 P(t)
Time used: 0:13
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.071965 0.058172 0.090613 0.063575 0.062564 0.063865 197.652081 0.900000 0.255912 1.773908 1.382356
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.195322
np = 11
lnL0 = -531.859001
Iterating by ming2
Initial: fx= 531.859001
x= 0.07196 0.05817 0.09061 0.06357 0.06256 0.06387 197.65208 0.90000 0.25591 1.77391 1.38236
1 h-m-p 0.0000 0.0006 243.4822 +++ 494.689002 m 0.0006 17 | 1/11
2 h-m-p 0.0001 0.0003 100.1186 ++ 491.923239 m 0.0003 31 | 2/11
3 h-m-p 0.0001 0.0003 63.6186 ++ 491.606267 m 0.0003 45 | 3/11
4 h-m-p 0.0000 0.0000 1678.4139 ++ 491.540486 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0000 29329.5017 ++ 490.322673 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0002 2171.4612 ++ 487.163387 m 0.0002 87 | 6/11
7 h-m-p 0.0118 0.0590 11.0205 -------------.. | 6/11
8 h-m-p 0.0000 0.0000 122.4335 ++ 487.021694 m 0.0000 126 | 7/11
9 h-m-p 0.0192 8.0000 0.0000 Y 487.021694 0 0.0192 140 | 7/11
10 h-m-p 0.5768 8.0000 0.0000 +Y 487.021694 0 2.3074 159
Out..
lnL = -487.021694
160 lfun, 1920 eigenQcodon, 10560 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -487.026562 S = -487.019683 -0.003015
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:16
did 20 / 47 patterns 0:16
did 30 / 47 patterns 0:16
did 40 / 47 patterns 0:17
did 47 / 47 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=124
NC_011896_1_WP_010908591_1_2005_MLBR_RS09510 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
NC_002677_1_NP_302270_1_1142_rpsL MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
**************************************************
NC_011896_1_WP_010908591_1_2005_MLBR_RS09510 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
NC_002677_1_NP_302270_1_1142_rpsL KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595 KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
**************************************************
NC_011896_1_WP_010908591_1_2005_MLBR_RS09510 SLDTQGVKNRKQARSRYGAKKEKS
NC_002677_1_NP_302270_1_1142_rpsL SLDTQGVKNRKQARSRYGAKKEKS
NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500 SLDTQGVKNRKQARSRYGAKKEKS
NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120 SLDTQGVKNRKQARSRYGAKKEKS
NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320 SLDTQGVKNRKQARSRYGAKKEKS
NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595 SLDTQGVKNRKQARSRYGAKKEKS
************************
>NC_011896_1_WP_010908591_1_2005_MLBR_RS09510 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA TGGAGCCAAGAAGGAGAAGAGC >NC_002677_1_NP_302270_1_1142_rpsL ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA TGGAGCCAAGAAGGAGAAGAGC >NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA TGGAGCCAAGAAGGAGAAGAGC >NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA TGGAGCCAAGAAGGAGAAGAGC >NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA TGGAGCCAAGAAGGAGAAGAGC >NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595 ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA TGGAGCCAAGAAGGAGAAGAGC
>NC_011896_1_WP_010908591_1_2005_MLBR_RS09510 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG SLDTQGVKNRKQARSRYGAKKEKS >NC_002677_1_NP_302270_1_1142_rpsL MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG SLDTQGVKNRKQARSRYGAKKEKS >NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG SLDTQGVKNRKQARSRYGAKKEKS >NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG SLDTQGVKNRKQARSRYGAKKEKS >NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG SLDTQGVKNRKQARSRYGAKKEKS >NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595 MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG SLDTQGVKNRKQARSRYGAKKEKS
#NEXUS
[ID: 0522115364]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908591_1_2005_MLBR_RS09510
NC_002677_1_NP_302270_1_1142_rpsL
NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500
NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120
NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320
NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908591_1_2005_MLBR_RS09510,
2 NC_002677_1_NP_302270_1_1142_rpsL,
3 NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500,
4 NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120,
5 NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320,
6 NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06741022,2:0.0674567,3:0.0694722,4:0.07120515,5:0.06869527,6:0.06769991);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06741022,2:0.0674567,3:0.0694722,4:0.07120515,5:0.06869527,6:0.06769991);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -509.87 -513.47
2 -509.86 -512.91
--------------------------------------
TOTAL -509.86 -513.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894710 0.087366 0.373048 1.498392 0.862599 1364.75 1379.16 1.001
r(A<->C){all} 0.168924 0.020803 0.000090 0.448568 0.131644 224.62 271.31 1.000
r(A<->G){all} 0.168631 0.020249 0.000007 0.451652 0.131921 164.26 234.54 1.000
r(A<->T){all} 0.164058 0.019897 0.000121 0.449329 0.124280 264.60 316.01 1.000
r(C<->G){all} 0.170478 0.021177 0.000026 0.465616 0.131938 150.65 278.33 1.000
r(C<->T){all} 0.165849 0.019213 0.000046 0.442972 0.130344 183.72 197.23 1.005
r(G<->T){all} 0.162061 0.020346 0.000073 0.455687 0.119664 147.82 228.18 1.005
pi(A){all} 0.238664 0.000483 0.199194 0.284302 0.237853 968.85 1161.28 1.000
pi(C){all} 0.269279 0.000522 0.224128 0.311308 0.269466 1286.91 1332.30 1.000
pi(G){all} 0.314374 0.000571 0.269201 0.362332 0.314434 1273.15 1295.00 1.000
pi(T){all} 0.177683 0.000397 0.139450 0.217588 0.177177 1398.83 1401.46 1.000
alpha{1,2} 0.430822 0.237119 0.000292 1.405344 0.266275 1138.04 1146.89 1.000
alpha{3} 0.464335 0.236609 0.000232 1.465119 0.302485 1214.79 1324.07 1.000
pinvar{all} 0.995788 0.000027 0.986541 0.999997 0.997526 1278.22 1332.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpsL/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 124
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 2 2 2 2 2 2 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 6 6 6 6 6 6
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 6 6 6 6 6 6
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 2 2 2 2 2 2 | CAG 7 7 7 7 7 7 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 1 1 1 1 1 1 | ACC 4 4 4 4 4 4 | AAC 4 4 4 4 4 4 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 14 14 14 14 14 14 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 7 7 7 7 7 7
GTC 3 3 3 3 3 3 | GCC 2 2 2 2 2 2 | GAC 2 2 2 2 2 2 | GGC 4 4 4 4 4 4
GTA 1 1 1 1 1 1 | GCA 0 0 0 0 0 0 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 6 6 6 6 6 6 | GCG 3 3 3 3 3 3 | GAG 3 3 3 3 3 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908591_1_2005_MLBR_RS09510
position 1: T:0.08065 C:0.29839 A:0.30645 G:0.31452
position 2: T:0.22581 C:0.20161 A:0.32258 G:0.25000
position 3: T:0.22581 C:0.30645 A:0.08871 G:0.37903
Average T:0.17742 C:0.26882 A:0.23925 G:0.31452
#2: NC_002677_1_NP_302270_1_1142_rpsL
position 1: T:0.08065 C:0.29839 A:0.30645 G:0.31452
position 2: T:0.22581 C:0.20161 A:0.32258 G:0.25000
position 3: T:0.22581 C:0.30645 A:0.08871 G:0.37903
Average T:0.17742 C:0.26882 A:0.23925 G:0.31452
#3: NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500
position 1: T:0.08065 C:0.29839 A:0.30645 G:0.31452
position 2: T:0.22581 C:0.20161 A:0.32258 G:0.25000
position 3: T:0.22581 C:0.30645 A:0.08871 G:0.37903
Average T:0.17742 C:0.26882 A:0.23925 G:0.31452
#4: NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120
position 1: T:0.08065 C:0.29839 A:0.30645 G:0.31452
position 2: T:0.22581 C:0.20161 A:0.32258 G:0.25000
position 3: T:0.22581 C:0.30645 A:0.08871 G:0.37903
Average T:0.17742 C:0.26882 A:0.23925 G:0.31452
#5: NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320
position 1: T:0.08065 C:0.29839 A:0.30645 G:0.31452
position 2: T:0.22581 C:0.20161 A:0.32258 G:0.25000
position 3: T:0.22581 C:0.30645 A:0.08871 G:0.37903
Average T:0.17742 C:0.26882 A:0.23925 G:0.31452
#6: NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595
position 1: T:0.08065 C:0.29839 A:0.30645 G:0.31452
position 2: T:0.22581 C:0.20161 A:0.32258 G:0.25000
position 3: T:0.22581 C:0.30645 A:0.08871 G:0.37903
Average T:0.17742 C:0.26882 A:0.23925 G:0.31452
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 0 | TCC 12 | TAC 18 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 36
CTC 6 | CCC 6 | CAC 12 | CGC 36
CTA 6 | CCA 12 | Gln Q CAA 0 | CGA 6
CTG 24 | CCG 12 | CAG 42 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 6
ATC 6 | ACC 24 | AAC 24 | AGC 12
ATA 6 | ACA 6 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 12 | ACG 6 | AAG 84 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 42
GTC 18 | GCC 12 | GAC 12 | GGC 24
GTA 6 | GCA 0 | Glu E GAA 6 | GGA 6
GTG 36 | GCG 18 | GAG 18 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.08065 C:0.29839 A:0.30645 G:0.31452
position 2: T:0.22581 C:0.20161 A:0.32258 G:0.25000
position 3: T:0.22581 C:0.30645 A:0.08871 G:0.37903
Average T:0.17742 C:0.26882 A:0.23925 G:0.31452
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -487.021689 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.729362 1.382356
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908591_1_2005_MLBR_RS09510: 0.000004, NC_002677_1_NP_302270_1_1142_rpsL: 0.000004, NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500: 0.000004, NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120: 0.000004, NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320: 0.000004, NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.72936
omega (dN/dS) = 1.38236
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 299.2 72.8 1.3824 0.0000 0.0000 0.0 0.0
7..2 0.000 299.2 72.8 1.3824 0.0000 0.0000 0.0 0.0
7..3 0.000 299.2 72.8 1.3824 0.0000 0.0000 0.0 0.0
7..4 0.000 299.2 72.8 1.3824 0.0000 0.0000 0.0 0.0
7..5 0.000 299.2 72.8 1.3824 0.0000 0.0000 0.0 0.0
7..6 0.000 299.2 72.8 1.3824 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -487.021696 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.587664 0.717608 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908591_1_2005_MLBR_RS09510: 0.000004, NC_002677_1_NP_302270_1_1142_rpsL: 0.000004, NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500: 0.000004, NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120: 0.000004, NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320: 0.000004, NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.58766
MLEs of dN/dS (w) for site classes (K=2)
p: 0.71761 0.28239
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 300.9 71.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 300.9 71.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 300.9 71.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 300.9 71.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 300.9 71.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 300.9 71.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -487.021654 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000001 0.000000 1.000000 89.103483
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908591_1_2005_MLBR_RS09510: 0.000004, NC_002677_1_NP_302270_1_1142_rpsL: 0.000004, NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500: 0.000004, NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120: 0.000004, NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320: 0.000004, NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 89.10348
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 310.4 61.6 89.1034 0.0000 0.0000 0.0 0.0
7..2 0.000 310.4 61.6 89.1034 0.0000 0.0000 0.0 0.0
7..3 0.000 310.4 61.6 89.1034 0.0000 0.0000 0.0 0.0
7..4 0.000 310.4 61.6 89.1034 0.0000 0.0000 0.0 0.0
7..5 0.000 310.4 61.6 89.1034 0.0000 0.0000 0.0 0.0
7..6 0.000 310.4 61.6 89.1034 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908591_1_2005_MLBR_RS09510)
Pr(w>1) post mean +- SE for w
1 M 1.000** 89.103
2 P 1.000** 89.103
3 T 1.000** 89.103
4 I 1.000** 89.103
5 Q 1.000** 89.103
6 Q 1.000** 89.103
7 L 1.000** 89.103
8 V 1.000** 89.103
9 R 1.000** 89.103
10 K 1.000** 89.103
11 G 1.000** 89.103
12 R 1.000** 89.103
13 R 1.000** 89.103
14 D 1.000** 89.103
15 K 1.000** 89.103
16 I 1.000** 89.103
17 G 1.000** 89.103
18 K 1.000** 89.103
19 V 1.000** 89.103
20 K 1.000** 89.103
21 T 1.000** 89.103
22 A 1.000** 89.103
23 A 1.000** 89.103
24 L 1.000** 89.103
25 K 1.000** 89.103
26 G 1.000** 89.103
27 N 1.000** 89.103
28 P 1.000** 89.103
29 Q 1.000** 89.103
30 R 1.000** 89.103
31 R 1.000** 89.103
32 G 1.000** 89.103
33 V 1.000** 89.103
34 C 1.000** 89.103
35 T 1.000** 89.103
36 R 1.000** 89.103
37 V 1.000** 89.103
38 Y 1.000** 89.103
39 T 1.000** 89.103
40 S 1.000** 89.103
41 T 1.000** 89.103
42 P 1.000** 89.103
43 K 1.000** 89.103
44 K 1.000** 89.103
45 P 1.000** 89.103
46 N 1.000** 89.103
47 S 1.000** 89.103
48 A 1.000** 89.103
49 L 1.000** 89.103
50 R 1.000** 89.103
51 K 1.000** 89.103
52 V 1.000** 89.103
53 A 1.000** 89.103
54 R 1.000** 89.103
55 V 1.000** 89.103
56 K 1.000** 89.103
57 L 1.000** 89.103
58 T 1.000** 89.103
59 S 1.000** 89.103
60 Q 1.000** 89.103
61 V 1.000** 89.103
62 E 1.000** 89.103
63 V 1.000** 89.103
64 T 1.000** 89.103
65 A 1.000** 89.103
66 Y 1.000** 89.103
67 I 1.000** 89.103
68 P 1.000** 89.103
69 G 1.000** 89.103
70 E 1.000** 89.103
71 G 1.000** 89.103
72 H 1.000** 89.103
73 N 1.000** 89.103
74 L 1.000** 89.103
75 Q 1.000** 89.103
76 E 1.000** 89.103
77 H 1.000** 89.103
78 S 1.000** 89.103
79 M 1.000** 89.103
80 V 1.000** 89.103
81 L 1.000** 89.103
82 V 1.000** 89.103
83 R 1.000** 89.103
84 G 1.000** 89.103
85 G 1.000** 89.103
86 R 1.000** 89.103
87 V 1.000** 89.103
88 K 1.000** 89.103
89 D 1.000** 89.103
90 L 1.000** 89.103
91 P 1.000** 89.103
92 G 1.000** 89.103
93 V 1.000** 89.103
94 R 1.000** 89.103
95 Y 1.000** 89.103
96 K 1.000** 89.103
97 I 1.000** 89.103
98 I 1.000** 89.103
99 R 1.000** 89.103
100 G 1.000** 89.103
101 S 1.000** 89.103
102 L 1.000** 89.103
103 D 1.000** 89.103
104 T 1.000** 89.103
105 Q 1.000** 89.103
106 G 1.000** 89.103
107 V 1.000** 89.103
108 K 1.000** 89.103
109 N 1.000** 89.103
110 R 1.000** 89.103
111 K 1.000** 89.103
112 Q 1.000** 89.103
113 A 1.000** 89.103
114 R 1.000** 89.103
115 S 1.000** 89.103
116 R 1.000** 89.103
117 Y 1.000** 89.103
118 G 1.000** 89.103
119 A 1.000** 89.103
120 K 1.000** 89.103
121 K 1.000** 89.103
122 E 1.000** 89.103
123 K 1.000** 89.103
124 S 1.000** 89.103
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908591_1_2005_MLBR_RS09510)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -487.021683 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 197.652081 68.835361 96.988502
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908591_1_2005_MLBR_RS09510: 0.000004, NC_002677_1_NP_302270_1_1142_rpsL: 0.000004, NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500: 0.000004, NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120: 0.000004, NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320: 0.000004, NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 197.65208
Parameters in M7 (beta):
p = 68.83536 q = 96.98850
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.35292 0.37549 0.38910 0.40006 0.40996 0.41959 0.42958 0.44075 0.45479 0.47847
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 267.7 104.3 0.4151 0.0000 0.0000 0.0 0.0
7..2 0.000 267.7 104.3 0.4151 0.0000 0.0000 0.0 0.0
7..3 0.000 267.7 104.3 0.4151 0.0000 0.0000 0.0 0.0
7..4 0.000 267.7 104.3 0.4151 0.0000 0.0000 0.0 0.0
7..5 0.000 267.7 104.3 0.4151 0.0000 0.0000 0.0 0.0
7..6 0.000 267.7 104.3 0.4151 0.0000 0.0000 0.0 0.0
Time used: 0:13
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -487.021694 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 197.652087 0.357704 0.005000 1.795994 1.531391
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908591_1_2005_MLBR_RS09510: 0.000004, NC_002677_1_NP_302270_1_1142_rpsL: 0.000004, NZ_LVXE01000034_1_WP_010908591_1_1530_A3216_RS09500: 0.000004, NZ_LYPH01000037_1_WP_010908591_1_1486_A8144_RS07120: 0.000004, NZ_CP029543_1_WP_010908591_1_2028_DIJ64_RS10320: 0.000004, NZ_AP014567_1_WP_010908591_1_2083_JK2ML_RS10595: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 197.65209
Parameters in M8 (beta&w>1):
p0 = 0.35770 p = 0.00500 q = 1.79599
(p1 = 0.64230) w = 1.53139
MLEs of dN/dS (w) for site classes (K=11)
p: 0.03577 0.03577 0.03577 0.03577 0.03577 0.03577 0.03577 0.03577 0.03577 0.03577 0.64230
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.53139
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 267.7 104.3 0.9836 0.0000 0.0000 0.0 0.0
7..2 0.000 267.7 104.3 0.9836 0.0000 0.0000 0.0 0.0
7..3 0.000 267.7 104.3 0.9836 0.0000 0.0000 0.0 0.0
7..4 0.000 267.7 104.3 0.9836 0.0000 0.0000 0.0 0.0
7..5 0.000 267.7 104.3 0.9836 0.0000 0.0000 0.0 0.0
7..6 0.000 267.7 104.3 0.9836 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908591_1_2005_MLBR_RS09510)
Pr(w>1) post mean +- SE for w
1 M 0.642 0.984
2 P 0.642 0.984
3 T 0.642 0.984
4 I 0.642 0.984
5 Q 0.642 0.984
6 Q 0.642 0.984
7 L 0.642 0.984
8 V 0.642 0.984
9 R 0.642 0.984
10 K 0.642 0.984
11 G 0.642 0.984
12 R 0.642 0.984
13 R 0.642 0.984
14 D 0.642 0.984
15 K 0.642 0.984
16 I 0.642 0.984
17 G 0.642 0.984
18 K 0.642 0.984
19 V 0.642 0.984
20 K 0.642 0.984
21 T 0.642 0.984
22 A 0.642 0.984
23 A 0.642 0.984
24 L 0.642 0.984
25 K 0.642 0.984
26 G 0.642 0.984
27 N 0.642 0.984
28 P 0.642 0.984
29 Q 0.642 0.984
30 R 0.642 0.984
31 R 0.642 0.984
32 G 0.642 0.984
33 V 0.642 0.984
34 C 0.642 0.984
35 T 0.642 0.984
36 R 0.642 0.984
37 V 0.642 0.984
38 Y 0.642 0.984
39 T 0.642 0.984
40 S 0.642 0.984
41 T 0.642 0.984
42 P 0.642 0.984
43 K 0.642 0.984
44 K 0.642 0.984
45 P 0.642 0.984
46 N 0.642 0.984
47 S 0.642 0.984
48 A 0.642 0.984
49 L 0.642 0.984
50 R 0.642 0.984
51 K 0.642 0.984
52 V 0.642 0.984
53 A 0.642 0.984
54 R 0.642 0.984
55 V 0.642 0.984
56 K 0.642 0.984
57 L 0.642 0.984
58 T 0.642 0.984
59 S 0.642 0.984
60 Q 0.642 0.984
61 V 0.642 0.984
62 E 0.642 0.984
63 V 0.642 0.984
64 T 0.642 0.984
65 A 0.642 0.984
66 Y 0.642 0.984
67 I 0.642 0.984
68 P 0.642 0.984
69 G 0.642 0.984
70 E 0.642 0.984
71 G 0.642 0.984
72 H 0.642 0.984
73 N 0.642 0.984
74 L 0.642 0.984
75 Q 0.642 0.984
76 E 0.642 0.984
77 H 0.642 0.984
78 S 0.642 0.984
79 M 0.642 0.984
80 V 0.642 0.984
81 L 0.642 0.984
82 V 0.642 0.984
83 R 0.642 0.984
84 G 0.642 0.984
85 G 0.642 0.984
86 R 0.642 0.984
87 V 0.642 0.984
88 K 0.642 0.984
89 D 0.642 0.984
90 L 0.642 0.984
91 P 0.642 0.984
92 G 0.642 0.984
93 V 0.642 0.984
94 R 0.642 0.984
95 Y 0.642 0.984
96 K 0.642 0.984
97 I 0.642 0.984
98 I 0.642 0.984
99 R 0.642 0.984
100 G 0.642 0.984
101 S 0.642 0.984
102 L 0.642 0.984
103 D 0.642 0.984
104 T 0.642 0.984
105 Q 0.642 0.984
106 G 0.642 0.984
107 V 0.642 0.984
108 K 0.642 0.984
109 N 0.642 0.984
110 R 0.642 0.984
111 K 0.642 0.984
112 Q 0.642 0.984
113 A 0.642 0.984
114 R 0.642 0.984
115 S 0.642 0.984
116 R 0.642 0.984
117 Y 0.642 0.984
118 G 0.642 0.984
119 A 0.642 0.984
120 K 0.642 0.984
121 K 0.642 0.984
122 E 0.642 0.984
123 K 0.642 0.984
124 S 0.642 0.984
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908591_1_2005_MLBR_RS09510)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17
Model 1: NearlyNeutral -487.021696 Model 2: PositiveSelection -487.021654 Model 0: one-ratio -487.021689 Model 7: beta -487.021683 Model 8: beta&w>1 -487.021694 Model 0 vs 1 1.4000000078340236E-5 Model 2 vs 1 8.400000001529406E-5 Model 8 vs 7 2.2000000058142177E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
