--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:26:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsL/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -509.87          -513.47
2       -509.86          -512.91
--------------------------------------
TOTAL     -509.86          -513.23
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.894710    0.087366    0.373048    1.498392    0.862599   1364.75   1379.16    1.001
r(A<->C){all}   0.168924    0.020803    0.000090    0.448568    0.131644    224.62    271.31    1.000
r(A<->G){all}   0.168631    0.020249    0.000007    0.451652    0.131921    164.26    234.54    1.000
r(A<->T){all}   0.164058    0.019897    0.000121    0.449329    0.124280    264.60    316.01    1.000
r(C<->G){all}   0.170478    0.021177    0.000026    0.465616    0.131938    150.65    278.33    1.000
r(C<->T){all}   0.165849    0.019213    0.000046    0.442972    0.130344    183.72    197.23    1.005
r(G<->T){all}   0.162061    0.020346    0.000073    0.455687    0.119664    147.82    228.18    1.005
pi(A){all}      0.238664    0.000483    0.199194    0.284302    0.237853    968.85   1161.28    1.000
pi(C){all}      0.269279    0.000522    0.224128    0.311308    0.269466   1286.91   1332.30    1.000
pi(G){all}      0.314374    0.000571    0.269201    0.362332    0.314434   1273.15   1295.00    1.000
pi(T){all}      0.177683    0.000397    0.139450    0.217588    0.177177   1398.83   1401.46    1.000
alpha{1,2}      0.430822    0.237119    0.000292    1.405344    0.266275   1138.04   1146.89    1.000
alpha{3}        0.464335    0.236609    0.000232    1.465119    0.302485   1214.79   1324.07    1.000
pinvar{all}     0.995788    0.000027    0.986541    0.999997    0.997526   1278.22   1332.91    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-487.021696
Model 2: PositiveSelection	-487.021654
Model 0: one-ratio	-487.021689
Model 7: beta	-487.021683
Model 8: beta&w>1	-487.021694


Model 0 vs 1	1.4000000078340236E-5

Model 2 vs 1	8.400000001529406E-5

Model 8 vs 7	2.2000000058142177E-5
>C1
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C2
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C3
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C4
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C5
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C6
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=124 

C1              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C2              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C3              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C4              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C5              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C6              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
                **************************************************

C1              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C2              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C3              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C4              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C5              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C6              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
                **************************************************

C1              SLDTQGVKNRKQARSRYGAKKEKS
C2              SLDTQGVKNRKQARSRYGAKKEKS
C3              SLDTQGVKNRKQARSRYGAKKEKS
C4              SLDTQGVKNRKQARSRYGAKKEKS
C5              SLDTQGVKNRKQARSRYGAKKEKS
C6              SLDTQGVKNRKQARSRYGAKKEKS
                ************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3720]--->[3720]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.460 Mb, Max= 30.653 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C2              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C3              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C4              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C5              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
C6              MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
                **************************************************

C1              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C2              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C3              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C4              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C5              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
C6              KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
                **************************************************

C1              SLDTQGVKNRKQARSRYGAKKEKS
C2              SLDTQGVKNRKQARSRYGAKKEKS
C3              SLDTQGVKNRKQARSRYGAKKEKS
C4              SLDTQGVKNRKQARSRYGAKKEKS
C5              SLDTQGVKNRKQARSRYGAKKEKS
C6              SLDTQGVKNRKQARSRYGAKKEKS
                ************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
C2              ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
C3              ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
C4              ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
C5              ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
C6              ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
                **************************************************

C1              CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
C2              CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
C3              CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
C4              CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
C5              CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
C6              CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
                **************************************************

C1              GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
C2              GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
C3              GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
C4              GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
C5              GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
C6              GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
                **************************************************

C1              AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
C2              AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
C3              AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
C4              AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
C5              AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
C6              AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
                **************************************************

C1              ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
C2              ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
C3              ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
C4              ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
C5              ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
C6              ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
                **************************************************

C1              GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
C2              GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
C3              GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
C4              GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
C5              GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
C6              GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
                **************************************************

C1              TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
C2              TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
C3              TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
C4              TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
C5              TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
C6              TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
                **************************************************

C1              TGGAGCCAAGAAGGAGAAGAGC
C2              TGGAGCCAAGAAGGAGAAGAGC
C3              TGGAGCCAAGAAGGAGAAGAGC
C4              TGGAGCCAAGAAGGAGAAGAGC
C5              TGGAGCCAAGAAGGAGAAGAGC
C6              TGGAGCCAAGAAGGAGAAGAGC
                **********************



>C1
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C2
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C3
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C4
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C5
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C6
ATGCCCACCATTCAGCAGCTGGTACGCAAGGGTCGTCGAGACAAGATTGG
CAAGGTCAAGACTGCGGCTCTGAAGGGCAACCCACAGCGTCGCGGTGTTT
GCACCCGTGTGTACACTTCCACCCCGAAGAAGCCGAACTCGGCGCTTCGC
AAGGTTGCCCGCGTGAAGCTGACGAGTCAGGTTGAGGTCACAGCGTACAT
ACCAGGCGAGGGTCACAACCTACAGGAACACTCCATGGTGTTGGTGCGTG
GTGGCCGGGTGAAAGATCTGCCTGGTGTGCGTTACAAAATCATTCGCGGT
TCGCTCGACACCCAGGGTGTCAAGAACCGGAAGCAGGCTCGTAGCCGCTA
TGGAGCCAAGAAGGAGAAGAGC
>C1
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C2
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C3
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C4
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C5
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
>C6
MPTIQQLVRKGRRDKIGKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 372 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579793088
      Setting output file names to "/data/11res/rpsL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 416530295
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0522115364
      Seed = 509816621
      Swapseed = 1579793088
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -832.553787 -- -24.965149
         Chain 2 -- -832.553708 -- -24.965149
         Chain 3 -- -832.553708 -- -24.965149
         Chain 4 -- -832.553835 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -832.553787 -- -24.965149
         Chain 2 -- -832.553835 -- -24.965149
         Chain 3 -- -832.553835 -- -24.965149
         Chain 4 -- -832.553787 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-832.554] (-832.554) (-832.554) (-832.554) * [-832.554] (-832.554) (-832.554) (-832.554) 
        500 -- (-521.726) (-523.616) [-525.022] (-527.474) * (-525.352) [-518.250] (-522.347) (-524.436) -- 0:00:00
       1000 -- (-519.276) (-516.937) [-519.868] (-517.446) * (-530.194) (-521.913) (-522.970) [-515.891] -- 0:00:00
       1500 -- [-521.024] (-522.301) (-521.270) (-516.163) * (-520.143) (-518.496) [-518.337] (-520.304) -- 0:00:00
       2000 -- (-518.633) (-522.080) [-519.608] (-518.978) * (-522.450) (-520.261) (-520.828) [-516.951] -- 0:00:00
       2500 -- [-514.348] (-516.521) (-519.609) (-521.933) * [-514.656] (-516.383) (-518.374) (-521.689) -- 0:00:00
       3000 -- (-519.709) (-519.459) (-522.821) [-521.423] * (-521.038) [-517.917] (-526.745) (-516.799) -- 0:00:00
       3500 -- (-530.681) (-516.677) (-526.783) [-516.153] * [-523.320] (-520.839) (-519.711) (-525.442) -- 0:00:00
       4000 -- (-522.512) (-519.987) [-518.163] (-523.270) * (-521.365) (-520.446) [-516.784] (-525.511) -- 0:00:00
       4500 -- [-518.325] (-539.786) (-520.628) (-523.243) * (-521.046) (-527.066) (-526.418) [-521.326] -- 0:00:00
       5000 -- (-513.912) [-524.418] (-515.933) (-529.344) * (-522.573) (-522.589) (-514.789) [-514.972] -- 0:00:00

      Average standard deviation of split frequencies: 0.104757

       5500 -- (-521.133) (-520.322) [-522.753] (-514.790) * (-517.963) (-517.099) (-524.456) [-518.839] -- 0:00:00
       6000 -- (-530.791) (-519.738) [-518.344] (-526.874) * (-519.263) [-516.981] (-516.753) (-517.571) -- 0:00:00
       6500 -- (-520.695) (-518.243) (-523.287) [-520.544] * (-523.229) (-517.310) (-515.865) [-521.679] -- 0:00:00
       7000 -- [-522.320] (-518.567) (-519.841) (-520.868) * [-518.717] (-516.965) (-515.502) (-514.128) -- 0:02:21
       7500 -- (-523.958) (-525.818) [-515.921] (-517.644) * [-517.648] (-517.204) (-523.944) (-518.713) -- 0:02:12
       8000 -- [-519.553] (-514.426) (-522.724) (-524.674) * (-525.523) (-516.075) [-516.783] (-519.085) -- 0:02:04
       8500 -- [-515.277] (-517.103) (-520.676) (-514.705) * (-515.239) (-523.368) (-527.942) [-519.829] -- 0:01:56
       9000 -- (-521.753) (-526.838) (-517.422) [-519.028] * [-522.609] (-517.506) (-527.876) (-516.620) -- 0:01:50
       9500 -- (-516.716) [-520.655] (-519.268) (-527.545) * [-516.296] (-521.844) (-528.500) (-521.210) -- 0:01:44
      10000 -- (-518.173) [-519.914] (-526.478) (-523.430) * (-522.530) (-529.683) (-517.224) [-519.223] -- 0:01:39

      Average standard deviation of split frequencies: 0.048846

      10500 -- [-525.966] (-510.580) (-518.732) (-523.953) * [-516.143] (-520.620) (-524.672) (-527.945) -- 0:01:34
      11000 -- (-515.811) (-509.567) [-521.510] (-524.385) * (-527.167) (-520.872) [-521.341] (-524.265) -- 0:01:29
      11500 -- (-517.818) (-509.835) [-522.373] (-522.079) * (-518.306) [-524.239] (-525.532) (-519.990) -- 0:01:25
      12000 -- (-523.354) [-510.130] (-517.400) (-525.168) * (-525.762) (-517.709) [-524.877] (-524.277) -- 0:01:22
      12500 -- (-516.307) [-509.672] (-517.581) (-535.113) * (-530.455) [-517.517] (-511.841) (-519.251) -- 0:01:19
      13000 -- (-523.674) [-510.452] (-525.932) (-524.279) * (-515.934) [-518.322] (-511.024) (-514.327) -- 0:01:15
      13500 -- (-511.595) (-510.922) [-519.051] (-510.406) * (-517.812) (-526.302) [-515.859] (-520.783) -- 0:01:13
      14000 -- (-512.838) (-511.085) [-517.748] (-509.951) * (-522.089) (-528.575) (-511.581) [-514.819] -- 0:01:10
      14500 -- (-513.920) (-508.911) (-538.807) [-509.513] * [-518.388] (-523.404) (-510.122) (-521.537) -- 0:01:07
      15000 -- (-511.727) [-509.234] (-524.506) (-510.824) * (-525.018) (-514.848) [-512.256] (-517.186) -- 0:01:05

      Average standard deviation of split frequencies: 0.062027

      15500 -- (-513.058) [-509.383] (-515.675) (-510.672) * (-521.227) [-515.164] (-511.173) (-526.156) -- 0:01:03
      16000 -- (-512.392) (-511.201) [-510.404] (-511.557) * [-515.150] (-513.800) (-514.129) (-525.684) -- 0:01:01
      16500 -- (-509.593) (-511.432) (-511.248) [-509.985] * (-517.669) (-521.725) (-510.577) [-519.549] -- 0:00:59
      17000 -- (-509.705) (-511.932) [-509.456] (-512.293) * (-541.624) (-525.948) (-510.320) [-520.494] -- 0:00:57
      17500 -- (-511.565) [-509.692] (-509.343) (-511.576) * (-524.550) (-522.479) [-508.498] (-517.319) -- 0:00:56
      18000 -- (-508.944) [-512.338] (-513.726) (-509.382) * (-512.326) (-521.259) [-510.534] (-516.825) -- 0:00:54
      18500 -- (-509.103) (-512.241) [-509.326] (-510.558) * (-514.262) (-519.653) (-511.233) [-517.747] -- 0:00:53
      19000 -- (-510.027) [-509.322] (-510.663) (-510.853) * [-512.387] (-522.386) (-508.307) (-523.976) -- 0:00:51
      19500 -- (-510.333) (-512.851) (-511.100) [-509.745] * (-510.733) [-516.198] (-509.343) (-516.016) -- 0:00:50
      20000 -- [-513.336] (-513.415) (-511.280) (-510.483) * (-508.972) [-520.434] (-511.683) (-519.272) -- 0:00:49

      Average standard deviation of split frequencies: 0.046820

      20500 -- (-512.472) [-510.142] (-511.502) (-509.659) * (-512.845) (-523.280) (-513.865) [-518.646] -- 0:00:47
      21000 -- (-511.637) (-508.754) (-511.239) [-512.138] * [-509.983] (-521.665) (-510.586) (-521.789) -- 0:00:46
      21500 -- [-511.056] (-509.057) (-510.790) (-511.257) * [-509.118] (-518.475) (-511.026) (-521.836) -- 0:00:45
      22000 -- (-509.582) (-512.302) (-509.526) [-509.741] * (-510.617) (-518.824) [-510.964] (-518.555) -- 0:00:44
      22500 -- (-511.240) (-511.069) (-510.199) [-509.523] * (-510.359) (-526.909) (-510.151) [-517.859] -- 0:00:43
      23000 -- (-513.062) (-509.755) [-511.126] (-513.152) * [-514.385] (-516.706) (-511.119) (-537.042) -- 0:00:42
      23500 -- [-511.571] (-510.472) (-510.356) (-510.719) * (-513.088) [-516.510] (-509.724) (-517.365) -- 0:00:41
      24000 -- [-510.771] (-515.694) (-510.691) (-509.091) * (-509.274) (-524.934) (-513.216) [-523.350] -- 0:01:21
      24500 -- (-509.599) [-513.029] (-509.309) (-509.716) * [-508.802] (-516.997) (-513.753) (-531.960) -- 0:01:19
      25000 -- (-511.669) [-511.233] (-512.580) (-509.828) * (-511.712) (-522.720) [-510.103] (-526.925) -- 0:01:18

      Average standard deviation of split frequencies: 0.041442

      25500 -- (-511.681) [-510.166] (-509.990) (-511.981) * (-509.368) (-517.105) [-510.452] (-524.861) -- 0:01:16
      26000 -- (-512.308) [-511.378] (-514.865) (-511.944) * (-509.654) (-521.925) [-510.477] (-518.134) -- 0:01:14
      26500 -- (-514.033) [-511.704] (-509.762) (-512.588) * (-509.116) (-525.830) [-511.643] (-516.111) -- 0:01:13
      27000 -- (-510.850) (-512.137) (-509.814) [-508.745] * (-509.210) (-521.250) [-510.695] (-516.742) -- 0:01:12
      27500 -- (-509.602) [-509.902] (-509.518) (-509.514) * (-511.678) (-516.222) (-509.575) [-513.673] -- 0:01:10
      28000 -- [-509.800] (-512.170) (-512.397) (-510.221) * (-514.336) (-519.443) (-509.366) [-517.125] -- 0:01:09
      28500 -- (-509.525) [-510.667] (-508.390) (-509.649) * [-509.452] (-533.171) (-509.818) (-513.806) -- 0:01:08
      29000 -- (-515.493) [-510.378] (-509.283) (-509.095) * (-509.938) [-517.747] (-514.050) (-523.723) -- 0:01:06
      29500 -- [-511.711] (-515.666) (-509.362) (-509.613) * (-509.434) (-517.907) (-513.498) [-514.576] -- 0:01:05
      30000 -- (-511.112) (-509.781) [-510.184] (-511.621) * (-509.671) (-518.497) [-514.134] (-520.863) -- 0:01:04

      Average standard deviation of split frequencies: 0.034587

      30500 -- [-510.818] (-511.275) (-510.928) (-509.218) * (-511.585) (-526.648) (-509.562) [-522.085] -- 0:01:03
      31000 -- (-513.604) (-510.781) (-510.750) [-510.598] * (-511.738) (-522.725) (-509.078) [-521.083] -- 0:01:02
      31500 -- (-510.080) (-514.509) (-509.111) [-512.262] * (-509.094) (-523.867) [-509.373] (-516.384) -- 0:01:01
      32000 -- (-512.421) (-510.900) (-510.364) [-509.160] * (-508.580) (-525.325) (-509.749) [-514.746] -- 0:01:00
      32500 -- (-509.763) [-509.788] (-510.454) (-511.053) * (-509.309) (-519.904) (-511.133) [-520.513] -- 0:00:59
      33000 -- [-510.158] (-512.107) (-511.744) (-509.396) * (-511.491) (-531.819) [-511.871] (-519.790) -- 0:00:58
      33500 -- [-509.527] (-511.087) (-510.251) (-511.672) * (-509.888) (-523.238) (-513.699) [-521.301] -- 0:00:57
      34000 -- [-508.870] (-510.036) (-509.626) (-509.273) * (-511.309) [-522.894] (-512.741) (-520.020) -- 0:00:56
      34500 -- (-510.561) [-511.128] (-508.794) (-509.697) * (-513.250) [-516.318] (-512.196) (-516.721) -- 0:00:55
      35000 -- (-510.456) [-509.946] (-511.113) (-509.796) * [-510.753] (-522.480) (-509.407) (-520.031) -- 0:00:55

      Average standard deviation of split frequencies: 0.033770

      35500 -- (-512.306) [-509.048] (-511.222) (-509.603) * (-511.128) (-522.566) (-512.088) [-515.978] -- 0:00:54
      36000 -- (-510.325) [-510.800] (-515.289) (-512.332) * (-512.810) (-516.643) (-510.649) [-522.958] -- 0:00:53
      36500 -- [-511.977] (-510.608) (-513.825) (-509.330) * [-509.311] (-526.423) (-509.793) (-521.949) -- 0:00:52
      37000 -- (-512.012) [-509.017] (-513.721) (-510.907) * [-509.227] (-522.408) (-509.546) (-522.493) -- 0:00:52
      37500 -- (-514.103) (-509.027) (-509.993) [-511.885] * [-511.283] (-520.211) (-512.577) (-522.666) -- 0:00:51
      38000 -- (-509.767) (-510.909) [-511.247] (-508.817) * (-514.184) [-522.182] (-511.279) (-523.835) -- 0:01:15
      38500 -- (-511.319) [-509.617] (-509.628) (-508.714) * (-512.779) [-517.760] (-517.376) (-519.789) -- 0:01:14
      39000 -- (-509.614) (-511.131) (-510.857) [-509.085] * [-509.220] (-520.851) (-510.957) (-519.958) -- 0:01:13
      39500 -- (-509.309) (-512.214) (-513.814) [-513.833] * (-508.770) (-519.602) [-511.440] (-523.680) -- 0:01:12
      40000 -- (-510.009) (-509.856) (-513.519) [-510.020] * [-508.773] (-524.020) (-509.900) (-516.442) -- 0:01:12

      Average standard deviation of split frequencies: 0.030505

      40500 -- [-511.519] (-515.282) (-514.594) (-510.799) * (-509.274) (-525.735) [-510.480] (-518.846) -- 0:01:11
      41000 -- (-510.734) [-510.171] (-510.802) (-509.394) * (-508.729) [-528.581] (-512.412) (-521.613) -- 0:01:10
      41500 -- (-509.774) (-509.345) (-510.411) [-510.187] * (-510.095) (-516.859) [-511.860] (-520.762) -- 0:01:09
      42000 -- (-509.177) (-508.798) (-515.441) [-508.301] * (-510.422) [-510.064] (-512.926) (-515.276) -- 0:01:08
      42500 -- (-511.126) [-512.679] (-511.821) (-514.643) * (-511.415) [-510.214] (-512.098) (-520.059) -- 0:01:07
      43000 -- (-510.565) (-508.963) (-511.050) [-510.357] * (-512.634) (-510.277) [-510.362] (-517.886) -- 0:01:06
      43500 -- (-512.531) [-513.996] (-512.491) (-513.082) * (-510.707) (-511.670) [-508.570] (-523.108) -- 0:01:05
      44000 -- (-511.218) (-510.533) (-514.027) [-510.044] * (-512.298) (-513.277) (-510.205) [-519.200] -- 0:01:05
      44500 -- (-510.440) (-510.133) (-508.934) [-513.518] * (-511.750) (-509.338) [-510.575] (-517.870) -- 0:01:04
      45000 -- [-508.648] (-511.148) (-509.686) (-510.801) * (-510.725) (-512.240) (-514.181) [-527.898] -- 0:01:03

      Average standard deviation of split frequencies: 0.026840

      45500 -- [-508.933] (-508.642) (-509.817) (-509.702) * (-515.472) [-512.511] (-509.209) (-519.898) -- 0:01:02
      46000 -- [-508.727] (-512.048) (-509.531) (-510.632) * (-510.580) (-510.597) [-511.758] (-529.521) -- 0:01:02
      46500 -- (-508.437) (-510.178) (-512.213) [-509.371] * [-509.746] (-511.090) (-511.010) (-517.532) -- 0:01:01
      47000 -- (-509.205) [-509.273] (-509.733) (-510.585) * [-510.055] (-508.847) (-510.734) (-527.495) -- 0:01:00
      47500 -- (-509.125) (-509.551) [-508.768] (-510.706) * (-509.264) (-510.960) [-510.988] (-527.549) -- 0:01:00
      48000 -- (-509.291) (-509.531) [-509.782] (-512.466) * (-509.097) (-508.836) [-508.852] (-518.800) -- 0:00:59
      48500 -- (-508.985) (-510.822) [-514.762] (-510.625) * [-510.002] (-509.021) (-513.680) (-525.548) -- 0:00:58
      49000 -- (-510.357) (-510.174) (-514.635) [-511.244] * (-510.275) (-509.254) [-512.141] (-520.588) -- 0:00:58
      49500 -- (-509.821) (-510.978) [-510.753] (-508.586) * (-510.163) (-511.046) (-515.051) [-525.252] -- 0:00:57
      50000 -- (-511.732) (-510.447) [-509.749] (-510.762) * [-510.329] (-513.063) (-509.182) (-515.938) -- 0:00:57

      Average standard deviation of split frequencies: 0.023925

      50500 -- [-509.835] (-509.188) (-510.943) (-510.917) * (-512.202) (-517.931) (-509.003) [-515.503] -- 0:00:56
      51000 -- [-511.240] (-510.614) (-512.333) (-509.972) * (-510.767) [-514.745] (-509.315) (-519.502) -- 0:00:55
      51500 -- (-512.674) [-512.662] (-509.017) (-513.319) * [-511.912] (-510.822) (-509.470) (-526.882) -- 0:00:55
      52000 -- (-511.005) (-510.882) (-515.137) [-510.209] * (-509.757) [-508.936] (-510.227) (-512.355) -- 0:00:54
      52500 -- [-509.819] (-514.174) (-512.729) (-510.347) * (-513.096) (-510.508) (-509.318) [-514.327] -- 0:00:54
      53000 -- (-516.764) [-510.305] (-510.145) (-510.641) * (-514.916) (-509.118) (-510.273) [-512.121] -- 0:00:53
      53500 -- (-513.644) (-509.127) [-510.243] (-511.981) * (-512.429) [-510.975] (-510.274) (-511.489) -- 0:00:53
      54000 -- (-510.466) (-510.041) (-511.954) [-513.188] * (-511.794) (-510.232) (-513.498) [-510.290] -- 0:00:52
      54500 -- (-511.459) (-511.618) (-514.251) [-509.787] * (-509.752) (-509.320) (-509.991) [-511.313] -- 0:01:09
      55000 -- [-511.791] (-515.667) (-510.743) (-509.056) * (-511.225) (-509.264) (-512.398) [-510.797] -- 0:01:08

      Average standard deviation of split frequencies: 0.027779

      55500 -- (-513.489) [-509.807] (-517.070) (-509.200) * (-514.489) (-509.406) (-512.878) [-510.381] -- 0:01:08
      56000 -- (-515.536) (-510.101) (-511.349) [-509.277] * (-514.829) [-509.239] (-510.715) (-511.521) -- 0:01:07
      56500 -- (-514.633) (-509.902) (-511.414) [-510.566] * (-508.728) (-509.935) [-509.662] (-510.217) -- 0:01:06
      57000 -- [-511.450] (-509.308) (-513.877) (-511.659) * (-510.355) (-510.228) [-510.371] (-511.414) -- 0:01:06
      57500 -- (-512.487) (-511.787) [-510.287] (-509.787) * (-509.111) (-511.742) [-510.140] (-509.745) -- 0:01:05
      58000 -- [-510.922] (-510.724) (-508.916) (-508.965) * (-509.224) (-510.527) [-509.588] (-508.489) -- 0:01:04
      58500 -- (-509.943) [-510.900] (-508.559) (-510.405) * (-508.599) [-510.152] (-510.739) (-509.490) -- 0:01:04
      59000 -- (-511.900) [-510.309] (-510.437) (-515.407) * (-512.520) (-510.373) (-511.828) [-511.825] -- 0:01:03
      59500 -- [-512.110] (-512.473) (-508.709) (-515.376) * (-510.315) (-511.030) [-508.503] (-512.077) -- 0:01:03
      60000 -- (-508.820) [-510.056] (-512.071) (-510.727) * (-509.850) (-508.532) [-509.261] (-511.486) -- 0:01:02

      Average standard deviation of split frequencies: 0.027585

      60500 -- (-509.243) [-511.596] (-511.822) (-512.918) * (-509.354) [-509.948] (-512.766) (-514.111) -- 0:01:02
      61000 -- (-509.720) [-509.616] (-511.413) (-509.844) * (-509.358) (-509.902) (-510.090) [-510.968] -- 0:01:01
      61500 -- (-513.632) [-512.685] (-510.565) (-508.957) * (-511.310) [-510.074] (-510.144) (-511.213) -- 0:01:01
      62000 -- (-513.816) (-509.037) (-511.132) [-509.376] * [-509.982] (-512.333) (-509.720) (-512.347) -- 0:01:00
      62500 -- (-510.512) [-509.549] (-509.776) (-509.273) * [-508.943] (-511.385) (-510.730) (-513.380) -- 0:01:00
      63000 -- (-510.731) (-508.958) (-514.606) [-510.088] * (-513.537) (-511.173) [-510.594] (-510.517) -- 0:00:59
      63500 -- (-508.786) (-510.573) [-510.878] (-511.658) * (-512.770) (-509.742) (-515.353) [-510.691] -- 0:00:58
      64000 -- (-509.702) (-509.981) [-509.761] (-511.201) * (-510.286) (-511.418) (-513.033) [-509.486] -- 0:00:58
      64500 -- (-511.191) (-509.619) (-512.308) [-508.768] * (-510.653) [-509.792] (-509.775) (-511.473) -- 0:00:58
      65000 -- (-514.472) [-509.307] (-510.459) (-513.287) * [-510.019] (-510.442) (-511.112) (-512.215) -- 0:00:57

      Average standard deviation of split frequencies: 0.024999

      65500 -- (-510.856) (-511.367) (-511.128) [-509.464] * (-511.927) (-509.748) [-509.386] (-513.308) -- 0:00:57
      66000 -- [-511.775] (-511.217) (-512.733) (-509.696) * [-509.596] (-508.890) (-508.623) (-512.317) -- 0:00:56
      66500 -- (-513.850) (-509.311) [-510.829] (-514.884) * [-510.134] (-509.844) (-511.406) (-509.673) -- 0:00:56
      67000 -- [-509.903] (-509.900) (-510.656) (-510.448) * [-509.855] (-511.427) (-510.964) (-508.724) -- 0:00:55
      67500 -- (-517.544) [-510.818] (-513.637) (-509.900) * (-510.434) [-512.297] (-508.944) (-509.424) -- 0:00:55
      68000 -- (-514.468) (-511.773) [-510.877] (-509.961) * (-509.952) (-512.194) (-513.668) [-511.118] -- 0:00:54
      68500 -- [-510.923] (-508.510) (-511.309) (-511.618) * (-511.817) (-511.799) [-510.604] (-512.216) -- 0:00:54
      69000 -- (-510.310) (-510.080) [-510.145] (-513.354) * (-511.819) [-512.367] (-512.358) (-512.298) -- 0:00:53
      69500 -- (-509.516) (-512.939) (-509.967) [-511.913] * (-511.271) (-510.262) (-513.592) [-510.995] -- 0:00:53
      70000 -- [-511.513] (-512.801) (-511.923) (-512.205) * (-510.707) (-512.338) [-509.230] (-510.196) -- 0:00:53

      Average standard deviation of split frequencies: 0.029860

      70500 -- (-511.385) [-512.625] (-510.970) (-509.524) * [-510.334] (-512.242) (-511.840) (-511.499) -- 0:00:52
      71000 -- (-517.596) (-509.394) [-509.789] (-509.992) * (-509.282) (-510.767) (-509.068) [-510.714] -- 0:01:05
      71500 -- (-512.807) (-509.023) (-511.578) [-509.126] * (-510.990) (-509.570) (-509.039) [-513.090] -- 0:01:04
      72000 -- (-513.934) (-509.460) (-510.028) [-511.149] * (-510.048) (-510.808) (-509.162) [-510.791] -- 0:01:04
      72500 -- (-511.784) (-510.577) [-512.503] (-510.044) * (-509.445) (-509.445) (-509.089) [-511.011] -- 0:01:03
      73000 -- (-510.329) (-509.641) (-510.154) [-508.952] * (-508.779) (-513.797) [-509.280] (-518.112) -- 0:01:03
      73500 -- (-509.704) (-510.042) (-511.731) [-509.340] * (-510.555) [-509.096] (-510.952) (-516.182) -- 0:01:03
      74000 -- (-509.563) [-517.713] (-509.312) (-510.525) * (-510.332) [-510.384] (-510.282) (-513.143) -- 0:01:02
      74500 -- (-509.582) (-514.879) (-508.561) [-514.983] * [-510.074] (-509.929) (-510.781) (-508.702) -- 0:01:02
      75000 -- (-509.800) [-510.804] (-510.731) (-510.019) * (-509.193) (-510.491) (-509.992) [-508.913] -- 0:01:01

      Average standard deviation of split frequencies: 0.029708

      75500 -- (-511.810) (-511.896) [-508.697] (-510.790) * (-511.319) [-512.239] (-509.705) (-510.857) -- 0:01:01
      76000 -- [-510.468] (-518.724) (-510.226) (-509.315) * (-509.213) (-509.785) (-511.822) [-508.410] -- 0:01:00
      76500 -- [-509.308] (-516.704) (-510.575) (-512.402) * (-508.906) [-509.883] (-509.641) (-510.922) -- 0:01:00
      77000 -- (-515.263) [-509.036] (-512.674) (-508.382) * (-509.745) [-509.438] (-509.832) (-512.749) -- 0:00:59
      77500 -- (-512.637) [-510.765] (-511.035) (-509.261) * (-515.695) (-511.809) [-508.945] (-513.584) -- 0:00:59
      78000 -- (-512.162) (-509.644) (-509.425) [-508.925] * (-510.564) [-511.787] (-510.523) (-511.532) -- 0:00:59
      78500 -- (-514.669) (-510.634) (-508.596) [-509.639] * [-510.443] (-508.606) (-510.069) (-512.172) -- 0:00:58
      79000 -- (-511.165) [-508.806] (-511.114) (-509.835) * (-514.468) (-511.713) (-512.614) [-509.936] -- 0:00:58
      79500 -- (-509.018) [-510.612] (-514.288) (-510.299) * (-510.236) (-516.662) (-512.571) [-510.188] -- 0:00:57
      80000 -- (-510.202) (-511.204) (-508.912) [-511.359] * (-508.902) [-510.909] (-509.361) (-509.826) -- 0:00:57

      Average standard deviation of split frequencies: 0.031372

      80500 -- (-510.844) (-514.174) [-508.746] (-508.994) * (-510.873) [-510.065] (-509.179) (-511.089) -- 0:00:57
      81000 -- [-510.561] (-513.588) (-509.636) (-518.140) * [-510.731] (-509.565) (-510.427) (-512.903) -- 0:00:56
      81500 -- [-513.895] (-513.361) (-508.874) (-516.300) * [-509.597] (-511.758) (-509.511) (-509.565) -- 0:00:56
      82000 -- (-512.335) (-512.176) (-508.936) [-509.129] * (-511.713) [-511.298] (-511.620) (-509.454) -- 0:00:55
      82500 -- (-512.700) (-510.198) [-509.412] (-512.015) * [-510.061] (-515.286) (-512.212) (-512.247) -- 0:00:55
      83000 -- [-509.333] (-510.492) (-510.407) (-512.055) * (-510.101) (-514.680) (-509.080) [-509.056] -- 0:00:55
      83500 -- [-509.254] (-508.889) (-511.944) (-514.057) * [-510.020] (-509.824) (-509.945) (-510.470) -- 0:00:54
      84000 -- (-509.025) (-508.899) [-509.733] (-512.103) * (-509.715) (-509.238) [-514.347] (-510.334) -- 0:00:54
      84500 -- (-509.937) [-509.600] (-512.309) (-513.337) * (-510.808) (-508.835) (-508.763) [-508.892] -- 0:00:54
      85000 -- (-511.033) (-511.193) (-511.088) [-509.569] * (-510.931) (-509.961) (-510.875) [-508.756] -- 0:00:53

      Average standard deviation of split frequencies: 0.028273

      85500 -- (-512.484) (-510.506) [-510.407] (-511.093) * [-509.258] (-509.574) (-509.931) (-509.985) -- 0:00:53
      86000 -- (-509.038) [-508.892] (-509.756) (-512.882) * (-510.257) (-513.822) (-510.235) [-508.864] -- 0:00:53
      86500 -- (-508.822) [-512.397] (-510.912) (-512.095) * (-509.090) [-510.759] (-510.394) (-509.756) -- 0:00:52
      87000 -- (-508.907) [-510.678] (-511.071) (-513.832) * [-509.981] (-511.285) (-509.512) (-509.996) -- 0:00:52
      87500 -- [-510.759] (-513.616) (-510.144) (-513.007) * (-510.755) [-511.488] (-510.547) (-511.052) -- 0:01:02
      88000 -- (-511.427) (-510.192) (-512.385) [-509.393] * (-509.719) [-509.862] (-508.945) (-513.434) -- 0:01:02
      88500 -- (-509.178) [-511.025] (-511.352) (-509.622) * [-511.489] (-509.864) (-510.013) (-509.291) -- 0:01:01
      89000 -- [-509.028] (-510.184) (-509.551) (-509.341) * [-510.365] (-511.020) (-512.139) (-510.410) -- 0:01:01
      89500 -- [-511.065] (-509.123) (-509.060) (-511.508) * (-511.678) (-511.850) (-511.034) [-509.396] -- 0:01:01
      90000 -- (-510.268) (-509.085) (-510.487) [-509.349] * (-512.686) (-510.174) [-509.009] (-513.708) -- 0:01:00

      Average standard deviation of split frequencies: 0.025176

      90500 -- (-509.807) (-509.643) [-509.573] (-508.448) * (-509.384) (-511.601) [-515.652] (-513.980) -- 0:01:00
      91000 -- [-510.500] (-511.135) (-511.753) (-509.242) * (-509.543) (-511.014) (-512.451) [-509.216] -- 0:00:59
      91500 -- (-510.719) (-512.098) [-508.871] (-510.034) * (-509.554) (-511.522) [-512.072] (-509.820) -- 0:00:59
      92000 -- [-512.783] (-511.529) (-512.047) (-510.148) * (-512.110) (-509.009) [-509.288] (-511.097) -- 0:00:59
      92500 -- (-512.705) (-511.528) [-508.963] (-508.898) * (-510.269) (-511.860) (-510.784) [-510.440] -- 0:00:58
      93000 -- (-510.969) [-511.324] (-509.972) (-510.595) * (-508.872) [-511.312] (-509.898) (-515.624) -- 0:00:58
      93500 -- (-513.467) [-508.999] (-510.994) (-510.246) * (-509.076) [-510.883] (-508.748) (-510.250) -- 0:00:58
      94000 -- (-512.031) [-508.573] (-509.870) (-511.260) * [-511.817] (-509.932) (-512.062) (-509.471) -- 0:00:57
      94500 -- (-508.890) (-509.289) [-509.081] (-510.804) * (-511.018) [-511.919] (-511.528) (-512.124) -- 0:00:57
      95000 -- (-513.573) (-510.264) [-509.864] (-513.509) * (-512.633) (-508.984) [-511.149] (-509.391) -- 0:00:57

      Average standard deviation of split frequencies: 0.025328

      95500 -- [-509.617] (-510.786) (-513.895) (-509.343) * (-512.468) [-509.409] (-509.916) (-509.953) -- 0:00:56
      96000 -- (-520.205) (-510.308) [-509.386] (-510.103) * (-513.794) [-509.463] (-510.906) (-511.745) -- 0:00:56
      96500 -- [-508.945] (-510.335) (-513.232) (-509.885) * (-511.043) (-510.008) [-510.363] (-509.891) -- 0:00:56
      97000 -- [-509.427] (-509.208) (-513.598) (-509.356) * (-515.681) (-511.068) [-508.943] (-510.482) -- 0:00:55
      97500 -- (-510.011) (-508.980) (-513.650) [-508.354] * (-514.599) (-511.344) [-508.884] (-510.087) -- 0:00:55
      98000 -- (-513.764) (-509.619) [-509.395] (-509.157) * (-509.062) (-509.175) (-512.381) [-508.910] -- 0:00:55
      98500 -- (-508.825) (-513.230) [-508.987] (-509.157) * [-509.937] (-511.064) (-510.960) (-514.153) -- 0:00:54
      99000 -- (-510.967) (-513.170) [-511.066] (-510.103) * (-511.202) [-511.848] (-512.837) (-512.280) -- 0:00:54
      99500 -- (-515.880) (-513.810) [-510.357] (-509.050) * [-514.523] (-509.591) (-508.634) (-510.919) -- 0:00:54
      100000 -- [-510.917] (-510.348) (-512.238) (-511.156) * (-511.653) (-511.523) [-509.155] (-511.687) -- 0:00:54

      Average standard deviation of split frequencies: 0.026016

      100500 -- (-508.624) (-513.301) (-513.270) [-509.677] * (-510.521) [-509.243] (-508.868) (-510.648) -- 0:00:53
      101000 -- [-510.663] (-510.406) (-511.456) (-509.310) * (-508.711) (-509.586) [-509.415] (-508.529) -- 0:00:53
      101500 -- [-509.597] (-518.477) (-513.477) (-512.965) * (-511.761) [-512.011] (-508.650) (-511.781) -- 0:00:53
      102000 -- (-510.807) (-516.621) [-510.318] (-509.103) * (-510.477) [-511.206] (-510.658) (-522.538) -- 0:00:52
      102500 -- (-513.686) (-508.980) [-511.922] (-511.798) * (-512.949) [-509.312] (-510.079) (-511.812) -- 0:00:52
      103000 -- (-513.108) (-510.909) [-510.256] (-511.512) * (-510.800) [-510.696] (-512.996) (-510.777) -- 0:00:52
      103500 -- [-509.381] (-508.321) (-513.948) (-511.009) * [-509.275] (-509.847) (-510.211) (-510.763) -- 0:00:51
      104000 -- (-516.503) [-512.910] (-510.329) (-508.618) * (-509.192) (-510.034) (-509.415) [-510.594] -- 0:00:51
      104500 -- (-511.579) (-513.009) [-512.177] (-510.594) * (-511.052) (-512.934) (-509.740) [-509.798] -- 0:00:59
      105000 -- (-509.981) (-513.897) (-513.805) [-510.790] * (-508.636) [-508.690] (-511.132) (-514.858) -- 0:00:59

      Average standard deviation of split frequencies: 0.022236

      105500 -- (-509.736) [-511.399] (-510.755) (-510.881) * [-510.196] (-511.380) (-509.627) (-519.367) -- 0:00:59
      106000 -- (-514.826) [-509.088] (-510.582) (-508.420) * (-509.662) [-511.377] (-510.514) (-513.732) -- 0:00:59
      106500 -- [-509.580] (-510.820) (-509.873) (-509.411) * [-510.225] (-512.141) (-514.639) (-513.097) -- 0:00:58
      107000 -- [-509.998] (-511.522) (-510.603) (-510.097) * [-509.307] (-512.690) (-509.689) (-511.252) -- 0:00:58
      107500 -- (-510.664) [-510.191] (-511.315) (-508.710) * (-510.002) (-515.166) [-509.009] (-509.555) -- 0:00:58
      108000 -- (-510.253) [-510.384] (-514.398) (-510.498) * (-511.816) (-514.572) [-508.344] (-512.483) -- 0:00:57
      108500 -- (-509.578) (-511.336) [-513.119] (-509.972) * (-511.803) [-509.450] (-510.781) (-510.978) -- 0:00:57
      109000 -- (-509.215) (-510.251) [-509.487] (-513.196) * (-511.350) [-510.287] (-511.538) (-513.704) -- 0:00:57
      109500 -- (-508.884) (-510.276) [-510.786] (-509.243) * (-509.587) (-510.700) (-512.151) [-511.387] -- 0:00:56
      110000 -- (-511.145) (-510.601) [-512.929] (-508.861) * (-509.693) (-510.597) (-509.345) [-510.589] -- 0:00:56

      Average standard deviation of split frequencies: 0.020402

      110500 -- (-512.257) [-510.902] (-510.572) (-508.749) * [-509.957] (-512.015) (-512.815) (-509.969) -- 0:00:56
      111000 -- [-510.134] (-510.078) (-515.521) (-509.183) * (-510.310) (-509.369) [-509.620] (-509.518) -- 0:00:56
      111500 -- (-509.059) (-510.914) (-519.801) [-509.277] * (-509.644) (-509.364) (-511.613) [-511.677] -- 0:00:55
      112000 -- (-509.339) (-510.980) (-515.919) [-509.710] * (-510.364) (-510.295) (-508.925) [-510.437] -- 0:00:55
      112500 -- [-509.180] (-513.611) (-509.522) (-508.519) * (-514.613) (-511.632) (-508.866) [-512.220] -- 0:00:55
      113000 -- (-509.034) (-514.857) (-512.010) [-508.928] * [-511.458] (-511.913) (-510.735) (-511.779) -- 0:00:54
      113500 -- (-508.932) (-509.346) (-510.569) [-510.073] * (-509.896) (-510.634) [-508.483] (-509.472) -- 0:00:54
      114000 -- (-508.541) (-509.686) (-510.675) [-512.974] * (-512.535) (-514.681) [-510.262] (-509.491) -- 0:00:54
      114500 -- (-511.201) [-510.835] (-510.624) (-511.818) * (-510.227) (-510.293) (-513.580) [-508.490] -- 0:00:54
      115000 -- (-512.824) [-509.414] (-510.127) (-509.347) * (-508.963) (-512.281) [-513.457] (-513.286) -- 0:00:53

      Average standard deviation of split frequencies: 0.022125

      115500 -- (-512.494) (-511.818) [-510.178] (-509.824) * (-509.009) [-511.740] (-512.882) (-509.250) -- 0:00:53
      116000 -- [-513.522] (-513.672) (-510.695) (-516.083) * (-512.955) (-512.037) [-511.966] (-511.103) -- 0:00:53
      116500 -- (-516.335) (-512.156) (-510.219) [-515.876] * [-510.073] (-509.230) (-508.768) (-512.738) -- 0:00:53
      117000 -- [-509.547] (-511.729) (-510.626) (-513.441) * [-511.021] (-510.345) (-508.942) (-508.709) -- 0:00:52
      117500 -- [-510.080] (-513.835) (-512.567) (-511.198) * (-514.828) [-510.259] (-509.570) (-509.258) -- 0:00:52
      118000 -- (-509.369) [-510.411] (-511.656) (-509.647) * [-511.503] (-509.013) (-511.087) (-511.122) -- 0:00:52
      118500 -- (-510.101) [-508.628] (-510.116) (-509.627) * (-509.375) (-510.171) [-513.158] (-510.087) -- 0:00:52
      119000 -- (-509.665) (-509.114) (-512.166) [-509.733] * (-510.354) (-517.392) [-512.266] (-511.879) -- 0:00:51
      119500 -- (-510.080) (-510.257) [-510.367] (-510.772) * (-510.296) (-513.471) (-512.199) [-509.922] -- 0:00:51
      120000 -- (-510.819) (-510.050) (-511.658) [-510.417] * (-509.436) (-512.722) (-511.455) [-512.176] -- 0:00:51

      Average standard deviation of split frequencies: 0.023223

      120500 -- (-514.693) [-510.898] (-510.655) (-511.004) * [-509.140] (-509.794) (-508.657) (-510.070) -- 0:00:58
      121000 -- (-512.634) [-512.742] (-515.142) (-510.371) * [-510.428] (-512.325) (-509.640) (-515.035) -- 0:00:58
      121500 -- [-515.751] (-509.110) (-512.343) (-509.442) * (-513.715) [-510.642] (-513.869) (-509.180) -- 0:00:57
      122000 -- [-509.792] (-510.619) (-513.600) (-512.788) * (-511.361) (-509.990) (-510.767) [-511.390] -- 0:00:57
      122500 -- [-509.692] (-508.642) (-509.580) (-509.517) * (-509.837) (-512.898) (-511.065) [-511.619] -- 0:00:57
      123000 -- (-508.563) (-510.024) [-510.413] (-510.521) * (-509.848) (-510.331) [-509.434] (-512.747) -- 0:00:57
      123500 -- (-512.773) (-512.987) [-510.693] (-510.533) * (-511.658) (-510.947) (-511.578) [-514.066] -- 0:00:56
      124000 -- (-510.615) (-509.362) (-509.689) [-510.251] * (-510.756) (-510.886) [-509.304] (-512.471) -- 0:00:56
      124500 -- (-509.559) [-510.092] (-511.125) (-509.833) * (-508.889) [-510.940] (-512.028) (-509.246) -- 0:00:56
      125000 -- (-511.815) (-511.169) [-510.886] (-509.571) * [-509.419] (-511.742) (-515.985) (-511.415) -- 0:00:56

      Average standard deviation of split frequencies: 0.020951

      125500 -- (-510.700) (-510.709) [-509.371] (-510.171) * (-512.672) [-511.486] (-511.825) (-510.410) -- 0:00:55
      126000 -- (-511.983) [-512.123] (-513.858) (-509.267) * (-512.712) (-511.937) (-511.389) [-508.904] -- 0:00:55
      126500 -- (-508.798) [-510.200] (-511.234) (-509.422) * (-511.930) (-511.234) [-508.992] (-511.044) -- 0:00:55
      127000 -- (-510.259) [-511.428] (-508.873) (-508.924) * (-509.377) [-511.216] (-511.784) (-511.075) -- 0:00:54
      127500 -- (-513.231) [-515.703] (-509.530) (-509.140) * [-514.656] (-511.538) (-509.041) (-509.669) -- 0:00:54
      128000 -- (-510.259) [-511.342] (-512.808) (-509.302) * [-510.717] (-512.174) (-509.387) (-511.375) -- 0:00:54
      128500 -- (-510.109) (-509.186) (-508.503) [-510.967] * (-508.781) (-509.163) [-514.049] (-508.336) -- 0:00:54
      129000 -- [-512.412] (-512.180) (-509.132) (-509.824) * [-508.932] (-509.854) (-514.084) (-509.155) -- 0:00:54
      129500 -- (-511.802) (-509.127) (-509.226) [-509.947] * [-509.368] (-510.595) (-512.168) (-509.065) -- 0:00:53
      130000 -- (-511.847) (-509.580) [-511.394] (-508.884) * (-514.728) (-509.853) [-510.612] (-511.011) -- 0:00:53

      Average standard deviation of split frequencies: 0.021646

      130500 -- (-511.881) [-511.555] (-511.403) (-508.973) * (-515.931) (-510.271) (-510.270) [-512.712] -- 0:00:53
      131000 -- [-509.889] (-508.694) (-511.472) (-508.663) * (-513.162) [-511.207] (-510.282) (-513.920) -- 0:00:53
      131500 -- [-510.169] (-508.951) (-510.368) (-509.393) * (-514.397) [-510.153] (-509.842) (-509.272) -- 0:00:52
      132000 -- (-512.187) (-510.644) (-511.172) [-511.107] * (-513.710) (-511.888) [-509.942] (-509.168) -- 0:00:52
      132500 -- [-510.837] (-511.918) (-509.307) (-511.436) * (-513.404) (-512.783) (-515.039) [-509.207] -- 0:00:52
      133000 -- [-512.027] (-515.214) (-510.328) (-511.944) * (-510.051) (-511.747) [-511.396] (-509.526) -- 0:00:52
      133500 -- (-509.887) (-514.712) (-509.891) [-511.092] * (-511.161) (-513.523) [-510.078] (-509.426) -- 0:00:51
      134000 -- [-513.339] (-513.279) (-512.844) (-509.682) * (-509.492) [-510.652] (-508.532) (-509.946) -- 0:00:51
      134500 -- (-510.697) [-515.230] (-513.773) (-509.158) * (-510.134) [-510.331] (-509.210) (-509.182) -- 0:00:51
      135000 -- (-508.940) (-513.418) [-511.705] (-508.978) * (-510.745) [-511.778] (-511.564) (-512.867) -- 0:00:51

      Average standard deviation of split frequencies: 0.022257

      135500 -- (-510.582) (-511.121) [-512.790] (-510.851) * (-512.597) [-508.609] (-510.080) (-511.064) -- 0:00:57
      136000 -- (-511.709) (-510.109) (-509.575) [-510.369] * [-509.842] (-509.620) (-510.255) (-514.086) -- 0:00:57
      136500 -- [-511.834] (-511.119) (-509.524) (-509.240) * [-510.835] (-511.603) (-511.967) (-510.305) -- 0:00:56
      137000 -- (-515.115) (-511.443) [-512.123] (-509.508) * [-509.216] (-508.491) (-511.955) (-511.398) -- 0:00:56
      137500 -- (-510.563) (-510.370) (-513.014) [-509.456] * (-508.876) [-513.136] (-509.434) (-513.934) -- 0:00:56
      138000 -- [-512.500] (-510.855) (-514.939) (-508.450) * [-512.423] (-514.223) (-510.452) (-509.989) -- 0:00:56
      138500 -- (-512.163) (-509.840) (-511.985) [-509.317] * (-511.153) (-513.160) (-511.593) [-510.886] -- 0:00:55
      139000 -- (-510.477) (-517.481) (-508.768) [-509.213] * (-509.843) (-510.166) (-514.017) [-511.816] -- 0:00:55
      139500 -- (-513.315) (-511.308) [-510.298] (-512.235) * (-510.091) [-510.546] (-510.889) (-511.595) -- 0:00:55
      140000 -- [-512.324] (-511.653) (-509.935) (-511.879) * (-509.121) (-510.858) (-511.740) [-509.013] -- 0:00:55

      Average standard deviation of split frequencies: 0.022753

      140500 -- (-509.993) [-512.141] (-511.408) (-509.959) * (-509.947) [-509.989] (-513.260) (-512.158) -- 0:00:55
      141000 -- (-512.362) [-511.400] (-511.848) (-510.780) * (-511.257) [-510.019] (-514.596) (-508.846) -- 0:00:54
      141500 -- (-509.428) (-509.010) [-510.184] (-510.529) * (-513.510) [-509.695] (-511.516) (-512.125) -- 0:00:54
      142000 -- (-508.943) (-511.415) (-512.425) [-510.935] * [-510.799] (-510.698) (-512.242) (-509.665) -- 0:00:54
      142500 -- (-508.582) (-512.752) [-511.441] (-511.235) * [-512.198] (-512.213) (-510.921) (-512.552) -- 0:00:54
      143000 -- (-510.198) (-509.501) [-508.680] (-512.524) * (-511.295) (-509.599) (-511.266) [-512.679] -- 0:00:53
      143500 -- [-509.029] (-511.603) (-509.960) (-509.759) * (-509.533) (-510.477) (-510.852) [-510.253] -- 0:00:53
      144000 -- (-509.735) (-509.077) (-513.862) [-508.648] * [-511.006] (-509.703) (-511.669) (-510.991) -- 0:00:53
      144500 -- (-512.211) (-511.623) [-508.724] (-509.581) * (-508.889) (-508.709) [-513.164] (-510.492) -- 0:00:53
      145000 -- (-511.693) (-509.278) [-510.449] (-508.624) * (-510.153) (-510.958) (-510.192) [-511.783] -- 0:00:53

      Average standard deviation of split frequencies: 0.023409

      145500 -- (-509.790) (-510.124) [-509.470] (-509.287) * (-510.688) (-512.750) (-510.774) [-510.910] -- 0:00:52
      146000 -- (-510.701) (-509.710) [-512.125] (-509.289) * (-511.363) (-511.637) (-509.509) [-509.414] -- 0:00:52
      146500 -- [-511.914] (-509.061) (-511.572) (-509.622) * [-510.900] (-512.768) (-513.204) (-509.406) -- 0:00:52
      147000 -- (-509.750) (-509.701) [-513.345] (-510.868) * (-510.668) [-512.296] (-512.550) (-509.803) -- 0:00:52
      147500 -- [-511.002] (-508.931) (-510.141) (-510.425) * [-509.741] (-510.504) (-512.569) (-513.945) -- 0:00:52
      148000 -- [-510.870] (-509.269) (-510.469) (-511.567) * [-511.194] (-509.196) (-512.790) (-510.596) -- 0:00:57
      148500 -- (-509.084) (-510.364) [-511.680] (-511.201) * (-513.449) [-508.580] (-511.126) (-511.239) -- 0:00:57
      149000 -- [-508.896] (-509.514) (-512.466) (-512.275) * (-512.225) (-509.648) (-509.869) [-509.060] -- 0:00:57
      149500 -- (-510.094) (-509.066) (-509.218) [-508.889] * (-509.959) (-511.024) (-511.518) [-514.185] -- 0:00:56
      150000 -- (-515.764) [-509.034] (-508.762) (-509.436) * (-512.364) [-509.567] (-513.656) (-511.024) -- 0:00:56

      Average standard deviation of split frequencies: 0.023935

      150500 -- (-516.757) (-509.746) (-509.784) [-509.171] * (-509.843) (-508.949) [-512.061] (-513.026) -- 0:00:56
      151000 -- (-512.367) [-512.496] (-510.324) (-509.425) * (-508.855) (-509.574) (-511.675) [-510.048] -- 0:00:56
      151500 -- (-512.765) [-511.178] (-512.684) (-511.337) * (-509.341) (-508.851) [-508.958] (-513.372) -- 0:00:56
      152000 -- (-510.615) [-510.557] (-517.258) (-513.485) * (-510.356) [-509.528] (-513.026) (-509.502) -- 0:00:55
      152500 -- (-508.974) (-512.402) (-514.296) [-511.807] * (-513.105) [-510.390] (-512.144) (-508.537) -- 0:00:55
      153000 -- [-511.202] (-512.234) (-509.006) (-511.324) * (-510.744) (-509.820) [-511.803] (-510.380) -- 0:00:55
      153500 -- [-514.004] (-510.409) (-513.900) (-509.375) * [-510.157] (-509.342) (-510.293) (-508.911) -- 0:00:55
      154000 -- (-512.351) (-512.089) (-513.139) [-509.361] * (-510.637) [-509.050] (-511.307) (-508.773) -- 0:00:54
      154500 -- [-509.415] (-510.013) (-510.826) (-510.935) * (-513.183) [-508.668] (-511.501) (-509.136) -- 0:00:54
      155000 -- (-513.271) (-513.479) (-509.565) [-509.254] * (-514.678) [-511.902] (-512.193) (-511.125) -- 0:00:54

      Average standard deviation of split frequencies: 0.022107

      155500 -- (-512.773) (-511.344) (-510.375) [-514.567] * (-509.844) (-512.547) (-512.038) [-509.133] -- 0:00:54
      156000 -- [-509.336] (-512.686) (-511.892) (-509.803) * (-510.666) [-512.131] (-509.842) (-509.155) -- 0:00:54
      156500 -- (-510.081) [-508.981] (-510.219) (-514.275) * (-509.436) [-510.005] (-512.461) (-509.612) -- 0:00:53
      157000 -- (-511.079) (-509.858) (-511.491) [-510.178] * [-511.490] (-513.928) (-511.902) (-508.907) -- 0:00:53
      157500 -- (-510.494) (-509.942) (-509.874) [-511.082] * (-511.917) (-512.202) (-508.874) [-510.126] -- 0:00:53
      158000 -- [-508.374] (-513.236) (-513.328) (-510.151) * [-509.523] (-510.109) (-512.136) (-509.894) -- 0:00:53
      158500 -- (-508.335) (-511.557) [-511.837] (-514.448) * [-508.782] (-511.405) (-513.799) (-511.503) -- 0:00:53
      159000 -- (-510.584) (-508.854) [-509.124] (-510.190) * (-512.107) (-513.622) [-510.211] (-512.646) -- 0:00:52
      159500 -- (-512.364) [-512.509] (-508.677) (-510.685) * [-509.875] (-510.115) (-509.691) (-509.470) -- 0:00:52
      160000 -- (-510.819) (-511.009) [-510.926] (-510.425) * [-508.899] (-508.642) (-510.286) (-510.782) -- 0:00:52

      Average standard deviation of split frequencies: 0.023146

      160500 -- (-515.698) [-513.558] (-511.428) (-509.275) * (-509.979) [-510.295] (-509.713) (-511.149) -- 0:00:57
      161000 -- (-513.505) [-512.589] (-518.408) (-511.364) * (-512.897) (-509.238) [-509.832] (-517.340) -- 0:00:57
      161500 -- (-510.862) [-511.219] (-515.615) (-510.123) * (-514.308) (-509.818) (-510.528) [-512.833] -- 0:00:57
      162000 -- [-510.169] (-512.151) (-514.704) (-513.346) * (-511.354) [-508.858] (-509.594) (-510.963) -- 0:00:56
      162500 -- (-509.427) (-510.596) [-509.632] (-514.195) * (-510.972) [-508.616] (-511.102) (-510.731) -- 0:00:56
      163000 -- (-509.062) (-510.847) [-509.139] (-511.140) * (-512.890) [-509.285] (-510.075) (-510.951) -- 0:00:56
      163500 -- (-508.772) (-509.792) [-510.594] (-509.388) * (-510.927) (-509.903) [-508.792] (-511.402) -- 0:00:56
      164000 -- [-509.276] (-513.645) (-509.928) (-510.483) * [-509.225] (-509.106) (-509.729) (-510.957) -- 0:00:56
      164500 -- (-511.229) [-508.936] (-508.785) (-510.356) * (-509.918) (-508.942) [-509.048] (-510.486) -- 0:00:55
      165000 -- [-509.013] (-510.242) (-510.767) (-512.213) * (-509.536) (-508.725) [-514.244] (-511.767) -- 0:00:55

      Average standard deviation of split frequencies: 0.022718

      165500 -- (-509.383) (-510.055) (-509.869) [-510.045] * (-509.663) (-512.979) [-510.652] (-509.674) -- 0:00:55
      166000 -- (-515.133) (-509.267) (-511.034) [-508.356] * (-511.159) (-510.231) [-510.771] (-509.670) -- 0:00:55
      166500 -- (-512.732) (-508.980) (-509.678) [-511.482] * (-511.561) [-515.375] (-509.952) (-511.721) -- 0:00:55
      167000 -- (-512.135) [-513.740] (-511.183) (-509.577) * (-509.173) (-509.588) (-511.555) [-510.290] -- 0:00:54
      167500 -- (-515.404) [-512.015] (-510.720) (-510.018) * (-511.981) (-510.696) (-514.446) [-511.932] -- 0:00:54
      168000 -- (-510.190) [-509.463] (-512.442) (-512.241) * (-511.166) [-512.641] (-512.130) (-513.732) -- 0:00:54
      168500 -- (-510.722) [-510.240] (-511.007) (-514.138) * (-508.618) (-508.884) (-511.847) [-510.039] -- 0:00:54
      169000 -- (-510.716) [-509.915] (-511.188) (-509.256) * [-508.347] (-511.640) (-514.125) (-509.127) -- 0:00:54
      169500 -- [-512.633] (-509.682) (-511.549) (-508.842) * [-510.580] (-509.776) (-509.744) (-508.636) -- 0:00:53
      170000 -- (-510.960) (-511.853) [-510.710] (-511.484) * (-509.698) (-509.787) [-510.175] (-509.663) -- 0:00:53

      Average standard deviation of split frequencies: 0.019642

      170500 -- (-517.626) [-509.811] (-511.549) (-513.390) * (-510.739) (-511.286) (-509.898) [-510.108] -- 0:00:53
      171000 -- (-511.805) (-511.604) (-512.012) [-510.808] * [-509.675] (-510.891) (-511.740) (-510.062) -- 0:00:53
      171500 -- (-511.477) (-510.741) (-510.828) [-511.780] * (-510.677) [-511.416] (-512.622) (-509.539) -- 0:00:53
      172000 -- (-512.621) (-509.646) [-511.609] (-513.395) * (-511.295) (-512.140) [-510.690] (-510.399) -- 0:00:52
      172500 -- (-510.203) (-508.695) (-508.825) [-511.447] * (-512.763) (-512.758) [-510.788] (-509.804) -- 0:00:52
      173000 -- (-513.304) (-509.213) (-508.657) [-510.290] * [-514.720] (-511.828) (-511.488) (-511.735) -- 0:00:52
      173500 -- (-508.689) (-509.283) [-509.747] (-513.620) * (-513.442) [-510.204] (-509.369) (-509.149) -- 0:00:52
      174000 -- (-510.126) (-513.806) [-509.379] (-510.585) * [-511.950] (-512.384) (-514.220) (-509.298) -- 0:00:52
      174500 -- (-509.094) [-511.480] (-511.685) (-509.904) * [-511.005] (-511.217) (-511.182) (-512.507) -- 0:00:52
      175000 -- [-508.729] (-511.539) (-509.475) (-510.930) * [-509.921] (-510.353) (-511.682) (-510.775) -- 0:00:51

      Average standard deviation of split frequencies: 0.020237

      175500 -- (-509.499) (-510.439) (-511.168) [-509.769] * (-509.666) (-511.407) [-509.775] (-510.728) -- 0:00:51
      176000 -- [-510.535] (-509.847) (-510.925) (-509.736) * (-513.121) [-510.222] (-509.973) (-515.217) -- 0:00:56
      176500 -- (-512.624) [-508.769] (-508.480) (-509.882) * (-512.978) [-509.241] (-512.409) (-512.140) -- 0:00:55
      177000 -- (-511.674) [-511.424] (-508.973) (-512.363) * (-510.003) [-509.705] (-510.020) (-511.509) -- 0:00:55
      177500 -- (-510.212) (-510.257) [-509.046] (-510.216) * (-513.948) [-511.099] (-511.602) (-514.217) -- 0:00:55
      178000 -- [-512.109] (-509.489) (-511.941) (-509.420) * (-517.301) [-511.609] (-510.458) (-508.928) -- 0:00:55
      178500 -- (-511.929) [-511.492] (-511.654) (-514.425) * (-511.606) (-511.516) [-512.337] (-508.667) -- 0:00:55
      179000 -- (-511.207) [-509.415] (-509.555) (-509.541) * (-510.516) (-509.457) (-510.570) [-509.591] -- 0:00:55
      179500 -- (-509.588) (-509.089) [-510.600] (-511.833) * (-508.744) (-510.741) (-510.362) [-508.621] -- 0:00:54
      180000 -- (-509.746) [-510.446] (-514.629) (-511.753) * [-513.231] (-512.446) (-511.726) (-508.965) -- 0:00:54

      Average standard deviation of split frequencies: 0.021599

      180500 -- (-510.562) [-511.156] (-511.413) (-512.951) * (-514.780) (-512.276) [-509.424] (-509.109) -- 0:00:54
      181000 -- (-511.569) (-509.865) [-510.075] (-508.697) * [-509.204] (-508.698) (-511.231) (-510.415) -- 0:00:54
      181500 -- [-511.127] (-510.595) (-510.110) (-510.495) * (-511.849) (-509.888) (-512.303) [-509.827] -- 0:00:54
      182000 -- [-509.341] (-511.309) (-508.854) (-508.855) * (-510.202) (-509.164) (-510.482) [-509.695] -- 0:00:53
      182500 -- (-510.594) (-509.139) [-509.128] (-509.273) * (-509.438) [-509.718] (-508.630) (-509.237) -- 0:00:53
      183000 -- (-511.732) (-513.978) [-510.174] (-511.773) * (-509.902) (-511.620) [-510.236] (-510.921) -- 0:00:53
      183500 -- [-509.065] (-510.820) (-510.580) (-509.987) * [-511.452] (-509.771) (-515.434) (-510.485) -- 0:00:53
      184000 -- [-509.626] (-510.462) (-509.955) (-511.396) * [-509.110] (-511.196) (-513.990) (-509.335) -- 0:00:53
      184500 -- (-509.589) (-511.677) (-516.921) [-509.323] * (-509.115) [-510.627] (-508.486) (-508.744) -- 0:00:53
      185000 -- [-510.899] (-510.316) (-510.877) (-509.733) * [-512.718] (-510.599) (-510.873) (-513.584) -- 0:00:52

      Average standard deviation of split frequencies: 0.018942

      185500 -- (-514.009) (-511.531) (-513.281) [-509.723] * (-511.557) (-509.734) (-511.214) [-510.056] -- 0:00:52
      186000 -- (-511.789) (-513.295) (-510.017) [-510.977] * (-509.936) (-509.811) (-508.933) [-511.246] -- 0:00:52
      186500 -- (-510.335) (-509.841) [-508.880] (-512.716) * [-511.781] (-509.361) (-508.838) (-510.560) -- 0:00:52
      187000 -- (-511.323) (-509.482) [-513.154] (-510.719) * (-515.232) [-511.791] (-513.461) (-512.978) -- 0:00:52
      187500 -- (-513.603) (-511.828) (-509.786) [-513.800] * (-511.484) [-510.395] (-509.258) (-511.233) -- 0:00:52
      188000 -- (-512.413) [-511.752] (-509.032) (-511.508) * (-511.207) (-512.353) (-511.052) [-510.263] -- 0:00:51
      188500 -- (-513.164) (-513.625) [-509.707] (-512.434) * (-510.187) (-512.789) (-509.444) [-511.254] -- 0:00:51
      189000 -- (-510.022) [-511.023] (-513.380) (-511.200) * (-510.144) (-511.393) [-508.495] (-512.999) -- 0:00:51
      189500 -- (-510.126) [-510.818] (-509.602) (-517.393) * (-510.547) (-509.432) (-508.718) [-513.009] -- 0:00:51
      190000 -- (-515.890) (-511.368) (-511.027) [-513.099] * (-510.573) (-508.925) [-510.522] (-514.559) -- 0:00:51

      Average standard deviation of split frequencies: 0.018868

      190500 -- (-515.067) (-509.878) (-511.937) [-515.749] * [-509.463] (-511.865) (-510.848) (-511.760) -- 0:00:50
      191000 -- [-508.930] (-510.293) (-511.783) (-509.527) * [-509.732] (-511.793) (-511.208) (-511.624) -- 0:00:50
      191500 -- (-510.098) [-512.115] (-512.158) (-510.170) * [-510.371] (-514.272) (-510.698) (-511.058) -- 0:00:50
      192000 -- (-513.879) (-511.830) (-511.408) [-508.893] * (-510.446) (-511.731) [-512.067] (-509.262) -- 0:00:50
      192500 -- (-509.578) (-509.841) [-509.626] (-509.075) * (-510.747) [-509.062] (-509.317) (-509.539) -- 0:00:54
      193000 -- (-509.678) (-510.965) (-512.790) [-511.685] * [-509.920] (-508.874) (-509.460) (-509.043) -- 0:00:54
      193500 -- (-509.893) [-510.555] (-510.660) (-515.588) * (-510.917) [-512.615] (-510.779) (-513.769) -- 0:00:54
      194000 -- (-511.803) (-513.830) (-510.914) [-510.468] * (-509.685) [-509.549] (-510.931) (-515.060) -- 0:00:54
      194500 -- (-511.137) (-512.456) (-508.800) [-510.970] * (-510.832) (-510.359) (-512.391) [-511.747] -- 0:00:53
      195000 -- (-510.404) [-509.316] (-511.980) (-509.320) * [-509.200] (-510.320) (-510.517) (-508.889) -- 0:00:53

      Average standard deviation of split frequencies: 0.017905

      195500 -- (-512.027) [-510.888] (-510.958) (-513.637) * (-508.673) (-508.819) [-508.698] (-510.105) -- 0:00:53
      196000 -- (-511.555) (-509.931) [-510.830] (-512.457) * (-509.375) (-508.622) (-509.295) [-508.673] -- 0:00:53
      196500 -- [-511.229] (-510.282) (-512.358) (-509.612) * [-509.913] (-511.332) (-509.591) (-509.285) -- 0:00:53
      197000 -- (-508.600) (-510.540) (-510.255) [-510.531] * (-509.187) [-508.577] (-509.383) (-510.564) -- 0:00:52
      197500 -- (-509.994) (-514.305) (-511.138) [-509.051] * [-510.863] (-511.913) (-511.149) (-512.945) -- 0:00:52
      198000 -- (-511.247) (-512.713) (-508.516) [-509.773] * [-509.286] (-510.326) (-509.637) (-512.523) -- 0:00:52
      198500 -- (-510.713) (-510.899) [-508.274] (-509.750) * [-510.619] (-510.712) (-513.280) (-509.820) -- 0:00:52
      199000 -- (-512.019) (-511.514) [-508.745] (-509.322) * (-509.992) (-510.697) (-511.390) [-509.977] -- 0:00:52
      199500 -- [-510.556] (-510.048) (-513.880) (-514.005) * (-513.332) (-509.422) (-513.369) [-508.204] -- 0:00:52
      200000 -- (-510.651) [-510.308] (-509.985) (-512.951) * (-510.478) (-510.780) (-512.800) [-510.944] -- 0:00:51

      Average standard deviation of split frequencies: 0.018517

      200500 -- (-508.374) [-512.033] (-511.341) (-510.398) * (-513.422) (-510.689) (-512.035) [-510.751] -- 0:00:51
      201000 -- (-508.519) [-511.236] (-515.212) (-509.034) * (-513.325) (-509.352) (-513.491) [-513.648] -- 0:00:51
      201500 -- (-509.073) (-513.283) (-512.884) [-512.762] * (-511.304) (-508.738) (-510.213) [-509.878] -- 0:00:51
      202000 -- [-509.447] (-514.065) (-511.652) (-512.756) * (-509.250) (-513.360) [-510.138] (-510.876) -- 0:00:51
      202500 -- (-508.593) (-512.398) (-510.889) [-513.422] * [-509.376] (-512.198) (-513.313) (-510.831) -- 0:00:51
      203000 -- (-509.129) (-508.842) (-510.233) [-508.221] * (-509.734) (-513.218) (-511.520) [-511.148] -- 0:00:51
      203500 -- (-509.294) [-511.622] (-510.190) (-509.405) * (-510.008) (-512.540) [-510.531] (-510.655) -- 0:00:50
      204000 -- [-511.578] (-512.725) (-509.921) (-509.427) * (-508.736) [-512.215] (-509.997) (-510.257) -- 0:00:50
      204500 -- (-509.300) (-509.885) (-510.635) [-510.401] * (-511.480) (-523.119) (-509.430) [-510.883] -- 0:00:50
      205000 -- (-510.757) (-510.751) (-512.086) [-510.698] * (-509.336) (-517.198) [-508.868] (-515.472) -- 0:00:50

      Average standard deviation of split frequencies: 0.019993

      205500 -- (-512.074) (-513.319) [-511.724] (-509.936) * (-514.235) (-515.519) (-509.336) [-510.838] -- 0:00:50
      206000 -- (-511.087) [-512.575] (-508.809) (-509.768) * [-513.575] (-509.266) (-511.984) (-512.100) -- 0:00:50
      206500 -- (-510.121) (-509.998) (-509.060) [-510.385] * (-512.003) [-509.250] (-510.424) (-512.548) -- 0:00:49
      207000 -- [-508.870] (-514.137) (-510.146) (-515.220) * (-512.342) (-511.674) [-511.019] (-509.875) -- 0:00:49
      207500 -- (-518.096) (-511.031) [-511.116] (-510.270) * [-509.731] (-509.112) (-510.159) (-512.178) -- 0:00:49
      208000 -- (-512.043) (-509.927) (-508.828) [-509.124] * (-513.522) (-513.949) (-508.582) [-511.669] -- 0:00:49
      208500 -- (-512.554) [-508.892] (-513.779) (-509.440) * (-509.076) (-513.675) (-511.103) [-512.052] -- 0:00:53
      209000 -- (-510.931) (-509.425) [-508.994] (-508.402) * (-513.559) [-512.130] (-511.201) (-512.982) -- 0:00:52
      209500 -- (-511.440) [-514.097] (-508.915) (-511.190) * (-509.064) (-512.302) [-511.075] (-513.680) -- 0:00:52
      210000 -- [-514.973] (-511.294) (-513.071) (-513.845) * (-509.785) [-509.108] (-512.223) (-510.239) -- 0:00:52

      Average standard deviation of split frequencies: 0.020257

      210500 -- (-512.953) (-510.377) [-510.710] (-508.809) * (-510.899) [-509.163] (-510.954) (-514.038) -- 0:00:52
      211000 -- [-509.354] (-513.220) (-512.273) (-509.227) * (-513.874) [-509.530] (-511.998) (-511.424) -- 0:00:52
      211500 -- (-508.594) (-511.421) (-509.258) [-510.671] * (-510.597) [-510.387] (-509.313) (-508.492) -- 0:00:52
      212000 -- (-515.006) (-511.272) [-508.577] (-510.544) * (-510.481) (-509.616) [-509.881] (-512.855) -- 0:00:52
      212500 -- (-510.947) [-510.464] (-513.836) (-508.811) * (-514.460) (-510.179) [-512.896] (-511.255) -- 0:00:51
      213000 -- (-509.844) (-511.103) (-513.177) [-510.229] * (-509.322) (-510.955) [-510.878] (-511.513) -- 0:00:51
      213500 -- (-509.168) (-509.348) [-508.341] (-509.059) * (-508.575) (-510.950) [-512.838] (-514.136) -- 0:00:51
      214000 -- (-509.696) (-510.137) [-509.966] (-509.626) * [-508.490] (-509.316) (-511.345) (-511.986) -- 0:00:51
      214500 -- [-508.826] (-509.928) (-513.827) (-511.761) * (-510.180) (-509.141) [-513.578] (-511.078) -- 0:00:51
      215000 -- (-509.678) (-508.344) [-510.429] (-515.731) * [-511.178] (-508.814) (-511.887) (-512.856) -- 0:00:51

      Average standard deviation of split frequencies: 0.019642

      215500 -- (-509.492) [-509.340] (-513.341) (-509.981) * [-509.783] (-510.470) (-514.353) (-511.676) -- 0:00:50
      216000 -- (-511.925) [-509.670] (-511.130) (-510.526) * (-509.216) (-509.517) [-513.775] (-509.232) -- 0:00:50
      216500 -- [-516.266] (-511.137) (-515.159) (-514.601) * (-510.378) (-510.820) (-511.364) [-511.622] -- 0:00:50
      217000 -- (-510.542) (-512.443) (-510.015) [-509.634] * (-511.066) (-509.416) [-511.202] (-512.316) -- 0:00:50
      217500 -- (-513.353) (-508.789) (-509.517) [-509.769] * (-512.487) (-512.946) [-513.028] (-512.892) -- 0:00:50
      218000 -- (-509.701) (-508.600) [-510.062] (-509.814) * (-510.122) (-512.114) (-514.510) [-512.662] -- 0:00:50
      218500 -- (-511.357) (-509.025) [-513.297] (-509.781) * [-509.839] (-512.549) (-512.974) (-512.453) -- 0:00:50
      219000 -- (-509.477) (-509.745) (-509.203) [-509.413] * (-510.738) (-512.675) (-509.768) [-512.499] -- 0:00:49
      219500 -- (-510.971) [-511.340] (-514.217) (-512.683) * (-510.189) (-511.264) (-512.368) [-511.526] -- 0:00:49
      220000 -- (-512.665) (-509.494) (-509.415) [-510.028] * (-513.222) (-511.361) [-510.211] (-511.401) -- 0:00:49

      Average standard deviation of split frequencies: 0.019583

      220500 -- (-509.617) (-509.856) (-510.075) [-513.525] * (-511.499) (-510.319) [-510.876] (-516.615) -- 0:00:49
      221000 -- (-514.397) (-512.054) [-510.753] (-510.257) * (-510.992) [-510.452] (-509.947) (-511.254) -- 0:00:49
      221500 -- (-512.723) [-514.439] (-511.067) (-512.886) * (-510.844) (-511.014) (-513.640) [-510.650] -- 0:00:49
      222000 -- [-509.422] (-509.841) (-510.497) (-513.543) * [-511.372] (-508.376) (-511.534) (-513.886) -- 0:00:49
      222500 -- [-510.805] (-513.517) (-510.724) (-510.153) * (-510.210) (-508.849) (-510.962) [-508.938] -- 0:00:48
      223000 -- (-510.786) (-513.965) (-513.210) [-508.951] * (-510.169) (-508.813) (-510.185) [-510.881] -- 0:00:48
      223500 -- (-511.383) [-509.594] (-510.589) (-509.467) * (-511.738) (-512.490) [-512.344] (-508.927) -- 0:00:48
      224000 -- [-508.744] (-510.585) (-511.962) (-510.880) * (-510.330) (-516.535) (-516.193) [-509.194] -- 0:00:48
      224500 -- (-511.574) (-510.355) (-512.531) [-513.370] * [-508.589] (-513.496) (-510.100) (-510.207) -- 0:00:51
      225000 -- (-508.771) (-510.770) [-510.236] (-512.441) * (-510.592) [-515.287] (-509.014) (-509.718) -- 0:00:51

      Average standard deviation of split frequencies: 0.018663

      225500 -- (-509.386) (-510.317) [-510.486] (-509.529) * [-510.486] (-509.605) (-508.674) (-508.939) -- 0:00:51
      226000 -- [-511.573] (-509.944) (-511.995) (-515.206) * (-511.972) (-513.554) (-510.982) [-513.453] -- 0:00:51
      226500 -- [-510.431] (-510.577) (-510.937) (-512.531) * (-510.039) (-513.387) (-509.713) [-509.552] -- 0:00:51
      227000 -- (-511.108) [-512.909] (-513.954) (-511.476) * [-514.449] (-511.347) (-511.423) (-510.308) -- 0:00:51
      227500 -- [-512.452] (-511.583) (-509.402) (-510.148) * (-510.632) (-509.385) [-510.713] (-509.685) -- 0:00:50
      228000 -- (-510.002) (-512.559) (-510.179) [-508.904] * (-510.814) (-511.239) (-512.719) [-510.468] -- 0:00:50
      228500 -- (-509.023) (-509.445) [-509.308] (-510.068) * [-510.641] (-511.345) (-514.949) (-510.645) -- 0:00:50
      229000 -- [-511.874] (-511.054) (-509.315) (-509.348) * (-512.361) (-511.466) [-509.738] (-510.086) -- 0:00:50
      229500 -- (-513.767) (-509.173) [-508.197] (-512.338) * (-508.691) (-509.060) (-509.319) [-513.202] -- 0:00:50
      230000 -- (-511.937) (-509.457) [-512.548] (-513.186) * (-509.259) (-510.332) (-509.353) [-511.754] -- 0:00:50

      Average standard deviation of split frequencies: 0.017640

      230500 -- (-512.930) (-510.865) [-511.278] (-511.784) * (-509.207) (-509.797) (-510.186) [-510.819] -- 0:00:50
      231000 -- [-511.695] (-512.103) (-509.882) (-510.798) * [-510.545] (-510.562) (-508.540) (-509.816) -- 0:00:49
      231500 -- (-511.853) [-510.359] (-511.064) (-510.893) * (-509.961) (-511.810) [-509.315] (-509.427) -- 0:00:49
      232000 -- (-509.506) [-512.578] (-510.786) (-511.994) * (-510.075) (-509.535) [-510.681] (-508.670) -- 0:00:49
      232500 -- (-511.241) [-513.004] (-510.760) (-511.189) * (-510.401) (-509.636) [-508.578] (-512.588) -- 0:00:49
      233000 -- [-514.809] (-510.149) (-512.104) (-509.545) * (-512.504) (-511.313) [-508.544] (-511.739) -- 0:00:49
      233500 -- [-511.625] (-511.782) (-511.518) (-512.127) * (-510.409) (-508.382) [-509.876] (-510.654) -- 0:00:49
      234000 -- (-508.805) [-509.536] (-511.931) (-512.268) * (-512.651) (-509.211) [-511.427] (-510.420) -- 0:00:49
      234500 -- (-512.709) (-512.021) [-509.111] (-512.588) * (-509.226) [-510.959] (-511.587) (-509.373) -- 0:00:48
      235000 -- (-511.945) [-510.470] (-509.398) (-509.743) * (-509.471) [-508.856] (-513.172) (-511.494) -- 0:00:48

      Average standard deviation of split frequencies: 0.017662

      235500 -- (-514.506) [-509.967] (-510.377) (-511.945) * (-509.343) (-508.877) (-511.251) [-509.218] -- 0:00:48
      236000 -- [-512.229] (-509.229) (-511.355) (-508.403) * (-512.049) [-509.668] (-510.360) (-517.855) -- 0:00:48
      236500 -- (-510.414) [-508.680] (-509.588) (-509.362) * (-509.794) (-509.724) (-508.855) [-511.582] -- 0:00:48
      237000 -- [-510.810] (-509.493) (-509.416) (-510.924) * (-509.091) (-513.411) (-509.972) [-509.582] -- 0:00:48
      237500 -- (-509.926) [-511.281] (-509.069) (-509.234) * (-510.544) (-511.000) (-509.591) [-511.643] -- 0:00:48
      238000 -- [-509.555] (-512.385) (-510.298) (-515.282) * [-511.711] (-509.935) (-509.061) (-512.223) -- 0:00:48
      238500 -- (-513.007) (-510.822) (-509.950) [-509.096] * [-510.932] (-512.109) (-511.300) (-511.454) -- 0:00:47
      239000 -- [-512.655] (-512.083) (-509.740) (-509.884) * (-509.233) [-508.426] (-510.966) (-513.914) -- 0:00:47
      239500 -- [-510.122] (-512.565) (-510.576) (-513.501) * (-510.929) (-510.026) [-511.854] (-514.169) -- 0:00:47
      240000 -- (-512.381) (-511.603) (-510.047) [-509.747] * (-512.916) [-511.016] (-511.619) (-515.770) -- 0:00:47

      Average standard deviation of split frequencies: 0.017053

      240500 -- (-508.574) [-508.692] (-509.003) (-510.317) * (-510.025) [-512.129] (-512.275) (-510.929) -- 0:00:50
      241000 -- (-509.781) [-513.504] (-511.913) (-508.416) * (-510.949) (-512.702) (-510.757) [-510.424] -- 0:00:50
      241500 -- (-509.584) [-510.599] (-509.546) (-510.434) * (-513.960) [-510.151] (-510.638) (-511.343) -- 0:00:50
      242000 -- (-512.023) (-509.579) [-510.237] (-510.004) * [-509.920] (-511.532) (-509.290) (-512.217) -- 0:00:50
      242500 -- (-512.588) [-512.607] (-510.343) (-511.084) * (-510.472) [-511.958] (-508.634) (-520.912) -- 0:00:49
      243000 -- (-513.939) [-511.774] (-510.473) (-512.689) * [-512.887] (-510.469) (-509.764) (-509.243) -- 0:00:49
      243500 -- (-510.860) [-508.885] (-508.703) (-509.758) * (-510.051) (-512.469) [-509.497] (-510.021) -- 0:00:49
      244000 -- (-509.963) (-511.367) (-511.142) [-511.260] * (-510.985) (-512.065) [-509.101] (-509.259) -- 0:00:49
      244500 -- (-512.534) [-510.531] (-509.613) (-511.484) * (-510.084) (-512.450) [-509.860] (-510.876) -- 0:00:49
      245000 -- (-515.307) [-510.156] (-511.617) (-512.435) * (-509.293) [-510.574] (-511.736) (-509.367) -- 0:00:49

      Average standard deviation of split frequencies: 0.015668

      245500 -- [-510.944] (-510.931) (-508.821) (-511.781) * [-509.725] (-510.627) (-511.352) (-511.537) -- 0:00:49
      246000 -- (-511.995) (-509.863) [-510.892] (-511.755) * (-509.410) [-513.370] (-511.087) (-513.444) -- 0:00:49
      246500 -- (-511.614) (-511.252) (-510.272) [-510.979] * (-511.694) (-515.957) [-512.317] (-511.092) -- 0:00:48
      247000 -- (-509.428) (-512.021) (-508.683) [-509.154] * (-510.484) (-510.994) [-513.580] (-510.117) -- 0:00:48
      247500 -- (-510.148) (-509.758) (-510.158) [-513.058] * [-511.217] (-510.328) (-509.368) (-509.744) -- 0:00:48
      248000 -- [-510.453] (-513.640) (-510.051) (-510.871) * [-510.440] (-509.693) (-510.174) (-508.716) -- 0:00:48
      248500 -- (-509.901) (-510.379) (-510.093) [-511.762] * (-511.121) (-511.192) [-511.349] (-508.973) -- 0:00:48
      249000 -- (-508.643) [-509.260] (-511.583) (-513.882) * [-510.522] (-509.316) (-511.357) (-510.912) -- 0:00:48
      249500 -- (-511.937) (-509.520) [-511.288] (-510.490) * (-510.210) [-513.454] (-511.386) (-513.434) -- 0:00:48
      250000 -- [-509.282] (-513.200) (-510.394) (-512.227) * (-511.076) (-512.094) (-510.897) [-512.886] -- 0:00:48

      Average standard deviation of split frequencies: 0.015045

      250500 -- (-510.878) (-511.149) (-511.901) [-509.328] * [-509.134] (-512.732) (-509.239) (-514.030) -- 0:00:47
      251000 -- (-509.479) (-508.800) (-511.676) [-508.957] * [-513.380] (-517.407) (-508.808) (-512.021) -- 0:00:47
      251500 -- (-513.584) [-509.907] (-510.370) (-509.997) * (-509.758) [-509.431] (-508.837) (-511.663) -- 0:00:47
      252000 -- [-511.290] (-508.826) (-509.532) (-509.315) * (-512.632) (-509.107) [-510.437] (-511.616) -- 0:00:47
      252500 -- [-509.264] (-513.031) (-509.140) (-511.188) * (-517.879) (-514.996) (-508.479) [-510.112] -- 0:00:47
      253000 -- (-509.472) [-511.438] (-509.421) (-513.227) * (-512.841) [-511.520] (-511.209) (-512.822) -- 0:00:47
      253500 -- (-512.454) [-510.443] (-512.202) (-509.320) * (-509.749) (-511.849) [-509.614] (-511.518) -- 0:00:47
      254000 -- (-514.162) (-508.879) [-511.861] (-509.516) * (-512.458) [-509.960] (-509.173) (-509.582) -- 0:00:46
      254500 -- [-511.008] (-508.772) (-513.438) (-513.272) * (-512.398) [-514.856] (-509.364) (-512.350) -- 0:00:46
      255000 -- (-510.836) [-510.164] (-509.680) (-509.033) * (-513.547) (-513.629) [-509.105] (-510.402) -- 0:00:46

      Average standard deviation of split frequencies: 0.015598

      255500 -- (-511.220) (-509.814) [-512.133] (-510.118) * (-509.765) (-509.471) [-509.032] (-510.873) -- 0:00:49
      256000 -- [-509.890] (-512.309) (-511.151) (-514.932) * (-509.591) (-509.099) (-509.293) [-510.853] -- 0:00:49
      256500 -- [-510.115] (-509.975) (-513.534) (-509.827) * [-513.885] (-510.061) (-513.399) (-510.403) -- 0:00:49
      257000 -- (-512.098) [-509.874] (-509.446) (-516.749) * [-509.167] (-508.797) (-510.841) (-509.894) -- 0:00:49
      257500 -- (-511.853) [-509.526] (-510.070) (-509.110) * (-512.721) [-509.966] (-509.891) (-512.698) -- 0:00:49
      258000 -- [-509.876] (-513.165) (-508.880) (-510.675) * [-509.852] (-513.245) (-511.809) (-510.933) -- 0:00:48
      258500 -- [-510.083] (-512.099) (-510.298) (-511.227) * [-508.475] (-512.663) (-511.583) (-510.212) -- 0:00:48
      259000 -- (-509.680) (-511.582) [-510.154] (-511.531) * (-510.243) [-512.502] (-510.658) (-510.388) -- 0:00:48
      259500 -- (-508.972) [-511.854] (-512.346) (-510.829) * (-508.971) (-509.967) (-509.044) [-509.948] -- 0:00:48
      260000 -- (-511.574) (-514.528) (-510.111) [-511.478] * (-509.812) [-508.981] (-509.460) (-511.606) -- 0:00:48

      Average standard deviation of split frequencies: 0.014468

      260500 -- [-509.185] (-512.325) (-509.483) (-512.543) * (-510.924) (-510.066) [-511.745] (-512.175) -- 0:00:48
      261000 -- [-510.931] (-509.585) (-509.615) (-514.691) * (-510.799) (-512.648) [-513.878] (-512.571) -- 0:00:48
      261500 -- (-514.956) [-509.178] (-513.047) (-511.589) * (-510.377) (-510.976) (-510.754) [-508.620] -- 0:00:48
      262000 -- (-509.713) [-509.126] (-513.269) (-511.703) * (-509.134) (-509.141) (-510.368) [-512.296] -- 0:00:47
      262500 -- (-512.007) (-512.315) [-512.203] (-508.946) * [-509.052] (-510.499) (-512.942) (-512.322) -- 0:00:47
      263000 -- (-510.866) (-511.806) [-511.712] (-509.725) * (-509.052) [-509.820] (-511.427) (-510.684) -- 0:00:47
      263500 -- [-510.821] (-512.653) (-511.806) (-509.683) * (-510.310) [-508.322] (-516.306) (-508.556) -- 0:00:47
      264000 -- (-510.945) (-510.150) [-509.530] (-509.811) * (-509.416) [-509.120] (-515.262) (-509.548) -- 0:00:47
      264500 -- (-509.996) (-510.044) [-511.369] (-513.927) * (-509.868) (-514.234) (-509.595) [-510.214] -- 0:00:47
      265000 -- (-509.189) (-509.949) [-510.422] (-509.633) * (-509.721) [-510.085] (-511.632) (-514.186) -- 0:00:47

      Average standard deviation of split frequencies: 0.014473

      265500 -- (-509.670) [-510.717] (-513.068) (-512.904) * (-514.426) (-510.597) [-516.322] (-510.432) -- 0:00:47
      266000 -- (-511.376) [-510.002] (-511.519) (-509.368) * [-511.502] (-511.008) (-511.213) (-509.536) -- 0:00:46
      266500 -- [-510.723] (-516.972) (-512.726) (-509.724) * (-511.478) (-511.058) [-510.904] (-514.254) -- 0:00:46
      267000 -- (-510.395) [-510.759] (-512.107) (-510.082) * [-510.470] (-512.023) (-511.413) (-510.654) -- 0:00:46
      267500 -- (-508.808) [-509.860] (-511.748) (-510.373) * (-509.524) (-511.301) (-510.939) [-513.046] -- 0:00:46
      268000 -- (-509.462) (-514.895) (-510.501) [-510.237] * (-513.382) (-515.650) [-509.384] (-509.570) -- 0:00:46
      268500 -- (-514.372) (-514.040) (-509.851) [-510.002] * (-513.800) (-513.803) [-509.723] (-510.128) -- 0:00:46
      269000 -- [-512.528] (-512.697) (-511.119) (-509.369) * (-509.469) (-512.301) [-515.163] (-515.646) -- 0:00:46
      269500 -- (-508.628) (-510.145) [-509.261] (-510.794) * (-510.686) (-509.728) (-511.023) [-511.624] -- 0:00:46
      270000 -- [-510.426] (-510.022) (-512.585) (-509.342) * (-510.400) [-509.293] (-510.787) (-513.522) -- 0:00:48

      Average standard deviation of split frequencies: 0.013062

      270500 -- (-513.983) (-510.971) (-512.769) [-511.178] * (-510.432) (-509.486) [-510.136] (-511.724) -- 0:00:48
      271000 -- [-511.424] (-509.163) (-512.145) (-510.087) * (-512.094) (-511.283) (-509.463) [-514.375] -- 0:00:48
      271500 -- (-512.657) [-513.610] (-514.937) (-512.998) * (-511.169) [-510.214] (-510.981) (-508.788) -- 0:00:48
      272000 -- (-509.867) (-509.831) (-513.804) [-510.877] * (-513.541) (-509.819) (-509.539) [-509.271] -- 0:00:48
      272500 -- (-511.835) (-510.640) [-511.084] (-508.651) * (-513.767) (-515.812) [-511.441] (-511.375) -- 0:00:48
      273000 -- (-511.588) (-511.793) [-510.167] (-515.508) * (-511.834) (-520.567) [-511.045] (-509.401) -- 0:00:47
      273500 -- (-509.037) (-512.153) (-510.454) [-509.845] * (-510.559) [-510.362] (-510.361) (-512.404) -- 0:00:47
      274000 -- (-515.006) (-514.968) [-514.025] (-509.316) * (-510.434) [-510.661] (-510.667) (-510.734) -- 0:00:47
      274500 -- [-509.504] (-514.182) (-509.393) (-510.250) * (-510.021) (-513.404) (-509.310) [-510.033] -- 0:00:47
      275000 -- [-508.358] (-510.538) (-509.906) (-510.960) * [-509.309] (-512.246) (-510.552) (-514.045) -- 0:00:47

      Average standard deviation of split frequencies: 0.013569

      275500 -- (-509.395) (-510.437) (-512.955) [-511.060] * (-512.149) [-511.305] (-510.941) (-509.571) -- 0:00:47
      276000 -- (-510.213) [-509.021] (-510.720) (-511.589) * (-511.189) (-509.798) [-510.232] (-509.950) -- 0:00:47
      276500 -- (-511.525) (-512.789) [-512.435] (-510.025) * (-510.516) [-509.505] (-509.237) (-511.337) -- 0:00:47
      277000 -- (-511.305) (-509.815) (-509.593) [-514.854] * (-510.678) (-509.563) [-509.733] (-510.976) -- 0:00:46
      277500 -- (-509.593) (-509.336) (-509.881) [-513.779] * (-510.232) (-510.698) [-509.736] (-508.569) -- 0:00:46
      278000 -- [-512.245] (-513.183) (-511.454) (-512.928) * (-510.626) (-508.826) [-511.378] (-511.400) -- 0:00:46
      278500 -- (-510.473) (-516.050) [-510.724] (-510.085) * (-509.098) (-511.461) (-509.540) [-511.328] -- 0:00:46
      279000 -- (-509.579) (-509.710) (-509.283) [-509.562] * (-509.905) [-511.528] (-516.060) (-509.680) -- 0:00:46
      279500 -- (-510.159) (-515.233) (-509.335) [-508.896] * (-510.774) (-509.774) [-509.239] (-508.566) -- 0:00:46
      280000 -- (-509.379) [-508.910] (-509.207) (-510.551) * (-510.071) [-508.447] (-510.117) (-516.432) -- 0:00:46

      Average standard deviation of split frequencies: 0.014067

      280500 -- [-511.231] (-509.237) (-509.225) (-510.150) * [-509.319] (-508.766) (-512.803) (-514.454) -- 0:00:46
      281000 -- (-511.805) (-510.319) (-513.710) [-509.934] * (-514.862) [-508.638] (-508.553) (-513.898) -- 0:00:46
      281500 -- (-512.838) (-509.913) (-512.097) [-509.736] * [-511.307] (-511.919) (-509.832) (-509.969) -- 0:00:45
      282000 -- (-509.945) [-510.748] (-509.292) (-509.747) * (-510.122) (-510.941) (-510.109) [-510.657] -- 0:00:45
      282500 -- [-508.971] (-512.213) (-509.267) (-510.867) * (-509.023) [-512.685] (-514.846) (-510.061) -- 0:00:45
      283000 -- (-511.055) (-508.603) (-510.867) [-509.377] * (-511.249) (-510.288) (-510.712) [-510.369] -- 0:00:45
      283500 -- [-508.477] (-509.606) (-509.530) (-510.099) * (-509.395) (-517.572) [-510.579] (-512.530) -- 0:00:45
      284000 -- (-510.827) [-508.736] (-509.209) (-511.872) * [-512.475] (-510.077) (-509.107) (-510.021) -- 0:00:45
      284500 -- (-511.270) (-509.293) [-508.908] (-510.727) * (-510.721) (-511.145) (-508.920) [-510.656] -- 0:00:45
      285000 -- (-509.905) (-508.928) (-510.745) [-509.905] * [-510.903] (-517.003) (-510.666) (-509.516) -- 0:00:45

      Average standard deviation of split frequencies: 0.014834

      285500 -- (-508.635) (-510.294) (-510.113) [-509.768] * (-510.921) (-511.743) (-509.896) [-509.405] -- 0:00:45
      286000 -- (-509.941) (-511.073) [-509.252] (-509.858) * (-508.855) (-511.832) (-509.194) [-509.868] -- 0:00:47
      286500 -- [-512.304] (-509.356) (-513.188) (-509.964) * (-509.478) (-512.067) [-510.795] (-509.652) -- 0:00:47
      287000 -- (-512.027) (-509.192) (-510.952) [-508.684] * (-510.928) (-509.226) [-510.251] (-514.505) -- 0:00:47
      287500 -- (-509.551) (-511.484) [-510.539] (-510.257) * [-509.353] (-513.273) (-509.312) (-516.376) -- 0:00:47
      288000 -- (-509.826) (-512.015) (-510.665) [-509.120] * (-511.324) (-508.529) [-509.754] (-512.520) -- 0:00:46
      288500 -- (-509.374) (-511.682) [-513.538] (-510.780) * [-514.006] (-511.641) (-511.014) (-510.723) -- 0:00:46
      289000 -- (-510.082) (-511.584) [-510.024] (-509.390) * [-510.152] (-511.197) (-509.944) (-514.138) -- 0:00:46
      289500 -- [-509.818] (-517.454) (-509.073) (-510.309) * (-511.743) (-510.168) [-509.422] (-513.790) -- 0:00:46
      290000 -- (-512.280) (-510.578) [-511.303] (-513.134) * (-509.500) (-512.171) [-508.803] (-510.872) -- 0:00:46

      Average standard deviation of split frequencies: 0.015407

      290500 -- (-510.133) (-510.558) [-510.673] (-510.747) * (-509.806) (-514.996) (-509.409) [-512.379] -- 0:00:46
      291000 -- [-509.262] (-510.768) (-514.003) (-510.157) * (-510.067) (-511.701) (-510.964) [-508.717] -- 0:00:46
      291500 -- (-509.830) (-509.488) (-510.309) [-510.147] * (-511.968) (-511.875) (-510.050) [-509.676] -- 0:00:46
      292000 -- (-510.763) [-510.780] (-512.052) (-512.122) * (-512.035) (-509.808) [-508.576] (-511.039) -- 0:00:46
      292500 -- [-510.162] (-512.358) (-509.033) (-512.661) * (-509.561) [-508.720] (-509.236) (-509.821) -- 0:00:45
      293000 -- (-512.097) (-509.251) (-509.714) [-511.948] * (-512.225) (-510.137) (-508.733) [-510.904] -- 0:00:45
      293500 -- (-509.749) (-508.750) [-511.601] (-511.895) * (-511.429) [-509.022] (-509.130) (-513.532) -- 0:00:45
      294000 -- (-509.771) [-512.555] (-508.871) (-510.269) * (-510.832) (-509.411) [-510.595] (-510.690) -- 0:00:45
      294500 -- (-509.479) (-510.936) (-508.700) [-508.876] * (-509.880) (-511.787) (-510.492) [-510.681] -- 0:00:45
      295000 -- (-510.001) [-510.758] (-509.305) (-509.314) * (-510.543) (-509.144) [-514.581] (-510.404) -- 0:00:45

      Average standard deviation of split frequencies: 0.014687

      295500 -- [-510.070] (-513.986) (-508.995) (-509.004) * [-510.604] (-510.390) (-512.981) (-511.669) -- 0:00:45
      296000 -- (-508.642) (-511.549) (-511.929) [-509.894] * (-510.999) (-511.315) [-509.983] (-512.145) -- 0:00:45
      296500 -- [-512.105] (-511.387) (-508.849) (-510.844) * (-512.412) (-508.667) (-508.874) [-510.222] -- 0:00:45
      297000 -- [-510.807] (-513.966) (-509.681) (-509.580) * (-510.979) (-511.366) (-508.633) [-509.153] -- 0:00:44
      297500 -- (-508.519) (-509.546) (-510.473) [-509.894] * (-513.386) (-508.885) [-510.168] (-510.017) -- 0:00:44
      298000 -- (-510.936) (-511.442) (-515.214) [-510.688] * (-513.518) (-508.453) (-510.994) [-509.268] -- 0:00:44
      298500 -- [-509.197] (-511.228) (-515.593) (-512.794) * (-510.406) (-511.716) (-512.155) [-508.799] -- 0:00:44
      299000 -- (-510.794) (-510.889) [-510.502] (-510.495) * (-512.174) (-509.589) (-513.782) [-508.782] -- 0:00:44
      299500 -- (-512.891) [-510.636] (-510.397) (-513.952) * (-512.182) (-510.246) (-515.013) [-511.772] -- 0:00:44
      300000 -- [-510.507] (-508.925) (-510.729) (-512.744) * (-510.515) (-509.252) [-511.940] (-512.340) -- 0:00:44

      Average standard deviation of split frequencies: 0.014664

      300500 -- [-510.707] (-513.630) (-513.497) (-513.753) * (-513.642) (-509.852) [-510.870] (-510.298) -- 0:00:44
      301000 -- (-509.689) (-513.084) [-511.261] (-510.556) * (-515.666) (-511.413) (-512.063) [-510.999] -- 0:00:44
      301500 -- (-511.344) (-512.899) (-513.436) [-509.383] * (-513.588) (-510.974) [-512.102] (-510.320) -- 0:00:44
      302000 -- (-511.557) [-509.012] (-511.591) (-511.693) * (-510.041) (-510.848) [-512.511] (-511.508) -- 0:00:43
      302500 -- (-510.044) [-509.926] (-510.604) (-512.353) * (-509.112) [-508.655] (-511.919) (-509.470) -- 0:00:46
      303000 -- [-509.406] (-510.929) (-509.540) (-509.737) * (-509.294) (-508.521) [-508.605] (-510.107) -- 0:00:46
      303500 -- (-508.750) [-515.741] (-509.146) (-513.517) * (-510.829) (-512.095) [-508.746] (-510.215) -- 0:00:45
      304000 -- (-509.845) (-512.135) [-510.348] (-512.923) * (-510.669) [-510.882] (-508.730) (-512.192) -- 0:00:45
      304500 -- [-510.820] (-509.232) (-511.514) (-512.516) * (-509.430) (-510.964) (-509.507) [-509.675] -- 0:00:45
      305000 -- (-511.299) [-509.943] (-510.403) (-510.580) * [-508.842] (-508.701) (-508.817) (-510.409) -- 0:00:45

      Average standard deviation of split frequencies: 0.015043

      305500 -- (-509.928) [-511.225] (-510.293) (-508.741) * (-511.304) (-509.362) (-511.600) [-509.866] -- 0:00:45
      306000 -- (-509.453) [-509.546] (-509.877) (-508.797) * [-510.082] (-512.497) (-513.645) (-513.599) -- 0:00:45
      306500 -- [-509.129] (-511.822) (-509.839) (-515.723) * (-513.547) (-510.539) [-508.299] (-509.198) -- 0:00:45
      307000 -- (-511.493) (-511.037) (-510.574) [-510.784] * (-512.704) (-510.810) (-511.479) [-511.022] -- 0:00:45
      307500 -- (-510.328) [-509.175] (-509.376) (-509.047) * [-509.541] (-508.948) (-510.798) (-511.427) -- 0:00:45
      308000 -- (-509.482) (-508.783) [-509.006] (-510.223) * [-512.397] (-510.123) (-512.179) (-508.852) -- 0:00:44
      308500 -- (-511.782) [-509.236] (-509.829) (-511.406) * [-510.708] (-509.507) (-511.037) (-509.686) -- 0:00:44
      309000 -- (-511.552) [-512.610] (-512.908) (-512.033) * (-509.807) (-510.243) [-509.486] (-509.694) -- 0:00:44
      309500 -- (-514.266) (-511.121) [-512.376] (-510.691) * (-509.326) (-511.652) [-510.619] (-509.739) -- 0:00:44
      310000 -- (-509.900) (-514.943) [-512.123] (-511.852) * (-513.047) [-510.242] (-512.688) (-511.240) -- 0:00:44

      Average standard deviation of split frequencies: 0.014281

      310500 -- (-510.276) (-512.912) [-509.481] (-509.624) * (-509.215) [-511.034] (-511.601) (-510.801) -- 0:00:44
      311000 -- [-509.803] (-515.025) (-510.754) (-508.690) * (-511.155) (-510.444) [-509.966] (-511.403) -- 0:00:44
      311500 -- (-508.832) (-510.623) (-514.780) [-510.999] * [-514.716] (-510.258) (-511.316) (-510.441) -- 0:00:44
      312000 -- (-512.159) (-509.324) [-510.537] (-513.947) * (-517.977) (-511.144) (-508.729) [-510.418] -- 0:00:44
      312500 -- (-511.367) (-508.631) (-510.447) [-509.065] * (-512.135) (-510.654) (-513.671) [-509.555] -- 0:00:44
      313000 -- (-514.479) (-508.855) (-508.565) [-508.984] * (-510.035) (-512.126) [-509.387] (-510.114) -- 0:00:43
      313500 -- (-514.300) (-510.358) [-511.350] (-508.988) * (-510.326) (-510.447) (-509.098) [-510.058] -- 0:00:43
      314000 -- [-509.005] (-510.860) (-516.492) (-509.440) * (-513.248) (-512.327) (-508.965) [-511.269] -- 0:00:43
      314500 -- (-511.488) (-511.998) (-509.235) [-510.206] * (-510.310) [-509.784] (-510.616) (-508.812) -- 0:00:43
      315000 -- [-513.249] (-516.930) (-509.256) (-510.814) * (-509.161) [-509.376] (-511.229) (-511.719) -- 0:00:43

      Average standard deviation of split frequencies: 0.014040

      315500 -- (-511.588) (-511.589) [-510.537] (-510.488) * (-508.421) (-509.903) (-512.616) [-510.391] -- 0:00:43
      316000 -- (-510.450) (-509.021) (-510.214) [-511.155] * (-509.072) [-509.893] (-508.569) (-509.679) -- 0:00:43
      316500 -- [-511.043] (-512.316) (-508.922) (-509.424) * [-509.346] (-515.376) (-512.998) (-512.621) -- 0:00:43
      317000 -- (-511.301) (-515.741) (-509.250) [-510.877] * [-510.872] (-512.317) (-509.636) (-510.826) -- 0:00:43
      317500 -- [-509.657] (-509.382) (-510.777) (-509.534) * (-509.707) (-510.053) (-509.619) [-509.755] -- 0:00:42
      318000 -- (-510.169) (-509.284) (-513.774) [-509.752] * (-510.070) [-510.143] (-509.512) (-514.931) -- 0:00:42
      318500 -- [-509.553] (-509.467) (-511.038) (-509.430) * [-514.879] (-510.751) (-508.673) (-513.209) -- 0:00:42
      319000 -- (-512.552) (-509.381) (-512.902) [-512.005] * (-509.234) (-511.843) [-509.025] (-511.380) -- 0:00:44
      319500 -- (-509.296) (-508.536) (-513.352) [-512.026] * [-509.152] (-512.054) (-509.762) (-509.465) -- 0:00:44
      320000 -- (-511.885) (-509.543) (-509.912) [-513.273] * (-510.299) [-509.316] (-510.007) (-513.057) -- 0:00:44

      Average standard deviation of split frequencies: 0.013058

      320500 -- [-511.396] (-511.645) (-510.648) (-511.317) * [-512.170] (-509.210) (-509.229) (-517.931) -- 0:00:44
      321000 -- (-509.808) (-509.714) (-508.738) [-510.375] * (-508.736) (-510.204) [-510.431] (-512.813) -- 0:00:44
      321500 -- [-509.862] (-510.839) (-510.245) (-509.270) * (-510.684) (-510.654) (-513.680) [-509.560] -- 0:00:44
      322000 -- (-511.460) (-512.265) (-511.611) [-508.759] * [-510.172] (-511.182) (-510.087) (-508.762) -- 0:00:44
      322500 -- (-513.613) [-509.818] (-513.044) (-511.522) * [-512.219] (-510.225) (-512.754) (-512.127) -- 0:00:44
      323000 -- (-516.503) (-511.279) [-509.126] (-510.029) * (-513.151) (-511.008) [-514.072] (-509.477) -- 0:00:44
      323500 -- (-516.277) (-511.598) [-510.936] (-509.041) * (-515.734) [-513.074] (-510.585) (-509.427) -- 0:00:43
      324000 -- (-509.775) [-512.882] (-510.222) (-509.997) * (-509.138) (-511.378) [-508.927] (-509.975) -- 0:00:43
      324500 -- [-508.911] (-509.493) (-511.166) (-509.020) * (-508.459) (-513.551) [-510.710] (-508.505) -- 0:00:43
      325000 -- [-510.027] (-509.373) (-511.492) (-509.760) * [-510.115] (-513.231) (-511.170) (-510.570) -- 0:00:43

      Average standard deviation of split frequencies: 0.013525

      325500 -- (-510.687) (-509.522) (-511.838) [-509.708] * (-512.247) (-510.897) (-512.990) [-514.079] -- 0:00:43
      326000 -- (-511.439) (-512.544) (-510.402) [-508.709] * (-510.030) (-510.726) (-512.362) [-510.031] -- 0:00:43
      326500 -- (-509.458) (-509.251) [-510.144] (-509.797) * (-510.634) (-513.435) (-510.753) [-510.948] -- 0:00:43
      327000 -- (-510.581) (-513.197) (-516.257) [-509.007] * (-509.626) [-512.621] (-513.215) (-510.745) -- 0:00:43
      327500 -- (-509.927) (-509.584) [-510.436] (-510.097) * (-510.209) (-509.990) (-512.984) [-509.408] -- 0:00:43
      328000 -- (-512.785) (-511.098) [-509.945] (-510.943) * [-511.341] (-510.406) (-511.545) (-508.882) -- 0:00:43
      328500 -- (-519.684) (-513.182) [-508.697] (-510.224) * [-509.776] (-509.264) (-511.145) (-510.019) -- 0:00:42
      329000 -- (-511.416) [-510.667] (-513.104) (-508.477) * (-510.227) [-510.296] (-509.927) (-511.796) -- 0:00:42
      329500 -- (-510.422) (-510.452) [-510.880] (-512.534) * (-509.393) (-510.418) [-510.060] (-509.912) -- 0:00:42
      330000 -- [-517.819] (-510.103) (-514.857) (-508.492) * (-509.144) (-511.322) (-510.892) [-509.967] -- 0:00:42

      Average standard deviation of split frequencies: 0.012741

      330500 -- [-509.374] (-510.239) (-511.185) (-509.096) * (-513.763) [-510.719] (-510.511) (-511.871) -- 0:00:42
      331000 -- [-510.454] (-511.242) (-513.424) (-509.598) * [-510.473] (-510.471) (-513.434) (-510.017) -- 0:00:42
      331500 -- (-509.444) (-512.288) [-509.313] (-510.980) * (-508.565) [-510.045] (-512.111) (-509.579) -- 0:00:42
      332000 -- [-511.123] (-510.777) (-511.042) (-511.345) * (-512.003) (-511.062) (-509.103) [-509.195] -- 0:00:42
      332500 -- [-510.908] (-513.342) (-508.890) (-509.866) * [-509.094] (-510.722) (-510.967) (-509.799) -- 0:00:42
      333000 -- [-508.845] (-512.141) (-509.663) (-510.122) * [-510.243] (-512.064) (-510.117) (-510.721) -- 0:00:42
      333500 -- [-512.324] (-510.496) (-511.415) (-509.205) * [-513.484] (-508.710) (-512.389) (-514.295) -- 0:00:41
      334000 -- [-510.686] (-510.488) (-508.538) (-511.271) * (-510.634) [-510.028] (-512.542) (-513.590) -- 0:00:41
      334500 -- [-508.267] (-513.273) (-511.701) (-512.784) * (-512.025) (-510.832) (-511.922) [-509.917] -- 0:00:41
      335000 -- (-509.802) [-510.663] (-508.673) (-514.149) * (-510.213) (-512.297) [-509.953] (-512.133) -- 0:00:41

      Average standard deviation of split frequencies: 0.013591

      335500 -- (-513.969) [-514.740] (-509.228) (-508.767) * (-509.091) (-516.223) [-510.558] (-508.818) -- 0:00:43
      336000 -- (-509.381) (-510.192) (-512.292) [-513.151] * [-509.764] (-510.706) (-512.862) (-510.100) -- 0:00:43
      336500 -- (-509.651) (-510.284) (-511.222) [-509.803] * [-510.842] (-509.961) (-511.659) (-508.780) -- 0:00:43
      337000 -- (-510.401) (-510.146) [-509.977] (-514.990) * (-509.744) [-509.524] (-512.950) (-512.554) -- 0:00:43
      337500 -- (-509.037) (-511.672) [-511.248] (-509.444) * [-515.308] (-512.188) (-510.518) (-510.339) -- 0:00:43
      338000 -- (-510.045) (-516.349) (-513.048) [-511.330] * (-511.273) (-512.890) [-508.814] (-509.324) -- 0:00:43
      338500 -- (-512.738) [-509.564] (-510.303) (-508.763) * (-510.433) (-516.101) [-510.842] (-508.775) -- 0:00:42
      339000 -- (-517.817) (-509.264) (-509.393) [-511.685] * [-508.613] (-511.190) (-511.366) (-510.657) -- 0:00:42
      339500 -- (-512.713) (-509.543) (-516.852) [-512.318] * (-509.927) (-511.019) [-513.894] (-513.350) -- 0:00:42
      340000 -- (-509.918) [-512.917] (-513.097) (-508.838) * (-509.129) (-508.720) [-515.117] (-512.180) -- 0:00:42

      Average standard deviation of split frequencies: 0.013665

      340500 -- [-510.372] (-511.325) (-509.765) (-509.350) * (-510.472) (-513.807) [-509.254] (-512.319) -- 0:00:42
      341000 -- (-511.121) (-509.620) [-509.305] (-513.001) * (-511.557) [-509.894] (-508.636) (-510.592) -- 0:00:42
      341500 -- (-511.443) (-512.079) (-510.207) [-509.779] * (-510.215) [-509.447] (-508.967) (-509.907) -- 0:00:42
      342000 -- (-511.923) [-510.560] (-511.453) (-511.143) * [-508.650] (-512.206) (-509.648) (-509.033) -- 0:00:42
      342500 -- (-511.872) (-510.447) [-508.561] (-509.270) * (-509.655) (-510.466) [-509.177] (-509.365) -- 0:00:42
      343000 -- [-508.955] (-519.030) (-510.078) (-510.347) * [-510.022] (-511.334) (-513.279) (-508.273) -- 0:00:42
      343500 -- [-509.925] (-511.927) (-509.676) (-509.364) * (-510.665) (-509.789) (-513.728) [-516.364] -- 0:00:42
      344000 -- [-508.766] (-512.268) (-510.407) (-510.138) * (-509.409) [-510.683] (-510.724) (-508.465) -- 0:00:41
      344500 -- [-510.154] (-510.573) (-509.335) (-510.899) * (-509.416) (-511.070) (-513.776) [-509.961] -- 0:00:41
      345000 -- (-511.846) [-509.173] (-511.238) (-511.706) * (-510.882) (-509.252) (-511.326) [-511.168] -- 0:00:41

      Average standard deviation of split frequencies: 0.013539

      345500 -- (-510.459) [-508.991] (-509.636) (-510.470) * (-509.345) (-510.304) (-509.589) [-509.541] -- 0:00:41
      346000 -- (-512.620) (-509.554) (-509.965) [-510.758] * (-514.283) [-509.014] (-513.617) (-510.643) -- 0:00:41
      346500 -- (-510.793) (-509.050) [-510.131] (-510.203) * [-510.987] (-509.068) (-512.654) (-512.086) -- 0:00:41
      347000 -- [-511.724] (-510.427) (-511.039) (-509.988) * (-509.718) [-511.676] (-509.785) (-514.081) -- 0:00:41
      347500 -- (-510.921) (-512.047) [-516.361] (-514.733) * (-513.305) (-509.444) (-510.515) [-512.107] -- 0:00:41
      348000 -- (-511.598) (-510.252) (-509.599) [-511.625] * (-512.212) (-510.931) [-510.107] (-509.475) -- 0:00:41
      348500 -- (-512.842) (-509.858) [-511.498] (-513.762) * (-513.278) (-511.042) (-512.252) [-508.694] -- 0:00:41
      349000 -- (-510.417) (-509.297) [-512.240] (-513.151) * (-512.650) (-510.212) [-512.368] (-514.477) -- 0:00:41
      349500 -- (-509.287) (-509.444) (-509.983) [-511.101] * (-509.480) (-513.216) [-510.617] (-510.443) -- 0:00:40
      350000 -- (-509.130) (-513.185) (-510.523) [-510.936] * [-509.904] (-511.922) (-510.324) (-510.051) -- 0:00:40

      Average standard deviation of split frequencies: 0.012920

      350500 -- (-510.159) (-513.031) (-508.251) [-510.930] * [-510.678] (-510.882) (-511.854) (-510.540) -- 0:00:40
      351000 -- (-510.842) (-510.640) [-508.559] (-508.933) * [-511.087] (-514.848) (-510.441) (-511.835) -- 0:00:40
      351500 -- [-510.584] (-511.013) (-510.525) (-511.130) * (-509.254) [-511.712] (-511.412) (-512.211) -- 0:00:40
      352000 -- (-511.523) (-513.779) (-508.889) [-511.684] * [-509.974] (-511.322) (-510.021) (-510.121) -- 0:00:42
      352500 -- [-509.791] (-515.501) (-512.676) (-515.678) * (-514.430) (-513.030) (-509.821) [-511.454] -- 0:00:42
      353000 -- [-511.428] (-509.844) (-509.937) (-509.673) * (-513.981) (-510.643) (-512.544) [-509.245] -- 0:00:42
      353500 -- (-510.359) (-511.194) [-512.305] (-509.484) * (-510.897) (-514.255) (-515.866) [-509.518] -- 0:00:42
      354000 -- [-509.029] (-510.440) (-510.750) (-510.357) * [-509.252] (-510.711) (-514.715) (-511.510) -- 0:00:41
      354500 -- (-513.472) [-509.962] (-511.470) (-513.270) * (-512.978) (-512.944) (-511.367) [-509.851] -- 0:00:41
      355000 -- [-510.333] (-509.266) (-513.586) (-509.707) * (-510.149) (-509.469) [-517.554] (-510.116) -- 0:00:41

      Average standard deviation of split frequencies: 0.013008

      355500 -- [-510.548] (-511.472) (-509.182) (-510.236) * (-511.151) [-508.586] (-510.382) (-509.448) -- 0:00:41
      356000 -- (-510.752) (-511.992) [-509.478] (-510.309) * (-511.842) [-509.289] (-516.194) (-510.267) -- 0:00:41
      356500 -- (-516.310) [-511.990] (-514.037) (-510.371) * (-510.573) (-514.032) [-509.538] (-512.500) -- 0:00:41
      357000 -- (-512.159) (-512.180) (-509.877) [-511.184] * (-509.757) [-510.111] (-509.096) (-513.679) -- 0:00:41
      357500 -- (-509.930) [-514.914] (-508.937) (-508.964) * [-511.813] (-512.002) (-512.293) (-513.588) -- 0:00:41
      358000 -- (-510.281) [-510.591] (-509.461) (-512.361) * (-511.289) (-510.379) [-509.309] (-510.610) -- 0:00:41
      358500 -- [-510.467] (-511.067) (-509.761) (-509.525) * (-511.435) (-510.311) [-511.444] (-515.305) -- 0:00:41
      359000 -- (-510.816) [-511.930] (-512.024) (-511.573) * (-511.939) (-511.282) [-510.822] (-513.942) -- 0:00:41
      359500 -- (-512.175) (-511.979) [-510.034] (-512.033) * (-510.867) (-508.173) [-514.190] (-512.443) -- 0:00:40
      360000 -- (-509.283) (-510.194) [-510.575] (-509.393) * (-510.426) (-512.424) [-511.132] (-512.189) -- 0:00:40

      Average standard deviation of split frequencies: 0.013301

      360500 -- (-512.561) [-509.987] (-509.360) (-508.786) * (-511.206) [-509.431] (-511.418) (-511.041) -- 0:00:40
      361000 -- (-512.610) (-511.461) [-510.204] (-514.576) * (-509.653) (-511.477) [-511.659] (-509.224) -- 0:00:40
      361500 -- (-509.716) (-513.793) [-512.822] (-510.909) * [-516.296] (-511.669) (-512.504) (-509.788) -- 0:00:40
      362000 -- (-510.291) [-509.557] (-509.390) (-511.359) * (-513.702) [-510.119] (-514.240) (-508.668) -- 0:00:40
      362500 -- (-515.769) [-512.140] (-511.114) (-510.999) * (-509.106) [-508.490] (-511.987) (-508.924) -- 0:00:40
      363000 -- (-509.341) [-509.105] (-511.025) (-511.157) * [-511.653] (-509.643) (-509.756) (-509.984) -- 0:00:40
      363500 -- (-508.550) (-511.817) (-515.266) [-511.302] * (-513.114) (-511.384) (-509.383) [-509.967] -- 0:00:40
      364000 -- (-512.755) [-510.067] (-513.128) (-514.799) * (-513.132) (-511.172) (-511.692) [-508.570] -- 0:00:40
      364500 -- (-510.901) [-512.408] (-510.481) (-511.805) * (-513.008) (-509.859) (-510.887) [-509.609] -- 0:00:40
      365000 -- [-509.636] (-511.320) (-512.185) (-509.083) * (-509.118) (-508.593) [-509.166] (-513.736) -- 0:00:40

      Average standard deviation of split frequencies: 0.013562

      365500 -- (-508.668) (-511.010) (-511.440) [-509.888] * (-513.191) (-511.563) (-508.841) [-508.941] -- 0:00:39
      366000 -- (-512.007) (-511.683) [-511.817] (-511.025) * (-511.043) (-516.285) [-512.880] (-508.342) -- 0:00:39
      366500 -- [-508.186] (-513.695) (-510.853) (-512.681) * [-509.990] (-512.752) (-511.502) (-510.012) -- 0:00:39
      367000 -- (-508.633) [-511.342] (-512.128) (-515.646) * (-511.294) [-511.205] (-511.535) (-509.265) -- 0:00:39
      367500 -- (-509.850) [-510.470] (-509.383) (-512.392) * [-510.558] (-509.791) (-513.366) (-509.561) -- 0:00:39
      368000 -- (-511.408) [-513.329] (-510.758) (-512.124) * (-514.928) (-511.068) [-509.690] (-509.375) -- 0:00:39
      368500 -- (-511.534) [-508.966] (-512.824) (-511.046) * (-513.072) (-512.802) [-509.065] (-508.414) -- 0:00:39
      369000 -- [-513.101] (-513.579) (-509.902) (-508.625) * [-511.091] (-510.196) (-509.471) (-509.924) -- 0:00:41
      369500 -- (-509.380) (-513.939) (-509.829) [-508.895] * [-512.526] (-508.984) (-509.132) (-510.915) -- 0:00:40
      370000 -- (-509.610) (-513.161) [-508.680] (-511.797) * (-510.843) (-511.357) [-508.637] (-511.584) -- 0:00:40

      Average standard deviation of split frequencies: 0.014289

      370500 -- [-508.344] (-512.615) (-514.629) (-516.902) * (-509.874) [-510.997] (-508.525) (-511.691) -- 0:00:40
      371000 -- (-511.818) (-509.496) (-508.827) [-510.859] * [-515.264] (-511.226) (-508.550) (-511.007) -- 0:00:40
      371500 -- (-510.044) [-509.555] (-509.647) (-510.446) * (-511.342) (-508.816) (-512.018) [-510.673] -- 0:00:40
      372000 -- (-513.802) [-508.729] (-509.681) (-511.972) * [-509.572] (-511.989) (-509.049) (-514.935) -- 0:00:40
      372500 -- [-511.580] (-512.333) (-510.336) (-509.679) * (-509.953) (-511.388) (-510.663) [-510.240] -- 0:00:40
      373000 -- [-514.156] (-513.837) (-512.847) (-513.149) * (-512.701) (-511.255) (-510.524) [-513.948] -- 0:00:40
      373500 -- (-508.951) [-508.791] (-510.790) (-512.249) * [-509.798] (-512.011) (-508.522) (-510.273) -- 0:00:40
      374000 -- [-509.432] (-511.907) (-510.588) (-508.849) * [-510.119] (-510.845) (-508.988) (-509.170) -- 0:00:40
      374500 -- [-509.887] (-510.101) (-512.378) (-509.678) * [-510.093] (-509.369) (-511.644) (-509.312) -- 0:00:40
      375000 -- (-510.004) [-513.344] (-510.425) (-510.786) * (-510.122) (-511.207) [-513.268] (-509.190) -- 0:00:40

      Average standard deviation of split frequencies: 0.014529

      375500 -- (-511.523) (-512.326) (-509.918) [-513.045] * (-513.713) [-511.579] (-509.785) (-509.749) -- 0:00:39
      376000 -- (-511.872) (-509.801) [-508.807] (-508.515) * [-514.543] (-509.655) (-509.767) (-511.031) -- 0:00:39
      376500 -- (-512.283) (-509.827) [-510.524] (-510.108) * [-508.823] (-510.070) (-510.745) (-510.376) -- 0:00:39
      377000 -- (-509.149) [-511.474] (-510.136) (-510.858) * [-510.274] (-510.441) (-512.434) (-510.827) -- 0:00:39
      377500 -- [-509.375] (-510.295) (-510.541) (-510.820) * (-513.288) [-512.603] (-511.732) (-509.460) -- 0:00:39
      378000 -- (-510.648) [-512.236] (-510.994) (-509.097) * (-512.717) [-509.942] (-510.623) (-511.377) -- 0:00:39
      378500 -- (-509.684) (-510.788) (-512.467) [-510.064] * (-513.282) (-512.678) (-510.350) [-515.643] -- 0:00:39
      379000 -- (-509.938) (-511.628) (-512.516) [-508.444] * (-512.932) (-511.028) (-509.340) [-509.256] -- 0:00:39
      379500 -- (-509.859) (-514.152) [-509.571] (-511.068) * (-510.866) [-508.847] (-508.319) (-510.031) -- 0:00:39
      380000 -- (-511.835) [-509.546] (-511.068) (-509.690) * [-509.779] (-511.348) (-514.438) (-510.022) -- 0:00:39

      Average standard deviation of split frequencies: 0.014059

      380500 -- (-511.393) (-510.464) (-511.063) [-509.598] * (-510.395) [-509.262] (-510.507) (-509.009) -- 0:00:39
      381000 -- [-510.058] (-508.580) (-512.119) (-508.935) * (-510.743) (-509.809) (-511.422) [-508.946] -- 0:00:38
      381500 -- [-510.514] (-510.275) (-510.727) (-510.195) * [-509.610] (-509.868) (-514.102) (-509.164) -- 0:00:38
      382000 -- (-511.020) (-511.012) [-511.611] (-512.579) * (-512.693) (-508.571) (-511.222) [-508.796] -- 0:00:38
      382500 -- (-511.522) (-509.688) (-512.035) [-508.494] * (-512.070) (-513.212) (-511.234) [-510.164] -- 0:00:38
      383000 -- (-510.133) [-512.606] (-512.935) (-508.562) * (-511.142) (-517.320) [-508.243] (-508.310) -- 0:00:38
      383500 -- (-511.724) (-510.407) (-513.621) [-509.205] * [-509.337] (-509.113) (-508.405) (-509.470) -- 0:00:38
      384000 -- [-509.994] (-511.114) (-512.616) (-511.472) * (-510.085) [-509.696] (-511.355) (-512.439) -- 0:00:38
      384500 -- (-511.146) (-512.566) [-509.357] (-508.902) * (-509.103) [-509.445] (-511.584) (-512.429) -- 0:00:38
      385000 -- (-512.667) (-511.687) (-509.849) [-515.042] * [-513.710] (-510.634) (-512.305) (-512.567) -- 0:00:38

      Average standard deviation of split frequencies: 0.016307

      385500 -- [-509.630] (-512.137) (-508.650) (-515.357) * (-509.805) (-509.094) (-510.945) [-510.516] -- 0:00:38
      386000 -- [-508.649] (-509.616) (-511.731) (-510.915) * (-508.453) [-508.999] (-511.273) (-515.521) -- 0:00:39
      386500 -- (-512.791) (-510.670) [-509.259] (-511.801) * [-511.185] (-509.174) (-510.126) (-508.964) -- 0:00:39
      387000 -- (-510.403) (-512.874) [-509.474] (-510.699) * (-509.192) [-509.455] (-509.740) (-517.500) -- 0:00:39
      387500 -- (-509.275) (-512.503) (-510.444) [-510.943] * (-510.526) (-509.694) [-510.599] (-512.267) -- 0:00:39
      388000 -- (-509.661) [-510.790] (-511.808) (-509.038) * (-510.714) [-509.215] (-510.681) (-509.205) -- 0:00:39
      388500 -- (-509.582) [-509.110] (-512.452) (-511.000) * [-509.080] (-511.719) (-510.687) (-509.246) -- 0:00:39
      389000 -- (-511.294) (-510.320) [-509.837] (-513.486) * (-508.766) (-510.309) [-511.234] (-509.353) -- 0:00:39
      389500 -- (-513.530) (-512.394) (-512.259) [-510.332] * (-511.293) (-510.167) (-511.414) [-508.663] -- 0:00:39
      390000 -- (-518.258) (-513.965) [-512.498] (-510.422) * (-510.160) (-510.303) [-508.715] (-510.546) -- 0:00:39

      Average standard deviation of split frequencies: 0.016467

      390500 -- (-509.637) [-509.299] (-510.142) (-508.954) * (-509.107) [-511.619] (-511.613) (-509.942) -- 0:00:39
      391000 -- (-509.353) (-512.156) (-511.245) [-510.402] * (-514.390) (-511.653) (-510.192) [-511.252] -- 0:00:38
      391500 -- (-509.304) (-509.519) (-510.439) [-516.702] * [-511.111] (-510.820) (-511.049) (-511.388) -- 0:00:38
      392000 -- (-510.196) (-509.605) (-511.964) [-508.430] * (-514.761) [-509.791] (-510.000) (-509.630) -- 0:00:38
      392500 -- (-509.041) (-512.701) [-512.848] (-509.054) * (-512.678) (-509.236) (-518.591) [-508.734] -- 0:00:38
      393000 -- (-510.806) [-511.915] (-512.173) (-511.681) * [-513.439] (-512.053) (-515.665) (-511.769) -- 0:00:38
      393500 -- (-511.035) [-510.037] (-510.692) (-509.245) * (-511.969) (-510.270) [-513.661] (-512.385) -- 0:00:38
      394000 -- [-509.827] (-512.861) (-514.628) (-509.095) * [-508.923] (-510.334) (-509.178) (-515.823) -- 0:00:38
      394500 -- (-513.341) (-509.579) (-513.726) [-508.741] * (-509.150) (-509.921) (-512.067) [-516.190] -- 0:00:38
      395000 -- (-509.351) (-511.032) [-509.242] (-509.056) * (-509.141) (-509.980) (-510.518) [-509.441] -- 0:00:38

      Average standard deviation of split frequencies: 0.016876

      395500 -- [-509.386] (-512.035) (-510.625) (-512.295) * (-512.327) [-512.206] (-511.558) (-511.031) -- 0:00:38
      396000 -- (-508.790) (-510.534) [-512.057] (-509.470) * (-509.572) (-512.343) (-509.140) [-509.800] -- 0:00:38
      396500 -- [-510.319] (-513.474) (-512.465) (-513.525) * [-511.544] (-512.136) (-511.665) (-510.171) -- 0:00:38
      397000 -- (-510.368) (-511.114) [-508.465] (-511.485) * (-510.236) [-513.157] (-516.629) (-512.882) -- 0:00:37
      397500 -- (-513.789) [-509.911] (-509.249) (-509.967) * (-513.545) (-518.534) [-509.189] (-512.110) -- 0:00:37
      398000 -- (-510.128) [-510.647] (-516.377) (-510.908) * (-511.048) (-513.905) (-513.934) [-508.803] -- 0:00:37
      398500 -- (-509.458) [-509.758] (-509.702) (-509.529) * (-514.001) (-510.437) [-510.670] (-509.306) -- 0:00:37
      399000 -- (-509.720) (-513.689) (-510.228) [-514.298] * (-512.717) (-512.943) [-514.456] (-513.819) -- 0:00:37
      399500 -- (-509.789) (-509.922) [-509.480] (-510.576) * [-512.107] (-510.655) (-514.934) (-509.698) -- 0:00:37
      400000 -- (-511.139) (-510.155) [-510.382] (-510.535) * (-512.250) (-511.463) [-509.225] (-509.980) -- 0:00:37

      Average standard deviation of split frequencies: 0.016818

      400500 -- (-511.005) (-513.774) (-511.537) [-509.974] * (-511.451) (-513.725) [-512.905] (-511.420) -- 0:00:37
      401000 -- (-512.731) (-513.244) (-510.170) [-510.942] * (-510.980) (-509.825) (-512.770) [-509.992] -- 0:00:37
      401500 -- (-510.070) (-509.769) [-511.811] (-517.562) * (-511.842) (-510.789) (-511.548) [-511.478] -- 0:00:37
      402000 -- (-508.748) (-510.059) [-513.349] (-510.395) * (-512.485) (-509.462) [-509.876] (-515.196) -- 0:00:37
      402500 -- (-509.553) (-510.053) [-510.980] (-509.972) * (-510.253) [-512.486] (-510.889) (-512.623) -- 0:00:38
      403000 -- (-508.805) [-509.232] (-512.349) (-511.159) * (-509.281) (-511.492) [-509.341] (-511.712) -- 0:00:38
      403500 -- (-510.083) [-509.270] (-510.440) (-508.789) * [-509.638] (-508.624) (-511.985) (-512.823) -- 0:00:38
      404000 -- (-509.118) [-509.354] (-509.345) (-511.033) * (-511.156) (-509.689) [-509.776] (-511.257) -- 0:00:38
      404500 -- (-508.602) [-510.834] (-509.452) (-511.222) * (-510.488) [-512.327] (-509.190) (-509.366) -- 0:00:38
      405000 -- (-512.058) [-509.386] (-509.491) (-511.563) * [-511.094] (-509.718) (-508.686) (-510.501) -- 0:00:38

      Average standard deviation of split frequencies: 0.016597

      405500 -- (-509.396) [-509.234] (-510.502) (-510.981) * (-512.932) (-509.836) [-511.759] (-515.349) -- 0:00:38
      406000 -- (-510.750) [-508.441] (-512.061) (-510.112) * (-511.980) (-509.365) [-513.009] (-510.157) -- 0:00:38
      406500 -- (-511.705) (-511.659) (-511.857) [-510.889] * (-513.108) (-510.873) [-512.440] (-509.748) -- 0:00:37
      407000 -- [-516.494] (-510.927) (-509.652) (-518.022) * (-509.322) (-509.788) [-509.205] (-511.166) -- 0:00:37
      407500 -- (-513.652) (-509.518) [-510.786] (-515.643) * [-508.888] (-509.993) (-509.100) (-509.877) -- 0:00:37
      408000 -- (-514.295) (-509.331) [-508.608] (-516.640) * (-511.189) [-510.559] (-511.759) (-509.067) -- 0:00:37
      408500 -- (-510.175) (-511.038) (-509.682) [-509.330] * (-509.471) (-510.109) (-510.419) [-509.172] -- 0:00:37
      409000 -- (-509.589) (-511.455) [-509.730] (-513.085) * (-511.509) (-508.977) [-509.881] (-509.320) -- 0:00:37
      409500 -- (-511.557) (-509.111) [-509.358] (-511.111) * (-511.057) (-514.397) (-512.896) [-510.158] -- 0:00:37
      410000 -- (-512.028) (-509.491) [-512.019] (-513.844) * (-510.625) [-508.425] (-511.540) (-510.072) -- 0:00:37

      Average standard deviation of split frequencies: 0.016476

      410500 -- [-509.817] (-511.291) (-512.434) (-511.529) * (-509.643) (-509.461) (-510.854) [-512.162] -- 0:00:37
      411000 -- [-510.600] (-514.034) (-513.947) (-512.194) * (-509.357) (-512.157) (-509.438) [-509.040] -- 0:00:37
      411500 -- (-509.298) [-508.728] (-515.655) (-516.093) * (-512.691) [-512.555] (-510.025) (-512.638) -- 0:00:37
      412000 -- (-509.229) (-508.918) [-514.389] (-518.473) * [-511.719] (-508.435) (-510.254) (-509.591) -- 0:00:37
      412500 -- (-510.954) (-511.367) (-510.460) [-513.800] * [-513.928] (-511.494) (-513.612) (-510.501) -- 0:00:37
      413000 -- (-511.052) [-511.627] (-510.051) (-512.599) * (-510.981) (-510.543) (-510.142) [-513.125] -- 0:00:36
      413500 -- [-509.136] (-510.040) (-509.966) (-508.940) * (-510.986) [-512.616] (-512.386) (-510.837) -- 0:00:36
      414000 -- (-509.357) (-509.285) (-510.089) [-510.326] * (-509.850) (-510.044) [-510.668] (-509.440) -- 0:00:36
      414500 -- (-513.731) (-509.793) [-508.530] (-511.112) * (-508.741) (-511.271) (-510.404) [-509.728] -- 0:00:36
      415000 -- [-512.129] (-515.196) (-509.667) (-513.362) * (-509.100) [-509.683] (-509.062) (-510.850) -- 0:00:36

      Average standard deviation of split frequencies: 0.015531

      415500 -- (-517.169) (-510.712) [-511.962] (-512.821) * [-510.282] (-511.823) (-512.900) (-514.141) -- 0:00:36
      416000 -- (-520.401) (-509.052) (-511.615) [-510.589] * (-513.263) [-512.355] (-510.634) (-511.575) -- 0:00:36
      416500 -- (-517.215) (-509.035) [-509.002] (-511.290) * (-510.611) (-509.865) [-512.303] (-510.567) -- 0:00:36
      417000 -- (-510.831) (-512.361) [-513.566] (-512.255) * [-510.314] (-512.903) (-509.652) (-513.081) -- 0:00:36
      417500 -- (-509.934) [-510.423] (-508.757) (-513.319) * [-510.084] (-510.384) (-509.260) (-514.441) -- 0:00:36
      418000 -- [-509.292] (-509.263) (-509.262) (-509.016) * (-512.268) (-509.053) [-510.381] (-510.711) -- 0:00:36
      418500 -- (-508.879) (-513.303) [-509.358] (-509.994) * (-508.678) (-511.544) [-509.366] (-510.679) -- 0:00:36
      419000 -- (-508.794) (-513.464) (-510.441) [-508.605] * [-511.502] (-509.232) (-508.399) (-509.581) -- 0:00:36
      419500 -- (-509.720) (-509.733) (-509.436) [-510.098] * (-510.647) (-509.732) [-508.777] (-509.694) -- 0:00:37
      420000 -- (-511.528) (-510.569) [-511.642] (-510.668) * [-510.627] (-510.307) (-513.063) (-509.182) -- 0:00:37

      Average standard deviation of split frequencies: 0.015095

      420500 -- (-511.781) (-512.970) (-512.832) [-512.190] * (-509.754) (-513.204) [-516.026] (-508.440) -- 0:00:37
      421000 -- (-513.590) [-508.589] (-510.328) (-509.163) * (-509.574) (-510.953) [-509.597] (-509.057) -- 0:00:37
      421500 -- (-510.577) (-509.793) [-510.410] (-510.257) * (-509.718) (-512.461) (-516.396) [-509.887] -- 0:00:37
      422000 -- (-511.045) (-511.447) (-511.707) [-508.583] * (-515.130) (-512.191) (-518.637) [-510.353] -- 0:00:36
      422500 -- [-510.373] (-511.647) (-511.479) (-510.056) * [-510.189] (-510.419) (-515.352) (-514.988) -- 0:00:36
      423000 -- (-508.444) [-512.053] (-509.349) (-509.748) * (-509.922) (-508.522) (-513.132) [-511.267] -- 0:00:36
      423500 -- (-511.240) [-510.990] (-509.764) (-512.256) * [-512.655] (-510.926) (-510.572) (-508.713) -- 0:00:36
      424000 -- [-511.224] (-511.457) (-510.290) (-512.204) * (-511.921) (-510.561) (-510.522) [-509.520] -- 0:00:36
      424500 -- (-513.930) (-515.751) (-511.223) [-510.220] * (-511.451) (-510.010) [-511.055] (-511.724) -- 0:00:36
      425000 -- (-512.064) (-511.533) [-515.743] (-509.686) * [-512.124] (-509.352) (-512.480) (-510.757) -- 0:00:36

      Average standard deviation of split frequencies: 0.015037

      425500 -- (-509.643) (-510.905) [-515.987] (-508.643) * (-512.770) (-510.834) [-508.912] (-515.807) -- 0:00:36
      426000 -- (-511.309) [-512.471] (-510.159) (-510.396) * (-511.001) (-510.886) [-509.657] (-509.568) -- 0:00:36
      426500 -- (-510.115) (-509.611) (-512.237) [-512.659] * (-511.471) [-509.312] (-511.826) (-508.736) -- 0:00:36
      427000 -- (-510.026) (-509.753) (-513.886) [-508.838] * (-510.513) (-512.031) [-512.176] (-508.699) -- 0:00:36
      427500 -- (-513.252) (-509.790) (-509.555) [-508.981] * (-513.367) [-510.382] (-510.913) (-508.375) -- 0:00:36
      428000 -- (-510.533) (-509.811) [-508.858] (-509.072) * (-511.511) (-510.841) (-509.388) [-508.359] -- 0:00:36
      428500 -- (-509.140) (-512.037) [-509.647] (-509.148) * (-511.182) (-510.769) (-511.668) [-510.725] -- 0:00:36
      429000 -- (-508.396) (-514.523) [-512.042] (-509.797) * (-509.766) [-510.230] (-515.396) (-510.889) -- 0:00:35
      429500 -- (-509.761) (-515.373) [-513.708] (-511.341) * (-511.291) (-511.075) [-509.054] (-511.008) -- 0:00:35
      430000 -- (-510.712) (-513.057) (-508.792) [-509.284] * [-513.403] (-510.872) (-509.796) (-511.460) -- 0:00:35

      Average standard deviation of split frequencies: 0.014552

      430500 -- (-510.132) (-510.225) (-511.383) [-511.017] * (-516.813) [-512.641] (-511.311) (-513.079) -- 0:00:35
      431000 -- (-512.316) (-511.789) [-510.996] (-511.061) * (-513.995) (-510.264) [-510.159] (-509.451) -- 0:00:35
      431500 -- (-513.076) [-511.724] (-510.653) (-512.385) * (-510.452) (-509.097) (-509.855) [-511.200] -- 0:00:35
      432000 -- (-509.483) (-510.727) [-509.895] (-514.704) * (-509.383) (-510.802) [-513.874] (-512.646) -- 0:00:35
      432500 -- (-511.845) (-510.547) [-513.695] (-511.183) * [-510.722] (-510.079) (-510.789) (-510.251) -- 0:00:35
      433000 -- (-511.963) (-510.776) (-514.702) [-514.598] * (-509.369) [-509.648] (-512.275) (-510.415) -- 0:00:35
      433500 -- (-512.122) [-511.016] (-508.343) (-510.205) * (-511.162) [-513.048] (-511.434) (-509.974) -- 0:00:35
      434000 -- (-513.233) [-511.574] (-511.274) (-508.702) * (-509.766) (-508.579) [-510.036] (-510.424) -- 0:00:35
      434500 -- (-512.402) [-511.697] (-509.928) (-509.649) * [-511.701] (-510.185) (-509.742) (-509.530) -- 0:00:35
      435000 -- (-510.759) [-512.389] (-509.012) (-511.154) * [-509.127] (-509.635) (-514.627) (-508.789) -- 0:00:35

      Average standard deviation of split frequencies: 0.014437

      435500 -- (-509.220) (-508.623) [-509.575] (-511.967) * [-508.971] (-510.812) (-514.177) (-509.093) -- 0:00:34
      436000 -- (-508.880) [-510.432] (-509.838) (-511.164) * (-512.360) (-512.702) [-510.728] (-511.585) -- 0:00:36
      436500 -- (-509.214) (-509.931) [-509.092] (-509.818) * (-511.979) (-508.934) [-508.729] (-511.812) -- 0:00:36
      437000 -- (-508.827) (-510.550) [-509.365] (-509.804) * (-509.804) [-512.698] (-511.322) (-509.344) -- 0:00:36
      437500 -- (-510.555) [-509.600] (-512.070) (-508.654) * [-510.711] (-510.698) (-512.037) (-512.041) -- 0:00:36
      438000 -- (-511.726) [-510.784] (-512.048) (-510.611) * [-511.373] (-515.994) (-514.121) (-510.619) -- 0:00:35
      438500 -- (-510.833) [-514.734] (-508.908) (-514.043) * (-510.246) [-514.199] (-512.819) (-511.448) -- 0:00:35
      439000 -- [-509.785] (-511.192) (-510.977) (-513.676) * [-513.832] (-508.988) (-512.121) (-508.479) -- 0:00:35
      439500 -- (-513.232) (-510.141) [-510.990] (-514.657) * (-514.730) [-509.502] (-513.988) (-511.595) -- 0:00:35
      440000 -- (-510.936) (-510.477) [-508.721] (-509.951) * (-510.721) [-510.644] (-512.933) (-508.562) -- 0:00:35

      Average standard deviation of split frequencies: 0.014284

      440500 -- [-512.103] (-511.433) (-510.705) (-510.967) * (-510.088) [-510.556] (-510.507) (-508.939) -- 0:00:35
      441000 -- [-511.024] (-515.559) (-510.155) (-510.058) * [-511.797] (-512.548) (-512.858) (-512.311) -- 0:00:35
      441500 -- [-511.324] (-509.097) (-511.412) (-509.182) * (-508.808) [-508.606] (-510.622) (-510.100) -- 0:00:35
      442000 -- [-508.922] (-509.125) (-511.127) (-509.591) * (-511.997) (-510.337) [-510.969] (-511.217) -- 0:00:35
      442500 -- (-509.595) (-512.526) (-511.684) [-510.415] * (-510.879) [-510.279] (-514.629) (-509.647) -- 0:00:35
      443000 -- (-509.218) (-512.530) [-509.708] (-510.850) * (-510.482) (-510.432) [-509.040] (-509.454) -- 0:00:35
      443500 -- (-514.782) [-512.081] (-509.165) (-515.605) * [-509.583] (-511.621) (-509.822) (-509.354) -- 0:00:35
      444000 -- (-514.048) [-509.718] (-508.676) (-509.463) * (-510.551) [-509.112] (-514.821) (-510.142) -- 0:00:35
      444500 -- [-513.831] (-510.324) (-509.334) (-511.321) * [-510.891] (-512.718) (-512.933) (-509.472) -- 0:00:34
      445000 -- (-509.864) (-510.710) (-513.611) [-512.241] * (-510.471) (-512.758) (-510.591) [-509.448] -- 0:00:34

      Average standard deviation of split frequencies: 0.013616

      445500 -- (-510.318) [-509.940] (-511.074) (-509.906) * (-509.607) [-510.643] (-513.243) (-511.158) -- 0:00:34
      446000 -- (-509.921) (-509.750) (-511.751) [-513.109] * (-510.458) (-510.782) (-510.907) [-510.868] -- 0:00:34
      446500 -- (-511.345) (-509.958) (-510.029) [-509.755] * (-511.913) [-512.365] (-509.798) (-510.366) -- 0:00:34
      447000 -- [-510.383] (-510.130) (-511.889) (-509.562) * (-510.610) (-512.961) [-511.920] (-511.280) -- 0:00:34
      447500 -- [-510.784] (-509.466) (-511.438) (-510.816) * (-510.192) (-512.022) [-510.890] (-515.127) -- 0:00:34
      448000 -- [-511.874] (-512.798) (-511.630) (-512.901) * (-510.354) [-510.698] (-515.480) (-512.961) -- 0:00:34
      448500 -- (-513.140) (-513.464) [-512.572] (-511.657) * (-510.407) (-511.550) [-513.682] (-514.236) -- 0:00:34
      449000 -- (-509.143) [-510.238] (-512.638) (-510.489) * [-512.727] (-517.120) (-511.605) (-510.105) -- 0:00:34
      449500 -- [-508.654] (-510.877) (-511.238) (-509.534) * (-512.113) (-512.296) (-512.426) [-509.540] -- 0:00:34
      450000 -- (-510.359) (-511.842) (-512.690) [-511.161] * (-509.312) (-510.160) (-509.493) [-509.009] -- 0:00:34

      Average standard deviation of split frequencies: 0.013537

      450500 -- [-510.481] (-515.978) (-514.276) (-513.330) * (-510.466) (-514.375) [-511.802] (-508.422) -- 0:00:34
      451000 -- (-510.476) (-513.290) [-510.115] (-511.035) * [-511.769] (-509.298) (-510.464) (-508.522) -- 0:00:34
      451500 -- [-508.823] (-510.440) (-513.302) (-509.764) * [-510.753] (-512.272) (-512.550) (-510.210) -- 0:00:34
      452000 -- (-510.308) [-509.829] (-511.439) (-511.413) * [-508.895] (-509.904) (-517.498) (-514.376) -- 0:00:33
      452500 -- (-509.316) [-511.163] (-512.810) (-511.219) * (-509.178) (-512.850) (-513.339) [-513.038] -- 0:00:35
      453000 -- (-511.327) [-509.401] (-508.387) (-510.430) * (-511.246) [-510.209] (-512.469) (-512.740) -- 0:00:35
      453500 -- (-511.378) (-511.037) (-508.600) [-510.348] * [-508.968] (-510.032) (-509.940) (-510.261) -- 0:00:34
      454000 -- [-511.884] (-509.342) (-510.539) (-509.345) * (-509.669) [-509.742] (-515.507) (-511.146) -- 0:00:34
      454500 -- (-513.510) (-510.173) (-510.581) [-509.935] * (-512.983) (-512.339) [-509.792] (-511.496) -- 0:00:34
      455000 -- [-517.266] (-511.858) (-512.213) (-509.960) * (-509.503) [-512.189] (-509.917) (-516.585) -- 0:00:34

      Average standard deviation of split frequencies: 0.014169

      455500 -- (-514.876) (-510.000) (-509.933) [-511.266] * (-511.642) [-511.181] (-509.746) (-510.723) -- 0:00:34
      456000 -- (-511.449) (-511.450) (-509.513) [-509.358] * (-510.934) [-508.576] (-509.650) (-511.886) -- 0:00:34
      456500 -- [-509.137] (-509.864) (-509.669) (-510.532) * (-510.305) (-511.032) (-508.645) [-514.046] -- 0:00:34
      457000 -- (-509.775) (-512.794) [-515.093] (-510.219) * (-513.794) (-510.154) [-511.927] (-517.778) -- 0:00:34
      457500 -- [-508.465] (-510.500) (-511.626) (-512.650) * (-510.380) (-511.155) (-509.839) [-513.037] -- 0:00:34
      458000 -- (-521.068) (-510.846) [-508.760] (-515.619) * (-510.653) (-512.357) (-510.171) [-508.663] -- 0:00:34
      458500 -- (-509.432) (-510.936) (-509.845) [-516.187] * (-510.111) (-510.888) [-510.615] (-511.794) -- 0:00:34
      459000 -- [-512.705] (-509.487) (-510.242) (-513.031) * [-509.546] (-510.223) (-510.894) (-511.540) -- 0:00:34
      459500 -- (-509.491) (-509.963) [-508.973] (-515.075) * (-509.195) (-509.068) (-511.425) [-512.874] -- 0:00:34
      460000 -- [-511.218] (-509.501) (-508.413) (-511.877) * (-508.844) [-510.886] (-510.712) (-512.570) -- 0:00:34

      Average standard deviation of split frequencies: 0.014146

      460500 -- (-512.081) [-508.959] (-508.786) (-510.530) * (-519.289) [-509.884] (-511.808) (-513.662) -- 0:00:33
      461000 -- (-511.997) [-509.327] (-514.187) (-510.851) * (-510.622) (-510.765) (-512.276) [-508.947] -- 0:00:33
      461500 -- (-512.989) [-508.923] (-518.428) (-511.951) * (-509.287) (-514.573) (-508.812) [-509.513] -- 0:00:33
      462000 -- (-509.980) (-509.319) [-514.785] (-508.406) * (-509.538) (-510.402) [-508.789] (-510.854) -- 0:00:33
      462500 -- (-509.332) (-518.750) (-509.192) [-508.676] * (-509.789) [-508.550] (-509.140) (-512.703) -- 0:00:33
      463000 -- [-510.574] (-516.899) (-508.973) (-512.798) * (-508.860) (-510.950) (-509.160) [-510.666] -- 0:00:33
      463500 -- (-510.185) (-512.201) (-509.213) [-512.697] * (-509.649) (-508.837) [-509.725] (-509.148) -- 0:00:33
      464000 -- [-509.038] (-511.627) (-508.582) (-509.797) * (-510.224) (-508.956) (-511.193) [-511.994] -- 0:00:33
      464500 -- [-509.480] (-513.053) (-512.387) (-512.334) * (-509.402) (-509.092) (-511.511) [-511.177] -- 0:00:33
      465000 -- (-513.048) (-511.255) (-511.776) [-511.896] * (-508.599) [-509.708] (-509.562) (-511.676) -- 0:00:33

      Average standard deviation of split frequencies: 0.014341

      465500 -- [-513.057] (-512.194) (-511.088) (-511.830) * (-509.782) [-513.497] (-512.965) (-512.783) -- 0:00:33
      466000 -- (-508.715) (-510.524) (-512.455) [-512.270] * (-514.436) (-509.809) [-510.726] (-513.634) -- 0:00:33
      466500 -- (-508.857) (-512.319) (-512.364) [-511.749] * (-514.017) [-508.904] (-511.486) (-509.733) -- 0:00:33
      467000 -- [-510.212] (-512.960) (-510.734) (-511.473) * (-508.827) (-508.987) [-510.503] (-513.266) -- 0:00:33
      467500 -- (-510.984) [-511.850] (-510.063) (-508.772) * (-509.220) [-512.221] (-513.848) (-510.791) -- 0:00:33
      468000 -- (-509.391) (-510.750) [-510.691] (-512.162) * (-509.099) [-511.991] (-510.598) (-511.433) -- 0:00:32
      468500 -- (-509.509) (-510.385) [-511.049] (-511.753) * [-510.617] (-509.187) (-510.475) (-512.206) -- 0:00:32
      469000 -- [-509.976] (-512.236) (-509.156) (-515.042) * [-511.028] (-509.885) (-512.313) (-509.094) -- 0:00:33
      469500 -- (-509.214) (-509.962) (-512.009) [-508.566] * (-510.777) (-510.897) (-511.936) [-510.444] -- 0:00:33
      470000 -- (-509.003) [-511.776] (-511.117) (-509.769) * (-510.232) [-509.352] (-511.129) (-509.331) -- 0:00:33

      Average standard deviation of split frequencies: 0.013315

      470500 -- (-511.389) [-509.574] (-510.649) (-511.360) * (-509.401) (-508.632) [-512.654] (-508.332) -- 0:00:33
      471000 -- (-510.592) [-511.668] (-511.772) (-510.944) * (-510.316) (-514.575) [-509.241] (-508.909) -- 0:00:33
      471500 -- (-510.151) (-511.288) [-508.813] (-510.819) * (-510.463) (-512.119) [-510.639] (-508.560) -- 0:00:33
      472000 -- (-511.048) (-509.921) [-512.356] (-511.765) * [-512.023] (-508.866) (-509.512) (-509.901) -- 0:00:33
      472500 -- (-510.378) (-510.479) (-509.247) [-509.863] * (-511.365) [-510.138] (-510.928) (-510.507) -- 0:00:33
      473000 -- [-509.499] (-510.032) (-510.389) (-511.954) * [-510.092] (-510.409) (-510.455) (-509.298) -- 0:00:33
      473500 -- [-510.952] (-513.396) (-511.492) (-510.208) * (-513.810) [-510.548] (-513.330) (-511.047) -- 0:00:33
      474000 -- [-508.625] (-511.415) (-509.530) (-512.278) * [-510.649] (-509.760) (-517.315) (-508.756) -- 0:00:33
      474500 -- [-509.276] (-513.197) (-509.697) (-512.865) * (-512.648) [-509.657] (-510.076) (-509.148) -- 0:00:33
      475000 -- (-509.148) (-509.351) (-508.331) [-511.282] * (-510.807) (-512.298) [-509.969] (-511.434) -- 0:00:33

      Average standard deviation of split frequencies: 0.013515

      475500 -- (-509.268) (-509.687) [-508.922] (-510.848) * [-509.554] (-514.860) (-509.525) (-515.679) -- 0:00:33
      476000 -- [-512.130] (-510.867) (-509.426) (-509.690) * [-513.185] (-509.633) (-514.617) (-513.781) -- 0:00:33
      476500 -- (-510.828) [-511.687] (-511.721) (-509.207) * (-511.255) [-513.202] (-509.770) (-513.438) -- 0:00:32
      477000 -- (-510.296) (-509.669) (-510.999) [-509.316] * (-514.606) (-518.066) [-510.533] (-509.979) -- 0:00:32
      477500 -- [-511.300] (-510.918) (-511.063) (-510.280) * (-509.711) (-508.655) [-510.419] (-509.593) -- 0:00:32
      478000 -- [-511.988] (-509.565) (-510.625) (-510.415) * (-510.025) [-511.768] (-509.656) (-510.783) -- 0:00:32
      478500 -- (-512.053) [-508.718] (-511.615) (-511.557) * [-511.639] (-514.655) (-509.660) (-511.567) -- 0:00:32
      479000 -- [-511.753] (-508.850) (-513.223) (-511.205) * [-510.300] (-512.136) (-511.388) (-509.286) -- 0:00:32
      479500 -- (-510.865) (-509.769) [-509.686] (-510.296) * (-511.261) (-514.067) [-514.323] (-514.775) -- 0:00:32
      480000 -- (-509.564) (-509.495) [-509.954] (-508.812) * (-511.479) [-509.683] (-509.456) (-509.773) -- 0:00:32

      Average standard deviation of split frequencies: 0.013096

      480500 -- (-509.287) (-511.139) [-510.647] (-509.419) * (-510.165) (-510.236) (-509.566) [-510.442] -- 0:00:32
      481000 -- (-510.512) [-512.146] (-508.981) (-510.125) * [-511.788] (-511.699) (-508.720) (-509.564) -- 0:00:32
      481500 -- (-511.127) [-512.036] (-514.512) (-510.066) * [-510.314] (-514.440) (-510.889) (-513.987) -- 0:00:32
      482000 -- (-510.949) [-509.276] (-508.842) (-509.406) * (-512.768) (-510.006) (-510.070) [-509.575] -- 0:00:32
      482500 -- (-513.062) (-513.567) [-511.656] (-509.609) * [-510.318] (-509.487) (-509.582) (-513.329) -- 0:00:32
      483000 -- (-509.866) [-511.933] (-509.729) (-511.484) * [-509.730] (-510.429) (-512.123) (-513.221) -- 0:00:32
      483500 -- (-514.011) (-513.355) (-510.217) [-510.049] * (-509.762) (-512.476) [-509.639] (-509.699) -- 0:00:32
      484000 -- (-514.673) (-514.587) (-509.577) [-510.319] * (-509.231) (-508.847) (-510.061) [-512.271] -- 0:00:33
      484500 -- (-514.088) [-509.751] (-515.327) (-509.938) * (-509.304) (-510.099) (-512.560) [-510.285] -- 0:00:32
      485000 -- (-514.389) [-510.290] (-514.083) (-509.712) * (-512.448) (-510.277) [-510.284] (-511.007) -- 0:00:32

      Average standard deviation of split frequencies: 0.012210

      485500 -- (-509.773) [-510.823] (-509.630) (-509.360) * [-509.487] (-511.983) (-510.319) (-511.348) -- 0:00:32
      486000 -- (-510.752) (-512.091) (-508.952) [-508.289] * [-509.329] (-511.097) (-509.826) (-509.888) -- 0:00:32
      486500 -- [-510.239] (-512.145) (-509.088) (-508.312) * (-510.356) (-511.438) [-510.123] (-508.646) -- 0:00:32
      487000 -- (-512.080) (-517.918) [-510.756] (-514.102) * [-512.309] (-510.313) (-513.031) (-515.327) -- 0:00:32
      487500 -- (-513.029) (-513.574) [-510.066] (-511.221) * (-511.169) [-510.836] (-511.913) (-512.932) -- 0:00:32
      488000 -- [-512.302] (-511.514) (-510.014) (-512.884) * (-509.281) [-509.068] (-509.648) (-508.884) -- 0:00:32
      488500 -- (-511.687) (-510.433) (-510.152) [-511.523] * [-508.855] (-513.656) (-514.052) (-509.491) -- 0:00:32
      489000 -- [-509.879] (-509.600) (-510.494) (-509.385) * [-508.710] (-511.754) (-511.355) (-509.560) -- 0:00:32
      489500 -- (-509.784) [-509.958] (-510.150) (-512.183) * (-509.400) [-517.014] (-510.932) (-511.694) -- 0:00:32
      490000 -- (-508.933) [-509.957] (-510.740) (-510.392) * [-512.086] (-508.739) (-509.487) (-510.346) -- 0:00:32

      Average standard deviation of split frequencies: 0.011649

      490500 -- (-510.317) [-509.069] (-512.247) (-508.865) * (-513.276) [-509.551] (-510.678) (-512.665) -- 0:00:32
      491000 -- [-515.415] (-512.376) (-511.651) (-510.005) * (-511.152) [-510.172] (-512.590) (-510.798) -- 0:00:32
      491500 -- (-513.021) (-513.367) (-512.275) [-509.094] * [-511.036] (-512.551) (-510.074) (-511.480) -- 0:00:32
      492000 -- (-509.725) (-509.888) [-511.123] (-515.336) * (-511.324) (-508.818) (-511.007) [-515.885] -- 0:00:32
      492500 -- (-509.335) (-510.981) [-510.279] (-515.607) * (-510.119) (-509.413) (-509.547) [-509.137] -- 0:00:31
      493000 -- (-513.185) (-508.278) [-509.355] (-520.398) * [-509.059] (-510.413) (-510.197) (-509.990) -- 0:00:31
      493500 -- [-509.971] (-510.143) (-512.558) (-509.569) * (-509.750) [-509.191] (-511.337) (-510.509) -- 0:00:31
      494000 -- [-516.550] (-508.847) (-513.754) (-510.365) * (-512.895) (-511.722) (-508.296) [-508.687] -- 0:00:31
      494500 -- (-509.469) (-508.822) [-510.285] (-510.965) * (-511.975) (-510.474) [-508.927] (-509.142) -- 0:00:31
      495000 -- (-512.503) (-512.555) [-509.021] (-510.047) * (-512.071) (-509.339) [-511.441] (-510.141) -- 0:00:31

      Average standard deviation of split frequencies: 0.011821

      495500 -- (-510.932) (-513.518) (-509.240) [-510.653] * (-511.829) (-511.545) [-514.998] (-510.390) -- 0:00:31
      496000 -- [-510.761] (-509.566) (-511.432) (-509.520) * [-511.417] (-517.918) (-512.222) (-511.941) -- 0:00:31
      496500 -- (-516.018) [-513.026] (-509.605) (-509.223) * (-510.144) (-512.519) (-510.735) [-510.501] -- 0:00:31
      497000 -- (-511.661) (-509.775) [-509.727] (-510.181) * (-514.498) (-512.314) [-509.403] (-513.818) -- 0:00:31
      497500 -- (-510.918) (-511.355) [-509.752] (-511.527) * (-511.936) [-510.006] (-511.629) (-511.334) -- 0:00:31
      498000 -- (-510.061) [-508.698] (-510.126) (-509.841) * (-514.154) (-510.303) (-509.919) [-510.665] -- 0:00:31
      498500 -- [-508.825] (-509.156) (-511.384) (-512.903) * (-512.023) [-508.854] (-512.748) (-510.044) -- 0:00:32
      499000 -- (-509.502) (-509.967) (-510.269) [-509.980] * (-510.247) (-509.924) (-509.034) [-512.564] -- 0:00:32
      499500 -- (-510.441) [-510.948] (-509.572) (-514.939) * (-510.327) (-513.278) (-511.333) [-515.598] -- 0:00:32
      500000 -- [-508.765] (-511.452) (-515.307) (-512.707) * (-511.339) (-511.702) [-511.617] (-511.247) -- 0:00:32

      Average standard deviation of split frequencies: 0.011416

      500500 -- (-509.400) (-515.838) [-509.835] (-508.341) * [-512.582] (-510.109) (-510.719) (-511.130) -- 0:00:31
      501000 -- [-508.851] (-516.262) (-518.333) (-509.412) * (-512.334) [-512.676] (-510.796) (-509.985) -- 0:00:31
      501500 -- (-512.052) (-516.960) [-511.139] (-510.824) * (-509.397) (-512.056) (-512.213) [-510.640] -- 0:00:31
      502000 -- [-508.957] (-518.510) (-512.567) (-510.061) * (-509.350) [-513.083] (-511.847) (-509.864) -- 0:00:31
      502500 -- (-509.903) (-508.391) (-510.976) [-510.015] * (-510.733) (-509.220) [-509.835] (-511.246) -- 0:00:31
      503000 -- (-511.352) (-514.522) [-508.750] (-509.333) * (-513.394) (-508.849) [-511.764] (-509.460) -- 0:00:31
      503500 -- [-509.932] (-512.168) (-513.832) (-511.599) * (-509.239) (-512.832) [-515.072] (-510.583) -- 0:00:31
      504000 -- (-510.188) [-510.127] (-510.420) (-511.887) * (-510.720) (-510.750) (-512.142) [-510.130] -- 0:00:31
      504500 -- [-511.146] (-509.318) (-510.079) (-508.916) * (-511.904) (-515.101) (-511.323) [-511.288] -- 0:00:31
      505000 -- [-510.616] (-511.211) (-512.498) (-509.563) * [-510.432] (-510.988) (-510.835) (-512.711) -- 0:00:31

      Average standard deviation of split frequencies: 0.011820

      505500 -- (-513.983) [-510.910] (-509.291) (-509.138) * (-512.718) (-511.854) [-509.111] (-511.349) -- 0:00:31
      506000 -- (-511.061) (-513.074) (-510.190) [-509.830] * (-515.498) [-515.580] (-510.221) (-509.810) -- 0:00:31
      506500 -- (-509.367) (-511.901) (-508.954) [-511.302] * (-512.786) [-508.742] (-513.740) (-510.416) -- 0:00:31
      507000 -- (-513.259) [-509.715] (-509.039) (-510.230) * (-510.469) (-510.149) (-510.645) [-510.734] -- 0:00:31
      507500 -- (-511.480) (-509.033) [-511.779] (-509.551) * (-511.897) [-509.087] (-512.864) (-513.999) -- 0:00:31
      508000 -- (-511.668) (-511.815) [-510.748] (-510.506) * (-518.626) [-510.564] (-511.294) (-511.315) -- 0:00:30
      508500 -- (-516.197) (-513.511) [-509.379] (-510.978) * [-509.476] (-512.522) (-511.872) (-513.112) -- 0:00:30
      509000 -- (-510.973) (-511.594) (-509.790) [-514.388] * (-509.522) (-513.756) (-509.271) [-509.527] -- 0:00:30
      509500 -- (-513.342) (-510.820) [-509.693] (-510.623) * (-511.188) [-509.747] (-511.746) (-510.962) -- 0:00:30
      510000 -- (-511.827) [-509.341] (-509.473) (-512.450) * (-511.623) (-513.200) (-510.480) [-511.373] -- 0:00:30

      Average standard deviation of split frequencies: 0.012462

      510500 -- (-511.542) (-511.404) [-512.081] (-510.327) * (-511.398) [-510.801] (-512.296) (-509.571) -- 0:00:30
      511000 -- (-511.270) (-511.082) (-509.186) [-511.747] * (-511.454) (-510.623) [-509.113] (-509.367) -- 0:00:30
      511500 -- (-511.208) [-513.280] (-510.218) (-511.778) * [-511.425] (-513.429) (-508.734) (-512.429) -- 0:00:30
      512000 -- [-512.823] (-512.890) (-511.148) (-511.300) * (-512.599) (-509.337) [-510.575] (-511.799) -- 0:00:30
      512500 -- (-510.222) [-509.325] (-510.870) (-510.855) * [-509.090] (-510.002) (-510.136) (-510.029) -- 0:00:30
      513000 -- [-511.628] (-510.421) (-510.352) (-510.513) * (-509.565) [-511.509] (-510.959) (-514.211) -- 0:00:31
      513500 -- (-510.342) (-509.093) (-510.396) [-517.608] * (-510.655) [-509.270] (-511.498) (-509.074) -- 0:00:31
      514000 -- [-509.705] (-508.671) (-512.955) (-510.516) * (-508.911) (-510.254) (-510.134) [-508.550] -- 0:00:31
      514500 -- (-513.069) (-515.017) (-511.456) [-509.064] * (-509.392) (-510.137) (-510.286) [-509.351] -- 0:00:31
      515000 -- (-509.187) (-513.955) (-514.823) [-510.240] * (-514.477) (-514.932) [-509.985] (-509.351) -- 0:00:31

      Average standard deviation of split frequencies: 0.013059

      515500 -- (-510.522) (-511.648) (-512.653) [-509.802] * (-509.095) (-511.640) [-509.237] (-508.615) -- 0:00:31
      516000 -- (-510.767) (-512.782) [-512.704] (-511.069) * (-514.322) (-510.097) (-509.085) [-510.680] -- 0:00:30
      516500 -- (-510.398) [-511.719] (-509.558) (-509.827) * [-513.736] (-511.795) (-511.822) (-508.998) -- 0:00:30
      517000 -- [-509.950] (-508.990) (-510.031) (-511.305) * [-508.145] (-512.700) (-511.956) (-512.880) -- 0:00:30
      517500 -- [-510.540] (-511.505) (-509.649) (-517.347) * (-510.297) (-508.869) (-511.982) [-511.692] -- 0:00:30
      518000 -- (-510.308) (-509.509) (-513.512) [-509.142] * (-510.265) (-509.674) [-508.470] (-509.088) -- 0:00:30
      518500 -- (-510.475) (-509.731) (-514.318) [-509.698] * (-511.300) [-508.846] (-512.332) (-509.464) -- 0:00:30
      519000 -- (-508.871) [-514.028] (-513.609) (-510.372) * (-509.949) [-509.196] (-515.409) (-510.587) -- 0:00:30
      519500 -- (-511.446) (-510.702) [-509.231] (-508.824) * (-508.802) (-511.150) (-509.850) [-509.606] -- 0:00:30
      520000 -- (-509.739) [-511.997] (-512.410) (-511.427) * (-511.140) [-512.100] (-514.015) (-511.453) -- 0:00:30

      Average standard deviation of split frequencies: 0.012942

      520500 -- [-508.761] (-509.479) (-508.919) (-510.377) * (-510.418) (-509.616) (-511.121) [-514.244] -- 0:00:30
      521000 -- (-511.848) (-511.175) [-508.720] (-510.237) * (-511.183) (-509.517) (-509.711) [-511.576] -- 0:00:30
      521500 -- (-511.665) (-511.519) (-512.146) [-510.189] * [-511.355] (-511.273) (-509.550) (-511.553) -- 0:00:30
      522000 -- (-509.059) [-509.394] (-515.862) (-508.858) * (-512.779) (-510.454) (-508.373) [-509.837] -- 0:00:30
      522500 -- (-509.124) (-509.182) (-512.314) [-509.616] * (-510.664) (-514.788) [-509.188] (-509.793) -- 0:00:30
      523000 -- (-509.140) [-509.828] (-510.210) (-510.008) * (-516.168) [-510.810] (-511.173) (-509.599) -- 0:00:30
      523500 -- [-509.026] (-509.609) (-510.607) (-509.561) * [-509.834] (-510.332) (-510.667) (-508.774) -- 0:00:30
      524000 -- [-512.297] (-512.573) (-509.677) (-511.872) * (-509.934) [-512.047] (-512.193) (-514.893) -- 0:00:29
      524500 -- (-509.489) (-512.573) (-511.118) [-511.193] * (-510.228) (-510.901) (-510.933) [-511.107] -- 0:00:29
      525000 -- (-511.331) [-509.778] (-510.658) (-511.655) * [-511.687] (-515.541) (-511.754) (-509.168) -- 0:00:29

      Average standard deviation of split frequencies: 0.012389

      525500 -- (-510.226) (-509.228) (-510.364) [-509.520] * [-509.891] (-514.309) (-511.373) (-511.581) -- 0:00:29
      526000 -- (-509.779) (-512.440) [-508.843] (-511.673) * [-510.061] (-512.354) (-510.906) (-512.599) -- 0:00:29
      526500 -- (-511.675) (-514.369) [-509.372] (-510.116) * [-512.450] (-512.910) (-514.573) (-509.262) -- 0:00:29
      527000 -- (-512.195) (-508.453) [-509.366] (-510.848) * [-509.725] (-509.666) (-509.822) (-510.611) -- 0:00:30
      527500 -- (-510.948) (-508.472) [-511.734] (-509.500) * (-509.055) (-510.424) [-510.034] (-512.033) -- 0:00:30
      528000 -- (-509.999) [-510.856] (-510.092) (-510.665) * (-510.308) [-509.775] (-510.276) (-512.115) -- 0:00:30
      528500 -- (-511.593) (-513.397) (-510.278) [-510.625] * [-511.871] (-509.098) (-510.122) (-515.029) -- 0:00:30
      529000 -- [-510.511] (-508.919) (-509.278) (-512.126) * (-511.751) [-510.586] (-511.541) (-512.200) -- 0:00:30
      529500 -- (-510.301) (-510.340) (-510.974) [-511.799] * (-511.175) (-510.553) (-510.212) [-510.621] -- 0:00:30
      530000 -- [-509.567] (-513.950) (-511.607) (-508.818) * (-522.420) [-510.450] (-510.468) (-513.976) -- 0:00:30

      Average standard deviation of split frequencies: 0.012959

      530500 -- (-509.335) (-513.303) (-510.986) [-509.497] * (-508.961) (-512.300) (-511.639) [-508.292] -- 0:00:30
      531000 -- (-513.104) (-513.102) (-511.021) [-508.894] * [-510.971] (-513.599) (-511.288) (-515.907) -- 0:00:30
      531500 -- [-509.749] (-513.703) (-510.427) (-511.336) * (-510.649) (-509.182) [-510.641] (-510.805) -- 0:00:29
      532000 -- (-509.601) (-513.893) (-510.667) [-510.067] * (-509.027) (-512.854) (-512.341) [-510.140] -- 0:00:29
      532500 -- [-509.856] (-513.285) (-511.451) (-509.454) * [-512.181] (-508.461) (-509.945) (-509.849) -- 0:00:29
      533000 -- (-508.737) (-514.638) [-510.426] (-513.309) * (-511.827) (-510.656) [-512.591] (-509.448) -- 0:00:29
      533500 -- (-509.854) [-509.149] (-511.031) (-509.566) * (-511.810) (-509.526) [-509.999] (-510.505) -- 0:00:29
      534000 -- (-509.849) [-508.936] (-509.336) (-513.373) * [-508.870] (-516.213) (-511.940) (-509.888) -- 0:00:29
      534500 -- (-511.498) (-511.688) (-509.052) [-513.486] * [-509.841] (-513.803) (-512.909) (-510.608) -- 0:00:29
      535000 -- (-512.849) (-513.725) (-510.157) [-510.110] * (-510.487) (-516.600) [-513.250] (-515.531) -- 0:00:29

      Average standard deviation of split frequencies: 0.013037

      535500 -- (-508.723) (-511.276) [-512.172] (-510.322) * (-512.518) (-513.519) (-512.033) [-509.248] -- 0:00:29
      536000 -- [-511.053] (-514.485) (-510.274) (-511.112) * [-513.279] (-511.341) (-513.552) (-510.874) -- 0:00:29
      536500 -- (-516.172) [-511.243] (-510.249) (-510.489) * (-509.361) (-510.734) (-512.851) [-509.278] -- 0:00:29
      537000 -- (-514.430) (-510.417) (-510.301) [-509.663] * (-509.735) (-517.518) [-510.905] (-510.069) -- 0:00:29
      537500 -- (-509.466) (-510.889) (-510.036) [-509.396] * (-511.259) (-510.174) [-509.483] (-510.274) -- 0:00:29
      538000 -- [-510.578] (-508.512) (-512.006) (-509.900) * (-510.418) (-509.899) [-512.136] (-509.352) -- 0:00:29
      538500 -- (-510.594) (-508.688) (-513.812) [-508.195] * (-510.939) [-512.252] (-511.266) (-508.723) -- 0:00:29
      539000 -- (-509.309) [-511.686] (-513.426) (-518.468) * (-511.863) [-509.463] (-510.540) (-511.231) -- 0:00:29
      539500 -- [-511.059] (-511.222) (-509.185) (-511.800) * [-514.174] (-511.703) (-510.809) (-514.386) -- 0:00:29
      540000 -- (-510.795) (-510.197) [-508.988] (-509.785) * (-513.844) (-509.916) (-512.912) [-512.006] -- 0:00:28

      Average standard deviation of split frequencies: 0.012360

      540500 -- [-510.120] (-511.134) (-509.395) (-511.051) * (-512.519) [-510.115] (-515.671) (-509.518) -- 0:00:28
      541000 -- (-511.192) (-511.679) (-508.964) [-509.961] * (-512.001) [-511.352] (-513.115) (-508.904) -- 0:00:29
      541500 -- (-510.951) (-509.880) [-513.180] (-511.003) * [-511.070] (-511.340) (-509.021) (-509.401) -- 0:00:29
      542000 -- (-510.270) (-509.422) (-512.632) [-510.697] * (-511.505) [-510.384] (-509.470) (-510.830) -- 0:00:29
      542500 -- [-511.544] (-509.463) (-515.607) (-508.802) * (-509.161) [-510.601] (-513.362) (-512.194) -- 0:00:29
      543000 -- [-508.415] (-509.499) (-513.213) (-508.943) * (-515.604) [-511.219] (-509.923) (-513.055) -- 0:00:29
      543500 -- (-514.492) (-512.682) [-514.527] (-509.160) * (-509.868) [-509.382] (-508.507) (-509.356) -- 0:00:29
      544000 -- (-508.926) [-509.789] (-510.314) (-509.708) * (-509.737) [-513.697] (-508.256) (-508.729) -- 0:00:29
      544500 -- (-511.960) (-509.079) (-509.498) [-509.095] * (-509.437) (-509.766) (-511.981) [-509.515] -- 0:00:29
      545000 -- (-510.195) (-509.203) [-510.234] (-511.902) * [-511.222] (-509.596) (-510.344) (-508.751) -- 0:00:29

      Average standard deviation of split frequencies: 0.012595

      545500 -- [-509.165] (-512.436) (-510.602) (-508.800) * [-511.071] (-511.093) (-512.304) (-508.663) -- 0:00:29
      546000 -- (-511.329) [-508.893] (-509.991) (-509.238) * (-513.826) [-511.909] (-508.816) (-509.720) -- 0:00:29
      546500 -- (-508.634) [-511.893] (-509.392) (-513.121) * (-509.914) (-511.139) (-508.691) [-510.814] -- 0:00:29
      547000 -- (-511.532) [-509.906] (-513.474) (-514.128) * (-511.769) (-513.297) (-511.267) [-511.551] -- 0:00:28
      547500 -- (-515.404) (-510.895) (-509.638) [-509.866] * (-511.610) [-510.063] (-511.222) (-510.559) -- 0:00:28
      548000 -- (-510.846) (-512.336) [-508.794] (-513.330) * (-510.452) [-508.679] (-511.161) (-514.148) -- 0:00:28
      548500 -- (-510.329) [-511.932] (-509.071) (-510.139) * [-511.837] (-508.645) (-509.808) (-514.309) -- 0:00:28
      549000 -- [-513.088] (-510.398) (-509.517) (-509.241) * (-512.213) (-509.816) [-511.886] (-512.714) -- 0:00:28
      549500 -- (-511.970) (-516.634) [-509.440] (-510.866) * (-509.442) (-511.139) (-514.775) [-509.769] -- 0:00:28
      550000 -- (-514.641) [-512.798] (-510.021) (-515.965) * (-510.381) (-508.715) (-508.789) [-509.553] -- 0:00:28

      Average standard deviation of split frequencies: 0.011935

      550500 -- [-509.661] (-514.936) (-509.527) (-510.419) * [-509.227] (-511.233) (-509.249) (-510.499) -- 0:00:28
      551000 -- (-510.281) (-513.662) (-509.158) [-510.504] * (-512.888) (-513.883) (-509.893) [-509.010] -- 0:00:28
      551500 -- (-513.516) (-510.943) [-516.619] (-513.894) * (-510.360) [-510.829] (-510.621) (-510.178) -- 0:00:28
      552000 -- (-517.728) (-509.691) [-511.868] (-511.165) * [-510.546] (-510.011) (-510.256) (-512.987) -- 0:00:28
      552500 -- (-510.983) [-510.081] (-508.594) (-510.413) * (-509.210) (-509.939) [-509.565] (-509.285) -- 0:00:28
      553000 -- (-510.600) (-510.112) [-509.795] (-511.495) * (-510.518) [-510.085] (-510.274) (-510.546) -- 0:00:28
      553500 -- (-511.911) (-511.158) [-510.263] (-510.413) * (-519.872) (-508.911) [-510.986] (-513.774) -- 0:00:28
      554000 -- (-512.895) [-513.018] (-514.836) (-511.719) * [-511.648] (-511.484) (-511.962) (-514.253) -- 0:00:28
      554500 -- (-511.215) (-511.866) (-510.919) [-510.102] * (-508.660) (-508.676) (-510.483) [-510.381] -- 0:00:28
      555000 -- (-514.659) (-511.581) [-509.553] (-510.533) * [-511.678] (-509.915) (-511.441) (-509.659) -- 0:00:28

      Average standard deviation of split frequencies: 0.012119

      555500 -- (-511.944) (-509.975) (-510.863) [-510.481] * (-509.583) (-509.990) (-509.280) [-508.875] -- 0:00:28
      556000 -- [-511.893] (-510.597) (-510.607) (-512.705) * (-509.365) (-515.241) (-511.798) [-509.929] -- 0:00:28
      556500 -- (-508.706) [-509.235] (-510.728) (-508.847) * (-516.006) (-510.764) (-512.453) [-509.634] -- 0:00:28
      557000 -- (-513.690) (-510.712) (-510.293) [-509.049] * (-510.281) (-515.040) (-511.655) [-510.228] -- 0:00:28
      557500 -- (-513.273) [-512.383] (-509.388) (-508.937) * (-512.629) (-511.749) (-512.956) [-515.162] -- 0:00:28
      558000 -- (-511.638) [-510.225] (-509.008) (-509.924) * [-509.542] (-512.845) (-511.066) (-514.179) -- 0:00:28
      558500 -- [-508.690] (-511.624) (-510.248) (-509.949) * [-510.572] (-509.232) (-511.710) (-510.414) -- 0:00:28
      559000 -- (-511.297) (-510.959) (-510.730) [-511.077] * [-509.178] (-512.870) (-512.642) (-511.539) -- 0:00:28
      559500 -- (-509.421) (-515.303) [-514.554] (-512.514) * (-517.230) (-512.385) (-509.777) [-509.013] -- 0:00:28
      560000 -- [-509.489] (-508.889) (-509.043) (-509.576) * [-511.352] (-509.463) (-510.220) (-509.225) -- 0:00:28

      Average standard deviation of split frequencies: 0.012909

      560500 -- (-510.157) (-509.254) [-509.129] (-511.054) * [-510.027] (-510.377) (-510.966) (-513.771) -- 0:00:28
      561000 -- (-510.737) [-511.557] (-508.698) (-509.996) * (-508.964) [-509.834] (-509.057) (-512.291) -- 0:00:28
      561500 -- (-510.745) (-510.144) [-509.100] (-512.943) * (-510.676) (-514.083) [-509.168] (-509.364) -- 0:00:28
      562000 -- (-509.152) (-509.975) (-510.023) [-508.379] * (-514.777) (-509.678) (-514.331) [-508.784] -- 0:00:28
      562500 -- (-510.348) (-509.358) (-511.526) [-511.555] * [-511.371] (-509.122) (-508.624) (-509.810) -- 0:00:28
      563000 -- (-514.236) [-508.932] (-510.277) (-509.511) * (-511.642) [-509.357] (-508.709) (-509.444) -- 0:00:27
      563500 -- (-512.160) (-509.607) [-509.954] (-510.890) * [-509.863] (-511.916) (-511.572) (-514.548) -- 0:00:27
      564000 -- [-509.679] (-511.069) (-510.507) (-510.128) * (-509.742) (-509.834) (-513.917) [-510.250] -- 0:00:27
      564500 -- (-513.508) (-511.866) (-510.619) [-508.760] * (-508.638) (-510.233) [-512.231] (-510.412) -- 0:00:27
      565000 -- (-511.106) (-510.152) [-511.969] (-509.594) * [-508.346] (-511.050) (-511.819) (-510.043) -- 0:00:27

      Average standard deviation of split frequencies: 0.012591

      565500 -- [-510.266] (-512.915) (-510.994) (-510.162) * (-510.103) [-512.426] (-514.529) (-509.918) -- 0:00:27
      566000 -- (-510.328) [-510.873] (-511.560) (-511.596) * [-510.674] (-509.145) (-517.188) (-510.588) -- 0:00:27
      566500 -- (-515.598) [-510.606] (-512.152) (-514.856) * (-508.848) (-515.799) [-510.017] (-511.159) -- 0:00:27
      567000 -- (-513.047) [-514.167] (-511.057) (-510.615) * [-512.393] (-515.841) (-512.408) (-510.977) -- 0:00:27
      567500 -- (-517.569) (-514.814) (-508.497) [-512.633] * (-510.183) (-510.633) (-510.306) [-510.485] -- 0:00:27
      568000 -- (-511.716) [-509.131] (-513.167) (-510.649) * (-512.869) [-516.696] (-509.785) (-511.435) -- 0:00:27
      568500 -- (-513.935) [-515.171] (-512.267) (-510.949) * (-509.630) (-511.850) (-510.220) [-513.110] -- 0:00:27
      569000 -- (-509.561) (-511.680) (-509.007) [-512.609] * (-509.204) (-511.543) (-509.384) [-510.458] -- 0:00:27
      569500 -- [-510.281] (-513.262) (-509.384) (-509.890) * (-509.718) (-511.854) (-510.735) [-509.512] -- 0:00:27
      570000 -- (-511.591) (-511.460) (-509.140) [-510.301] * (-509.027) (-510.038) [-512.011] (-513.266) -- 0:00:27

      Average standard deviation of split frequencies: 0.011954

      570500 -- (-513.778) (-509.381) (-511.306) [-508.689] * (-510.157) (-509.593) (-511.658) [-509.891] -- 0:00:27
      571000 -- [-512.299] (-509.624) (-517.152) (-512.026) * (-509.828) [-508.687] (-510.326) (-510.672) -- 0:00:27
      571500 -- [-509.882] (-508.891) (-509.478) (-510.332) * (-510.278) [-511.420] (-511.773) (-509.069) -- 0:00:27
      572000 -- (-510.071) (-511.482) [-511.027] (-511.690) * (-510.497) [-511.897] (-508.603) (-510.334) -- 0:00:27
      572500 -- (-511.020) (-512.419) (-510.646) [-509.746] * [-509.722] (-509.854) (-508.814) (-508.961) -- 0:00:27
      573000 -- (-512.494) (-511.338) (-511.238) [-510.971] * (-512.984) (-509.621) (-512.834) [-510.340] -- 0:00:27
      573500 -- (-511.376) (-512.075) (-509.944) [-509.180] * (-509.571) (-516.340) (-511.911) [-510.795] -- 0:00:27
      574000 -- [-511.475] (-515.147) (-509.682) (-509.749) * (-511.865) (-512.395) (-509.911) [-510.131] -- 0:00:27
      574500 -- (-511.257) [-512.025] (-510.796) (-511.936) * (-509.297) [-508.901] (-511.950) (-509.842) -- 0:00:27
      575000 -- (-510.514) (-512.556) [-509.553] (-510.102) * (-509.623) (-513.449) [-513.434] (-510.011) -- 0:00:27

      Average standard deviation of split frequencies: 0.012228

      575500 -- (-511.731) (-511.266) [-509.511] (-509.544) * [-509.887] (-513.964) (-511.215) (-510.084) -- 0:00:27
      576000 -- (-510.479) [-513.568] (-512.498) (-511.545) * (-510.353) (-511.518) (-515.536) [-510.836] -- 0:00:27
      576500 -- (-510.397) (-512.053) (-515.800) [-511.173] * (-509.939) [-510.812] (-510.522) (-511.333) -- 0:00:27
      577000 -- [-510.393] (-515.669) (-511.188) (-508.766) * (-509.252) [-509.072] (-509.366) (-509.727) -- 0:00:27
      577500 -- (-511.233) (-512.714) (-508.631) [-509.847] * [-510.624] (-511.664) (-510.685) (-508.636) -- 0:00:27
      578000 -- (-510.888) [-512.781] (-512.103) (-516.747) * (-511.632) (-510.931) (-512.628) [-509.128] -- 0:00:27
      578500 -- (-512.169) (-509.132) [-510.346] (-510.679) * [-509.801] (-512.317) (-509.869) (-511.387) -- 0:00:26
      579000 -- (-514.491) (-511.003) (-510.245) [-510.845] * [-510.924] (-509.503) (-508.376) (-511.254) -- 0:00:26
      579500 -- (-519.301) (-510.749) [-510.280] (-511.107) * [-509.403] (-511.016) (-508.409) (-510.622) -- 0:00:26
      580000 -- (-510.025) [-510.379] (-508.600) (-510.458) * (-510.226) (-513.833) (-510.021) [-508.931] -- 0:00:26

      Average standard deviation of split frequencies: 0.012703

      580500 -- [-510.761] (-513.730) (-510.474) (-510.767) * [-509.629] (-508.521) (-509.982) (-511.031) -- 0:00:26
      581000 -- (-509.838) [-509.704] (-511.730) (-509.842) * (-508.984) (-514.826) (-512.078) [-509.227] -- 0:00:26
      581500 -- [-511.043] (-510.008) (-509.124) (-514.087) * (-510.060) (-508.912) [-509.599] (-508.967) -- 0:00:26
      582000 -- [-511.010] (-510.201) (-511.692) (-511.871) * (-510.413) (-508.718) (-513.743) [-508.701] -- 0:00:26
      582500 -- (-511.759) (-512.101) (-508.496) [-508.364] * (-511.374) (-508.911) [-513.205] (-509.482) -- 0:00:26
      583000 -- (-510.954) (-509.999) [-509.370] (-510.413) * (-509.129) [-508.523] (-509.044) (-510.141) -- 0:00:26
      583500 -- (-513.284) [-509.730] (-509.469) (-512.701) * (-509.270) [-508.516] (-509.102) (-510.275) -- 0:00:26
      584000 -- [-511.865] (-512.550) (-510.700) (-512.599) * (-511.284) [-509.622] (-509.547) (-509.535) -- 0:00:26
      584500 -- (-513.516) (-508.711) [-511.607] (-510.000) * (-509.932) (-511.188) (-513.493) [-509.843] -- 0:00:26
      585000 -- [-511.141] (-511.897) (-510.717) (-509.986) * (-509.675) [-510.216] (-514.376) (-511.502) -- 0:00:26

      Average standard deviation of split frequencies: 0.012824

      585500 -- (-510.168) (-513.995) (-508.575) [-511.541] * (-514.636) [-512.526] (-512.270) (-510.513) -- 0:00:26
      586000 -- (-508.603) (-510.577) (-510.788) [-510.173] * (-508.376) (-510.222) (-510.961) [-510.554] -- 0:00:26
      586500 -- [-508.662] (-508.641) (-511.704) (-513.649) * (-508.462) [-510.478] (-512.587) (-516.744) -- 0:00:26
      587000 -- (-513.545) (-512.711) (-511.697) [-509.444] * (-508.712) [-510.396] (-510.834) (-511.442) -- 0:00:26
      587500 -- [-511.714] (-512.820) (-510.407) (-509.533) * (-510.371) [-510.813] (-511.808) (-510.776) -- 0:00:26
      588000 -- (-511.061) [-511.330] (-510.031) (-509.725) * (-511.154) [-512.729] (-514.452) (-517.510) -- 0:00:26
      588500 -- (-513.650) [-509.880] (-515.015) (-514.009) * (-512.137) (-512.196) [-515.301] (-511.274) -- 0:00:26
      589000 -- (-511.070) (-515.248) (-518.221) [-509.301] * (-513.345) (-509.468) (-513.199) [-508.889] -- 0:00:26
      589500 -- (-509.255) (-513.614) (-513.708) [-509.901] * (-509.267) (-509.417) [-511.862] (-508.661) -- 0:00:26
      590000 -- (-509.367) (-514.156) [-508.662] (-509.807) * [-509.913] (-510.908) (-512.990) (-512.163) -- 0:00:26

      Average standard deviation of split frequencies: 0.012957

      590500 -- (-509.873) [-510.220] (-509.809) (-510.171) * (-508.562) (-508.956) [-513.749] (-511.959) -- 0:00:26
      591000 -- (-509.892) (-510.139) (-509.895) [-511.395] * (-510.775) (-512.070) [-511.406] (-510.908) -- 0:00:26
      591500 -- (-511.366) (-509.902) [-510.843] (-511.153) * (-510.499) (-512.530) [-511.172] (-510.232) -- 0:00:26
      592000 -- (-509.981) [-510.622] (-509.417) (-511.334) * (-510.420) [-513.176] (-509.082) (-515.241) -- 0:00:26
      592500 -- [-510.423] (-513.476) (-511.823) (-511.166) * (-508.740) (-511.767) [-509.978] (-511.370) -- 0:00:26
      593000 -- [-512.236] (-509.404) (-512.136) (-510.292) * (-509.616) [-511.443] (-510.621) (-511.943) -- 0:00:26
      593500 -- [-509.352] (-510.107) (-509.884) (-511.751) * (-509.794) [-516.033] (-509.054) (-510.535) -- 0:00:26
      594000 -- [-510.009] (-510.615) (-509.024) (-510.376) * [-511.825] (-515.776) (-508.878) (-510.506) -- 0:00:25
      594500 -- [-508.612] (-511.603) (-509.676) (-510.272) * (-508.480) [-513.719] (-508.576) (-509.351) -- 0:00:25
      595000 -- (-510.166) (-509.384) (-510.429) [-508.935] * (-508.824) (-510.911) (-510.179) [-509.618] -- 0:00:25

      Average standard deviation of split frequencies: 0.012562

      595500 -- [-510.443] (-508.702) (-510.484) (-508.943) * (-509.193) [-510.114] (-511.244) (-512.355) -- 0:00:25
      596000 -- (-511.185) (-511.127) [-509.929] (-511.935) * [-509.685] (-509.592) (-512.203) (-514.636) -- 0:00:25
      596500 -- (-509.687) [-509.041] (-508.883) (-510.982) * (-510.222) (-511.908) [-509.492] (-509.587) -- 0:00:25
      597000 -- (-510.897) [-512.092] (-509.215) (-510.298) * (-509.946) [-512.795] (-509.837) (-510.395) -- 0:00:25
      597500 -- (-509.563) [-509.850] (-509.784) (-513.822) * (-509.163) (-509.000) [-511.698] (-511.845) -- 0:00:25
      598000 -- (-510.315) (-509.076) [-509.549] (-511.040) * [-509.736] (-509.322) (-509.179) (-510.974) -- 0:00:25
      598500 -- [-510.799] (-513.845) (-511.008) (-511.599) * (-513.526) (-509.054) [-510.111] (-511.658) -- 0:00:25
      599000 -- [-508.688] (-511.301) (-508.691) (-510.090) * (-512.439) [-510.016] (-511.888) (-510.402) -- 0:00:25
      599500 -- (-512.715) (-511.460) [-509.916] (-509.911) * (-514.488) (-509.681) [-510.609] (-509.303) -- 0:00:25
      600000 -- (-509.131) (-515.208) (-510.222) [-509.019] * (-512.533) (-510.179) [-509.699] (-509.942) -- 0:00:25

      Average standard deviation of split frequencies: 0.011625

      600500 -- [-509.749] (-512.015) (-512.510) (-510.145) * (-509.302) (-509.257) (-509.213) [-508.987] -- 0:00:25
      601000 -- [-508.638] (-512.116) (-511.683) (-510.732) * (-511.267) [-515.452] (-509.061) (-512.239) -- 0:00:25
      601500 -- [-509.885] (-511.715) (-510.168) (-510.122) * (-510.852) [-509.444] (-510.827) (-509.902) -- 0:00:25
      602000 -- [-511.388] (-509.911) (-508.512) (-510.057) * (-508.825) (-512.615) (-509.417) [-509.853] -- 0:00:25
      602500 -- (-509.334) (-509.500) [-510.028] (-511.167) * (-510.637) (-514.438) [-511.238] (-509.664) -- 0:00:25
      603000 -- (-508.407) (-510.753) [-511.654] (-510.063) * (-511.251) (-511.914) (-514.504) [-511.676] -- 0:00:25
      603500 -- (-509.833) [-512.190] (-508.488) (-511.486) * (-511.141) [-508.926] (-509.462) (-510.286) -- 0:00:25
      604000 -- (-510.024) (-510.917) (-510.662) [-514.109] * [-510.279] (-512.743) (-511.001) (-509.777) -- 0:00:25
      604500 -- [-509.661] (-510.301) (-508.665) (-514.944) * [-514.169] (-515.203) (-512.593) (-511.196) -- 0:00:25
      605000 -- (-509.070) (-509.752) [-510.438] (-515.755) * (-515.794) (-515.604) [-509.177] (-512.138) -- 0:00:25

      Average standard deviation of split frequencies: 0.012034

      605500 -- (-509.152) (-509.289) [-508.317] (-514.364) * (-510.027) (-513.081) (-508.476) [-510.303] -- 0:00:25
      606000 -- (-508.960) (-511.003) (-510.731) [-508.480] * (-509.125) (-509.446) [-509.324] (-511.561) -- 0:00:25
      606500 -- [-509.643] (-510.957) (-515.312) (-508.982) * [-510.683] (-514.834) (-509.854) (-509.560) -- 0:00:25
      607000 -- (-508.719) (-509.191) (-513.407) [-512.178] * (-511.601) (-512.270) [-510.684] (-510.069) -- 0:00:25
      607500 -- (-509.249) (-509.494) [-508.999] (-513.941) * (-513.020) (-515.455) (-512.613) [-511.066] -- 0:00:25
      608000 -- (-512.007) (-508.335) (-510.575) [-508.515] * (-510.549) (-510.496) [-510.894] (-510.731) -- 0:00:25
      608500 -- (-514.109) [-509.245] (-509.228) (-511.697) * (-508.905) (-511.083) [-512.026] (-508.896) -- 0:00:25
      609000 -- [-509.019] (-509.991) (-512.349) (-510.201) * (-510.645) [-511.829] (-515.643) (-510.175) -- 0:00:25
      609500 -- [-512.215] (-508.829) (-516.082) (-511.033) * (-510.817) [-508.991] (-509.379) (-509.256) -- 0:00:24
      610000 -- [-511.455] (-510.614) (-509.186) (-510.727) * [-509.559] (-510.589) (-510.253) (-508.958) -- 0:00:24

      Average standard deviation of split frequencies: 0.012669

      610500 -- (-511.102) (-514.936) (-513.128) [-510.911] * (-510.981) [-510.685] (-511.683) (-513.184) -- 0:00:24
      611000 -- [-508.866] (-509.883) (-513.682) (-511.200) * [-511.328] (-511.558) (-511.189) (-511.930) -- 0:00:24
      611500 -- (-509.288) [-509.666] (-510.145) (-509.138) * (-510.001) (-514.655) (-511.086) [-510.452] -- 0:00:24
      612000 -- (-511.753) (-509.009) (-508.754) [-510.029] * [-512.024] (-510.070) (-515.351) (-510.616) -- 0:00:24
      612500 -- (-510.910) [-508.802] (-512.646) (-511.652) * (-511.642) (-510.998) (-511.072) [-512.349] -- 0:00:24
      613000 -- (-510.828) (-512.831) (-511.224) [-508.800] * [-515.905] (-510.079) (-513.707) (-511.556) -- 0:00:24
      613500 -- (-516.898) (-509.278) [-512.791] (-510.773) * [-509.666] (-511.329) (-511.344) (-510.441) -- 0:00:24
      614000 -- [-515.295] (-512.520) (-510.122) (-510.045) * (-509.603) (-510.576) [-510.470] (-509.655) -- 0:00:24
      614500 -- (-511.635) [-513.740] (-510.468) (-509.329) * (-509.332) (-510.467) (-509.242) [-509.647] -- 0:00:24
      615000 -- (-515.373) (-510.677) (-508.701) [-513.060] * (-511.577) (-513.207) [-509.206] (-508.744) -- 0:00:24

      Average standard deviation of split frequencies: 0.012829

      615500 -- (-511.498) (-509.863) [-511.750] (-511.487) * (-509.443) (-509.971) (-510.854) [-511.203] -- 0:00:24
      616000 -- (-509.768) [-510.615] (-510.534) (-509.111) * (-509.621) (-511.500) (-510.850) [-509.258] -- 0:00:24
      616500 -- (-513.802) (-510.846) [-513.629] (-508.783) * (-510.010) (-509.748) [-509.789] (-509.627) -- 0:00:24
      617000 -- (-508.832) (-511.134) (-509.024) [-512.627] * (-510.539) (-510.083) [-513.214] (-508.812) -- 0:00:24
      617500 -- [-510.494] (-511.071) (-510.297) (-510.450) * [-511.587] (-508.669) (-512.540) (-512.945) -- 0:00:24
      618000 -- (-509.406) [-516.240] (-509.045) (-511.548) * (-509.912) [-509.378] (-514.430) (-515.203) -- 0:00:24
      618500 -- (-509.164) (-511.359) (-511.117) [-510.326] * (-509.086) (-509.231) [-509.563] (-511.855) -- 0:00:24
      619000 -- (-511.888) [-509.867] (-510.844) (-512.596) * (-509.082) (-508.850) (-510.073) [-508.632] -- 0:00:24
      619500 -- (-508.592) (-509.363) (-509.042) [-510.830] * (-511.003) (-511.408) (-510.942) [-508.877] -- 0:00:24
      620000 -- (-508.571) (-511.140) (-509.090) [-508.936] * (-511.979) (-514.365) [-509.744] (-509.355) -- 0:00:24

      Average standard deviation of split frequencies: 0.012599

      620500 -- [-508.556] (-512.366) (-511.257) (-510.455) * (-509.988) (-508.823) [-511.817] (-509.837) -- 0:00:24
      621000 -- (-508.820) (-511.251) (-510.047) [-509.187] * (-514.157) (-514.869) [-511.484] (-513.767) -- 0:00:24
      621500 -- (-509.181) (-511.592) [-509.323] (-510.561) * [-511.627] (-509.103) (-511.513) (-510.426) -- 0:00:24
      622000 -- (-512.166) (-510.118) [-510.437] (-512.939) * [-511.916] (-509.135) (-511.393) (-511.323) -- 0:00:24
      622500 -- (-513.458) (-517.494) (-516.222) [-509.376] * [-508.737] (-511.840) (-511.628) (-513.173) -- 0:00:24
      623000 -- [-513.007] (-513.156) (-508.913) (-509.930) * (-508.505) (-509.076) (-510.308) [-509.193] -- 0:00:24
      623500 -- (-514.748) (-510.308) [-509.421] (-509.421) * (-508.539) (-512.439) [-509.794] (-515.977) -- 0:00:24
      624000 -- [-511.999] (-511.225) (-509.445) (-509.312) * (-509.957) [-513.243] (-512.219) (-509.326) -- 0:00:24
      624500 -- (-512.429) (-511.120) [-510.122] (-510.238) * (-511.481) (-509.588) [-511.265] (-508.979) -- 0:00:24
      625000 -- (-510.241) (-516.537) (-513.491) [-511.736] * [-510.468] (-512.166) (-513.118) (-509.407) -- 0:00:24

      Average standard deviation of split frequencies: 0.012216

      625500 -- (-510.884) (-513.679) (-510.322) [-511.349] * (-508.446) [-512.252] (-511.875) (-509.326) -- 0:00:23
      626000 -- (-513.280) (-512.737) (-510.803) [-511.422] * [-511.052] (-512.294) (-512.334) (-510.515) -- 0:00:23
      626500 -- (-512.458) (-509.822) [-510.343] (-510.042) * (-512.680) (-512.110) [-510.236] (-513.195) -- 0:00:23
      627000 -- [-511.730] (-509.929) (-511.529) (-513.710) * (-511.295) (-509.280) [-508.922] (-510.571) -- 0:00:23
      627500 -- (-509.645) (-510.698) (-509.453) [-512.666] * [-508.546] (-510.035) (-514.016) (-510.207) -- 0:00:23
      628000 -- [-509.636] (-509.466) (-511.407) (-508.769) * (-512.766) [-511.366] (-508.679) (-512.033) -- 0:00:23
      628500 -- (-509.697) (-514.770) (-510.655) [-510.206] * [-510.751] (-512.972) (-509.166) (-510.409) -- 0:00:23
      629000 -- [-508.940] (-516.572) (-511.394) (-509.141) * (-511.186) (-511.588) (-509.762) [-509.430] -- 0:00:23
      629500 -- (-508.684) (-510.663) [-512.897] (-511.781) * (-516.559) [-509.752] (-509.173) (-510.768) -- 0:00:23
      630000 -- (-508.704) [-510.869] (-508.607) (-508.962) * (-511.141) [-510.248] (-513.870) (-509.422) -- 0:00:23

      Average standard deviation of split frequencies: 0.013415

      630500 -- (-513.372) (-513.599) (-510.102) [-510.817] * (-511.019) (-512.938) [-510.981] (-510.420) -- 0:00:23
      631000 -- (-509.873) [-514.128] (-510.713) (-510.530) * (-510.383) (-513.836) [-510.141] (-509.119) -- 0:00:23
      631500 -- [-514.186] (-509.892) (-511.453) (-512.650) * (-509.194) (-512.231) (-511.398) [-512.315] -- 0:00:23
      632000 -- (-509.603) [-508.838] (-509.429) (-509.918) * [-509.755] (-514.611) (-510.517) (-510.852) -- 0:00:23
      632500 -- [-509.895] (-509.108) (-508.424) (-509.666) * (-509.526) (-508.577) [-508.930] (-509.733) -- 0:00:23
      633000 -- (-510.723) (-509.418) [-510.408] (-509.022) * (-512.124) (-512.259) (-508.969) [-510.673] -- 0:00:23
      633500 -- [-511.223] (-510.740) (-511.845) (-512.352) * (-508.398) (-514.664) [-511.081] (-510.837) -- 0:00:23
      634000 -- [-511.724] (-511.094) (-512.003) (-509.839) * (-509.254) (-510.749) [-508.560] (-509.258) -- 0:00:23
      634500 -- (-510.626) [-509.520] (-509.002) (-510.141) * (-511.160) (-509.584) [-509.623] (-508.425) -- 0:00:23
      635000 -- [-509.602] (-510.023) (-510.765) (-510.788) * (-509.867) (-511.690) (-509.006) [-510.528] -- 0:00:23

      Average standard deviation of split frequencies: 0.014200

      635500 -- (-513.192) [-509.361] (-511.190) (-512.180) * [-509.238] (-508.988) (-509.846) (-511.691) -- 0:00:23
      636000 -- (-510.550) [-509.790] (-516.978) (-513.467) * [-514.088] (-510.071) (-508.668) (-511.070) -- 0:00:23
      636500 -- (-512.023) [-509.595] (-511.291) (-510.528) * (-510.074) (-511.823) [-510.374] (-511.352) -- 0:00:23
      637000 -- (-509.658) [-509.730] (-510.276) (-510.710) * (-510.117) (-511.177) (-512.720) [-509.827] -- 0:00:23
      637500 -- (-513.637) (-510.762) [-513.407] (-510.386) * (-508.879) (-510.107) [-510.642] (-509.452) -- 0:00:23
      638000 -- (-513.044) (-509.621) (-510.242) [-509.329] * (-511.253) (-510.240) [-511.533] (-509.371) -- 0:00:23
      638500 -- (-512.789) [-512.466] (-510.607) (-511.362) * (-511.442) [-512.322] (-510.719) (-509.636) -- 0:00:23
      639000 -- (-511.156) (-517.226) (-509.239) [-510.145] * [-510.320] (-510.464) (-510.438) (-511.120) -- 0:00:23
      639500 -- [-510.055] (-515.600) (-509.240) (-513.433) * (-509.477) (-508.953) (-512.443) [-515.534] -- 0:00:23
      640000 -- (-508.876) (-510.273) [-509.265] (-510.672) * (-509.065) [-509.858] (-510.297) (-517.191) -- 0:00:23

      Average standard deviation of split frequencies: 0.014677

      640500 -- [-510.182] (-516.260) (-511.958) (-509.272) * [-511.022] (-515.398) (-509.253) (-516.844) -- 0:00:23
      641000 -- [-510.372] (-510.833) (-511.627) (-512.485) * (-508.453) (-511.982) (-509.464) [-516.128] -- 0:00:22
      641500 -- (-509.721) (-509.930) (-509.112) [-509.799] * (-511.014) (-509.784) (-513.147) [-510.737] -- 0:00:22
      642000 -- (-511.582) (-510.460) (-510.556) [-511.168] * [-509.487] (-509.555) (-513.435) (-508.446) -- 0:00:22
      642500 -- (-509.453) (-508.751) [-511.026] (-511.700) * [-512.635] (-509.332) (-510.166) (-509.667) -- 0:00:22
      643000 -- (-511.962) (-512.782) (-515.535) [-509.425] * (-509.949) (-510.225) (-510.768) [-510.138] -- 0:00:22
      643500 -- (-509.273) (-520.402) (-512.745) [-508.921] * (-511.164) (-509.970) (-513.407) [-514.661] -- 0:00:22
      644000 -- (-510.148) (-510.003) (-510.437) [-508.567] * [-510.084] (-512.132) (-511.156) (-510.135) -- 0:00:22
      644500 -- (-509.961) (-510.397) [-509.678] (-510.821) * (-510.871) (-509.808) [-509.497] (-510.085) -- 0:00:22
      645000 -- [-509.395] (-511.225) (-510.339) (-508.828) * [-510.162] (-509.537) (-510.043) (-509.993) -- 0:00:22

      Average standard deviation of split frequencies: 0.014018

      645500 -- (-514.196) (-513.097) (-512.907) [-508.803] * (-510.223) (-524.470) [-509.355] (-513.698) -- 0:00:22
      646000 -- [-508.433] (-511.834) (-513.189) (-513.345) * (-509.900) (-519.154) [-508.655] (-510.827) -- 0:00:22
      646500 -- (-509.651) [-509.083] (-509.565) (-512.287) * [-509.213] (-512.937) (-508.909) (-512.838) -- 0:00:22
      647000 -- (-512.551) [-508.974] (-509.927) (-509.226) * [-509.122] (-511.629) (-511.533) (-509.947) -- 0:00:22
      647500 -- (-512.591) (-512.949) [-508.565] (-510.122) * (-515.239) (-508.536) (-513.497) [-509.407] -- 0:00:22
      648000 -- (-509.731) (-508.645) [-510.366] (-511.822) * (-512.708) (-511.539) [-512.324] (-512.383) -- 0:00:22
      648500 -- (-509.053) (-509.166) [-510.972] (-509.549) * (-511.711) (-510.445) (-513.753) [-512.675] -- 0:00:22
      649000 -- [-509.411] (-510.263) (-511.234) (-509.307) * (-510.342) (-510.691) (-512.580) [-512.144] -- 0:00:22
      649500 -- (-510.000) [-511.217] (-516.977) (-510.517) * (-510.216) (-514.064) (-514.339) [-510.299] -- 0:00:22
      650000 -- [-510.854] (-511.181) (-515.094) (-509.575) * (-509.325) [-510.962] (-511.717) (-510.272) -- 0:00:22

      Average standard deviation of split frequencies: 0.013537

      650500 -- (-509.569) [-508.496] (-510.702) (-512.946) * (-510.209) (-511.339) (-513.284) [-509.127] -- 0:00:22
      651000 -- [-512.429] (-510.275) (-509.529) (-518.651) * (-511.635) (-510.469) [-509.248] (-508.426) -- 0:00:22
      651500 -- (-510.802) (-511.745) [-510.367] (-510.905) * [-509.624] (-510.175) (-509.696) (-511.979) -- 0:00:22
      652000 -- (-509.389) (-510.259) (-510.468) [-509.702] * [-509.972] (-508.779) (-510.261) (-515.201) -- 0:00:22
      652500 -- (-509.876) [-510.714] (-512.319) (-510.118) * (-510.267) (-510.009) (-509.660) [-510.176] -- 0:00:22
      653000 -- (-510.422) [-511.295] (-513.151) (-509.659) * (-511.977) (-512.478) [-510.518] (-512.798) -- 0:00:22
      653500 -- (-511.575) [-511.881] (-511.751) (-510.063) * (-509.026) (-509.865) [-509.720] (-511.944) -- 0:00:22
      654000 -- (-511.352) (-511.272) (-511.607) [-509.541] * (-512.258) [-508.341] (-510.333) (-511.626) -- 0:00:22
      654500 -- (-513.764) (-509.789) (-511.403) [-510.659] * (-514.177) [-510.380] (-508.848) (-511.473) -- 0:00:22
      655000 -- (-510.473) [-509.131] (-511.722) (-510.519) * (-515.684) (-509.745) (-511.000) [-517.283] -- 0:00:22

      Average standard deviation of split frequencies: 0.013614

      655500 -- (-509.066) (-514.115) (-509.990) [-510.777] * (-512.442) [-510.128] (-509.774) (-511.962) -- 0:00:22
      656000 -- (-510.297) (-511.027) (-509.892) [-510.956] * (-509.056) (-512.046) (-510.720) [-511.388] -- 0:00:22
      656500 -- (-511.844) (-515.142) [-510.874] (-510.226) * (-510.763) (-511.292) (-511.080) [-509.840] -- 0:00:21
      657000 -- (-511.330) (-510.183) (-510.726) [-511.995] * (-509.501) [-511.504] (-510.704) (-509.710) -- 0:00:21
      657500 -- [-510.010] (-509.144) (-516.670) (-509.292) * (-510.415) (-513.441) [-509.798] (-510.932) -- 0:00:21
      658000 -- (-511.241) (-509.738) (-509.186) [-511.492] * [-511.699] (-509.264) (-509.352) (-509.607) -- 0:00:21
      658500 -- (-511.231) [-510.509] (-511.594) (-511.965) * [-512.534] (-508.688) (-509.848) (-512.856) -- 0:00:21
      659000 -- (-513.494) (-509.090) (-509.957) [-510.002] * (-512.720) (-510.413) [-510.417] (-508.654) -- 0:00:21
      659500 -- (-511.003) (-508.806) [-508.956] (-512.660) * (-508.619) (-510.011) (-514.567) [-509.423] -- 0:00:21
      660000 -- (-510.075) (-510.539) (-511.285) [-511.006] * (-514.245) (-508.827) (-511.243) [-510.050] -- 0:00:21

      Average standard deviation of split frequencies: 0.012804

      660500 -- [-511.628] (-508.832) (-509.543) (-510.651) * (-509.531) (-508.702) [-508.886] (-511.810) -- 0:00:21
      661000 -- [-511.234] (-510.250) (-509.684) (-515.782) * (-511.250) (-508.925) [-511.992] (-510.903) -- 0:00:21
      661500 -- (-510.265) (-512.901) [-510.221] (-512.412) * (-511.356) (-513.171) [-511.389] (-511.494) -- 0:00:21
      662000 -- [-511.562] (-515.179) (-511.638) (-508.939) * (-509.371) (-508.931) [-511.975] (-510.279) -- 0:00:21
      662500 -- (-512.683) (-511.166) [-511.049] (-508.636) * (-511.146) [-509.244] (-518.039) (-516.225) -- 0:00:21
      663000 -- [-508.958] (-511.559) (-509.782) (-510.181) * (-513.069) (-513.495) [-516.898] (-509.868) -- 0:00:21
      663500 -- (-509.349) (-509.302) (-510.546) [-512.072] * (-511.167) (-509.743) [-509.548] (-511.254) -- 0:00:21
      664000 -- (-516.034) [-512.493] (-510.010) (-510.434) * (-510.377) (-512.391) [-508.853] (-514.812) -- 0:00:21
      664500 -- (-511.821) (-509.385) [-509.258] (-511.557) * [-511.133] (-511.270) (-509.343) (-510.233) -- 0:00:21
      665000 -- (-511.534) (-511.680) (-510.954) [-510.185] * [-508.722] (-510.784) (-509.746) (-514.045) -- 0:00:21

      Average standard deviation of split frequencies: 0.012741

      665500 -- (-511.743) (-511.221) (-512.133) [-510.279] * (-509.102) [-510.229] (-513.518) (-512.376) -- 0:00:21
      666000 -- (-510.614) (-510.018) [-510.641] (-510.867) * [-509.151] (-512.618) (-509.572) (-508.680) -- 0:00:21
      666500 -- (-510.845) [-509.954] (-509.012) (-511.549) * [-509.702] (-509.467) (-509.112) (-513.380) -- 0:00:21
      667000 -- (-511.835) (-511.358) (-509.877) [-511.239] * (-509.388) (-512.713) [-508.812] (-510.764) -- 0:00:21
      667500 -- [-509.759] (-514.205) (-511.720) (-510.921) * (-509.643) [-512.303] (-512.019) (-509.839) -- 0:00:21
      668000 -- (-513.303) [-510.327] (-509.448) (-510.821) * (-510.305) (-512.110) (-509.874) [-509.096] -- 0:00:21
      668500 -- (-512.331) [-511.325] (-508.454) (-512.398) * [-512.672] (-512.086) (-512.967) (-509.384) -- 0:00:21
      669000 -- (-512.510) (-510.431) [-514.325] (-510.340) * [-509.027] (-511.577) (-511.406) (-511.148) -- 0:00:21
      669500 -- (-510.155) [-509.703] (-511.774) (-513.692) * (-509.544) [-510.746] (-510.282) (-511.637) -- 0:00:21
      670000 -- (-509.473) (-510.579) [-513.859] (-512.041) * [-508.799] (-511.379) (-511.150) (-512.390) -- 0:00:21

      Average standard deviation of split frequencies: 0.012363

      670500 -- (-513.383) (-514.232) (-510.814) [-512.909] * (-511.796) [-510.620] (-509.055) (-512.352) -- 0:00:21
      671000 -- (-509.909) (-513.560) (-510.915) [-510.388] * (-511.693) [-510.897] (-509.301) (-514.298) -- 0:00:21
      671500 -- (-509.917) [-509.364] (-511.672) (-510.157) * (-509.854) (-513.935) (-509.061) [-512.133] -- 0:00:21
      672000 -- [-513.860] (-510.063) (-510.896) (-509.827) * [-510.852] (-510.956) (-509.442) (-509.426) -- 0:00:20
      672500 -- [-510.422] (-510.299) (-513.211) (-511.832) * (-510.093) [-511.275] (-510.025) (-509.896) -- 0:00:20
      673000 -- [-508.639] (-510.428) (-509.378) (-511.945) * [-510.763] (-511.608) (-511.450) (-510.197) -- 0:00:20
      673500 -- (-513.547) [-510.691] (-510.565) (-512.433) * (-508.861) (-513.267) [-513.697] (-508.598) -- 0:00:20
      674000 -- [-513.806] (-511.924) (-512.295) (-510.220) * (-510.255) (-511.933) [-512.936] (-513.709) -- 0:00:20
      674500 -- [-510.320] (-511.338) (-510.400) (-510.414) * (-511.205) [-509.203] (-512.654) (-509.918) -- 0:00:20
      675000 -- (-511.547) (-512.029) (-511.418) [-508.956] * [-510.316] (-509.272) (-508.332) (-511.692) -- 0:00:20

      Average standard deviation of split frequencies: 0.011506

      675500 -- (-514.241) (-510.889) (-509.482) [-509.685] * (-510.449) [-509.441] (-509.087) (-511.080) -- 0:00:20
      676000 -- (-511.150) (-508.808) [-512.515] (-509.947) * [-510.628] (-509.249) (-513.309) (-509.503) -- 0:00:20
      676500 -- (-509.345) (-508.520) [-509.235] (-510.113) * (-509.643) (-511.757) (-509.820) [-510.734] -- 0:00:20
      677000 -- (-510.414) (-509.564) [-510.685] (-509.612) * (-510.458) [-509.606] (-509.448) (-508.537) -- 0:00:20
      677500 -- (-512.866) (-511.215) (-512.204) [-509.694] * (-509.506) (-511.192) [-510.948] (-512.055) -- 0:00:20
      678000 -- (-508.738) [-511.813] (-510.094) (-513.278) * (-510.151) (-513.558) [-508.320] (-512.680) -- 0:00:20
      678500 -- [-513.664] (-508.362) (-512.971) (-509.546) * (-511.005) (-509.821) [-508.332] (-510.187) -- 0:00:20
      679000 -- (-509.021) (-509.962) (-510.888) [-509.868] * (-510.863) (-511.874) [-509.213] (-515.423) -- 0:00:20
      679500 -- (-510.633) (-509.266) [-509.781] (-508.839) * [-511.335] (-515.385) (-510.403) (-510.312) -- 0:00:20
      680000 -- (-516.704) (-512.156) (-510.495) [-509.932] * (-515.332) (-509.210) [-513.981] (-510.140) -- 0:00:20

      Average standard deviation of split frequencies: 0.012140

      680500 -- (-511.463) (-512.765) [-510.444] (-515.517) * (-512.349) (-509.449) (-516.819) [-511.747] -- 0:00:20
      681000 -- (-512.662) [-508.924] (-510.101) (-517.299) * (-510.420) (-511.250) [-511.843] (-515.599) -- 0:00:20
      681500 -- [-511.394] (-512.300) (-512.508) (-510.751) * (-517.783) (-516.177) (-513.126) [-510.819] -- 0:00:20
      682000 -- (-509.185) [-511.140] (-509.989) (-511.545) * [-509.588] (-511.123) (-509.152) (-513.081) -- 0:00:20
      682500 -- (-510.152) (-511.382) (-512.097) [-512.593] * (-513.285) [-509.663] (-511.891) (-517.665) -- 0:00:20
      683000 -- [-510.741] (-512.007) (-512.469) (-509.935) * (-509.780) [-510.054] (-510.064) (-512.178) -- 0:00:20
      683500 -- (-509.905) (-516.075) [-509.764] (-509.825) * [-510.884] (-510.173) (-510.746) (-512.122) -- 0:00:20
      684000 -- (-509.793) (-517.597) (-509.419) [-512.488] * (-510.577) [-509.942] (-508.983) (-511.354) -- 0:00:20
      684500 -- (-509.411) [-509.992] (-508.217) (-509.728) * (-509.705) [-509.385] (-510.753) (-511.925) -- 0:00:20
      685000 -- (-508.903) (-509.154) (-510.428) [-508.517] * [-509.663] (-510.760) (-510.283) (-510.777) -- 0:00:20

      Average standard deviation of split frequencies: 0.012450

      685500 -- (-514.933) (-511.331) [-508.842] (-512.080) * [-508.962] (-512.532) (-509.811) (-511.301) -- 0:00:20
      686000 -- [-512.696] (-509.264) (-509.176) (-511.850) * (-508.876) [-512.145] (-512.139) (-512.371) -- 0:00:20
      686500 -- (-515.354) [-511.376] (-510.418) (-509.293) * [-509.308] (-511.840) (-511.545) (-508.964) -- 0:00:20
      687000 -- [-512.278] (-512.806) (-517.237) (-510.823) * (-510.258) [-512.291] (-510.911) (-509.156) -- 0:00:20
      687500 -- (-510.481) (-510.750) (-510.335) [-510.880] * [-513.212] (-513.020) (-516.110) (-510.582) -- 0:00:20
      688000 -- (-512.206) (-510.285) [-511.680] (-514.303) * (-513.304) [-511.928] (-512.539) (-511.314) -- 0:00:19
      688500 -- (-511.811) (-509.065) (-510.524) [-511.911] * [-508.926] (-510.026) (-510.336) (-510.434) -- 0:00:19
      689000 -- [-510.845] (-510.793) (-509.965) (-512.536) * (-510.369) (-510.356) [-510.173] (-509.692) -- 0:00:19
      689500 -- [-509.079] (-512.403) (-511.781) (-511.294) * (-510.377) [-510.836] (-510.854) (-512.814) -- 0:00:19
      690000 -- (-510.690) (-512.081) (-509.690) [-510.886] * (-510.772) (-510.166) (-509.828) [-513.610] -- 0:00:19

      Average standard deviation of split frequencies: 0.012567

      690500 -- (-510.672) (-511.567) (-509.703) [-510.225] * (-513.080) (-510.610) (-514.273) [-510.122] -- 0:00:19
      691000 -- (-511.670) (-510.704) (-509.778) [-508.827] * (-510.027) (-509.985) (-514.782) [-510.791] -- 0:00:19
      691500 -- (-513.622) (-509.905) [-510.771] (-513.610) * (-509.676) (-509.318) [-509.872] (-510.316) -- 0:00:19
      692000 -- (-511.894) (-509.695) [-508.888] (-510.294) * [-511.167] (-515.066) (-511.213) (-510.878) -- 0:00:19
      692500 -- (-511.016) (-509.930) (-511.156) [-510.019] * (-510.386) (-509.961) [-510.124] (-509.904) -- 0:00:19
      693000 -- (-510.204) (-510.177) [-511.112] (-510.587) * (-509.836) (-510.468) (-511.660) [-508.452] -- 0:00:19
      693500 -- (-508.713) [-510.138] (-513.389) (-514.709) * [-511.406] (-510.135) (-511.387) (-509.852) -- 0:00:19
      694000 -- (-511.248) (-514.463) [-512.067] (-512.206) * [-512.021] (-508.941) (-510.164) (-512.625) -- 0:00:19
      694500 -- (-511.920) [-511.368] (-511.103) (-510.808) * (-511.306) (-510.337) (-511.293) [-509.974] -- 0:00:19
      695000 -- (-510.982) (-509.317) (-511.473) [-508.971] * [-510.344] (-511.151) (-510.391) (-509.707) -- 0:00:19

      Average standard deviation of split frequencies: 0.012032

      695500 -- (-512.915) [-511.206] (-508.769) (-510.404) * (-510.677) (-509.784) (-509.358) [-510.940] -- 0:00:19
      696000 -- [-510.850] (-509.943) (-508.881) (-510.448) * [-512.636] (-509.448) (-510.345) (-509.885) -- 0:00:19
      696500 -- (-511.349) [-510.050] (-512.922) (-509.072) * (-511.291) (-511.988) [-509.835] (-513.181) -- 0:00:19
      697000 -- (-509.412) [-513.005] (-508.919) (-511.440) * [-509.825] (-512.099) (-512.358) (-508.938) -- 0:00:19
      697500 -- [-508.953] (-512.379) (-510.458) (-510.563) * (-510.601) (-508.646) (-515.294) [-509.354] -- 0:00:19
      698000 -- [-509.933] (-511.795) (-513.641) (-510.857) * (-509.744) (-508.491) (-512.644) [-509.384] -- 0:00:19
      698500 -- (-509.896) (-509.881) [-511.275] (-509.133) * (-511.700) (-513.722) (-509.573) [-509.161] -- 0:00:19
      699000 -- (-508.916) (-508.653) [-510.764] (-509.236) * [-510.288] (-513.223) (-511.945) (-509.249) -- 0:00:19
      699500 -- (-508.281) (-510.229) [-511.555] (-514.100) * [-511.462] (-513.226) (-513.446) (-512.775) -- 0:00:19
      700000 -- (-512.606) (-509.115) [-510.818] (-512.224) * [-511.516] (-515.122) (-510.743) (-513.397) -- 0:00:19

      Average standard deviation of split frequencies: 0.012427

      700500 -- (-510.916) (-509.732) (-512.181) [-508.680] * (-513.407) (-509.083) [-512.440] (-513.057) -- 0:00:19
      701000 -- (-516.431) [-508.932] (-509.540) (-514.359) * [-509.705] (-511.347) (-510.944) (-509.902) -- 0:00:19
      701500 -- (-513.011) (-519.333) (-511.920) [-510.237] * [-508.999] (-512.307) (-510.939) (-511.978) -- 0:00:19
      702000 -- (-509.800) [-514.930] (-513.212) (-509.097) * (-509.855) (-515.938) [-509.915] (-510.859) -- 0:00:19
      702500 -- (-510.611) (-511.034) (-510.647) [-509.762] * (-509.902) (-509.777) (-509.640) [-509.854] -- 0:00:19
      703000 -- (-511.064) (-511.263) (-509.882) [-512.206] * (-509.904) [-510.246] (-508.762) (-511.102) -- 0:00:19
      703500 -- (-510.413) (-512.107) (-513.890) [-510.455] * [-509.617] (-509.973) (-512.116) (-512.971) -- 0:00:18
      704000 -- [-510.330] (-511.854) (-512.212) (-508.326) * (-509.843) (-510.015) (-511.825) [-509.796] -- 0:00:18
      704500 -- (-509.383) (-509.276) (-512.137) [-509.068] * (-511.252) (-514.063) (-512.574) [-509.181] -- 0:00:18
      705000 -- [-509.427] (-514.014) (-511.784) (-510.491) * (-509.568) (-510.140) [-513.571] (-510.349) -- 0:00:18

      Average standard deviation of split frequencies: 0.012215

      705500 -- [-509.873] (-510.176) (-510.360) (-510.379) * [-509.843] (-511.850) (-513.054) (-510.424) -- 0:00:18
      706000 -- (-510.125) (-509.714) [-508.972] (-511.601) * [-513.880] (-514.807) (-514.724) (-511.440) -- 0:00:18
      706500 -- (-511.631) (-510.568) (-512.202) [-509.900] * (-510.296) (-513.235) [-510.869] (-508.216) -- 0:00:18
      707000 -- (-514.132) (-510.970) [-513.195] (-512.129) * (-509.338) (-509.678) (-509.646) [-508.414] -- 0:00:18
      707500 -- (-510.371) (-510.496) [-513.489] (-513.338) * (-509.313) (-508.551) (-509.934) [-510.864] -- 0:00:18
      708000 -- (-510.030) (-512.391) [-509.810] (-510.506) * [-512.412] (-511.785) (-509.152) (-508.745) -- 0:00:18
      708500 -- (-516.569) [-509.634] (-510.196) (-515.498) * (-509.564) (-509.552) (-510.433) [-508.747] -- 0:00:18
      709000 -- [-509.910] (-510.852) (-512.560) (-510.213) * (-513.960) (-510.494) (-509.779) [-510.481] -- 0:00:18
      709500 -- (-511.128) [-510.976] (-512.593) (-509.945) * (-511.744) [-509.482] (-508.695) (-515.011) -- 0:00:18
      710000 -- (-510.305) (-509.916) (-512.280) [-514.234] * (-511.522) [-509.282] (-510.320) (-510.526) -- 0:00:18

      Average standard deviation of split frequencies: 0.012252

      710500 -- (-512.969) [-508.853] (-508.737) (-509.896) * (-508.680) (-511.488) [-508.562] (-509.315) -- 0:00:18
      711000 -- [-509.561] (-508.841) (-513.356) (-515.593) * (-510.290) (-514.834) [-508.730] (-509.585) -- 0:00:18
      711500 -- [-511.163] (-509.512) (-516.118) (-509.699) * (-510.388) (-510.212) (-511.567) [-512.305] -- 0:00:18
      712000 -- (-510.017) (-510.695) [-509.181] (-510.151) * (-510.061) [-510.556] (-511.990) (-512.650) -- 0:00:18
      712500 -- (-511.098) [-511.922] (-508.594) (-513.367) * (-513.113) [-509.051] (-514.822) (-512.379) -- 0:00:18
      713000 -- [-510.839] (-512.211) (-509.060) (-511.946) * [-508.917] (-509.200) (-511.921) (-511.569) -- 0:00:18
      713500 -- (-510.839) (-509.479) [-510.783] (-510.519) * [-508.839] (-510.770) (-510.686) (-509.093) -- 0:00:18
      714000 -- (-510.219) (-510.169) (-510.584) [-509.911] * (-508.673) [-515.708] (-511.513) (-509.003) -- 0:00:18
      714500 -- (-510.553) [-511.040] (-512.315) (-512.434) * [-511.508] (-514.890) (-510.057) (-511.876) -- 0:00:18
      715000 -- (-511.737) [-512.626] (-509.920) (-512.680) * [-511.858] (-512.190) (-508.829) (-512.760) -- 0:00:18

      Average standard deviation of split frequencies: 0.011234

      715500 -- (-511.147) (-512.627) (-510.903) [-514.587] * [-508.760] (-511.851) (-508.873) (-515.371) -- 0:00:18
      716000 -- (-509.651) (-509.894) (-512.853) [-512.319] * (-509.870) (-509.789) [-508.398] (-512.898) -- 0:00:18
      716500 -- (-511.727) [-510.196] (-510.056) (-511.618) * (-510.854) (-509.622) [-509.248] (-510.771) -- 0:00:18
      717000 -- (-511.534) (-510.202) (-510.115) [-512.624] * [-509.717] (-513.156) (-510.688) (-509.431) -- 0:00:18
      717500 -- [-510.571] (-510.873) (-510.734) (-510.507) * (-513.019) (-510.405) [-509.787] (-509.774) -- 0:00:18
      718000 -- [-513.576] (-511.990) (-511.738) (-509.691) * (-509.204) (-509.706) [-508.987] (-509.949) -- 0:00:18
      718500 -- (-509.973) (-512.380) [-509.814] (-515.483) * (-512.219) [-509.024] (-509.654) (-508.413) -- 0:00:18
      719000 -- [-509.636] (-511.815) (-510.996) (-508.603) * (-511.342) [-512.245] (-512.211) (-510.553) -- 0:00:17
      719500 -- (-508.967) (-509.004) (-511.401) [-509.662] * (-510.980) [-508.914] (-512.287) (-509.455) -- 0:00:17
      720000 -- (-515.557) (-510.320) [-509.653] (-511.084) * (-509.045) (-508.903) (-517.309) [-509.551] -- 0:00:17

      Average standard deviation of split frequencies: 0.011202

      720500 -- (-509.223) (-510.106) [-510.407] (-509.490) * (-510.686) [-510.419] (-514.880) (-510.100) -- 0:00:17
      721000 -- (-510.674) [-515.442] (-510.304) (-509.675) * (-515.018) (-509.973) [-510.742] (-511.506) -- 0:00:17
      721500 -- (-510.752) (-511.257) (-509.371) [-510.249] * (-510.782) [-510.772] (-515.366) (-509.571) -- 0:00:17
      722000 -- (-511.890) [-513.000] (-509.949) (-511.189) * (-513.146) (-512.184) (-517.296) [-509.046] -- 0:00:17
      722500 -- (-509.181) (-510.357) [-509.824] (-509.715) * (-514.080) (-509.696) (-518.373) [-512.936] -- 0:00:18
      723000 -- (-512.033) [-511.138] (-510.276) (-511.018) * (-509.204) (-510.049) (-510.237) [-510.209] -- 0:00:18
      723500 -- [-511.197] (-510.595) (-509.857) (-510.563) * (-509.579) [-509.738] (-509.782) (-509.797) -- 0:00:17
      724000 -- (-513.079) [-508.672] (-509.095) (-510.948) * (-508.756) (-509.407) [-511.576] (-511.300) -- 0:00:17
      724500 -- (-511.150) (-510.160) (-509.167) [-510.504] * [-509.598] (-509.414) (-513.196) (-509.841) -- 0:00:17
      725000 -- (-510.714) (-513.099) (-509.755) [-509.964] * [-509.832] (-510.674) (-510.999) (-515.051) -- 0:00:17

      Average standard deviation of split frequencies: 0.011322

      725500 -- (-512.269) (-511.059) (-511.922) [-510.665] * (-512.347) [-511.404] (-510.580) (-516.104) -- 0:00:17
      726000 -- (-510.505) (-512.140) (-511.207) [-509.703] * (-512.445) (-509.218) (-515.995) [-511.048] -- 0:00:17
      726500 -- (-512.681) (-514.626) (-509.960) [-510.034] * (-510.924) (-509.565) (-511.386) [-509.381] -- 0:00:17
      727000 -- [-511.847] (-520.975) (-511.218) (-511.616) * (-509.957) [-511.306] (-509.522) (-511.151) -- 0:00:17
      727500 -- (-510.075) [-509.079] (-510.695) (-508.921) * (-511.467) (-512.075) [-508.747] (-513.769) -- 0:00:17
      728000 -- (-509.234) (-510.447) (-510.024) [-509.233] * (-510.183) (-508.913) [-510.504] (-512.569) -- 0:00:17
      728500 -- [-510.051] (-509.099) (-508.952) (-512.912) * (-509.778) (-512.662) [-510.490] (-512.405) -- 0:00:17
      729000 -- [-514.144] (-510.700) (-520.370) (-511.611) * (-512.206) (-508.988) (-511.805) [-509.389] -- 0:00:17
      729500 -- (-509.774) (-510.650) (-509.383) [-512.180] * (-513.293) [-509.524] (-513.276) (-511.740) -- 0:00:17
      730000 -- (-509.260) [-511.268] (-513.089) (-508.726) * (-513.149) [-511.415] (-512.305) (-512.575) -- 0:00:17

      Average standard deviation of split frequencies: 0.012031

      730500 -- (-508.250) (-516.330) [-511.938] (-511.328) * (-508.989) (-510.103) [-512.209] (-517.321) -- 0:00:17
      731000 -- [-510.396] (-514.669) (-512.592) (-509.015) * (-511.254) (-509.534) (-518.179) [-509.672] -- 0:00:17
      731500 -- (-511.138) (-511.907) (-511.684) [-508.595] * (-511.030) (-511.837) [-511.140] (-510.979) -- 0:00:17
      732000 -- (-511.287) (-508.703) [-511.050] (-510.320) * (-510.797) (-510.058) [-509.851] (-512.678) -- 0:00:17
      732500 -- (-510.927) (-511.473) (-509.829) [-510.570] * (-509.526) (-509.327) [-510.307] (-510.800) -- 0:00:17
      733000 -- (-510.134) [-509.794] (-511.653) (-510.191) * (-508.807) (-516.052) (-511.665) [-510.557] -- 0:00:17
      733500 -- (-510.131) [-511.894] (-509.385) (-510.309) * (-509.025) (-510.550) (-513.340) [-514.345] -- 0:00:17
      734000 -- (-510.733) (-512.823) (-510.445) [-512.068] * (-514.732) [-510.222] (-509.482) (-510.482) -- 0:00:17
      734500 -- (-513.036) (-510.248) (-511.601) [-511.060] * [-508.522] (-508.819) (-510.315) (-508.944) -- 0:00:16
      735000 -- [-510.631] (-509.103) (-509.976) (-509.416) * [-508.909] (-509.494) (-512.215) (-511.354) -- 0:00:16

      Average standard deviation of split frequencies: 0.011906

      735500 -- [-509.285] (-511.280) (-519.457) (-510.851) * (-511.634) [-508.959] (-510.288) (-511.420) -- 0:00:16
      736000 -- (-509.053) (-511.136) (-512.638) [-510.813] * (-511.276) (-512.236) (-511.587) [-509.215] -- 0:00:16
      736500 -- (-509.498) (-509.466) (-510.198) [-509.232] * (-510.022) (-510.164) (-511.301) [-508.911] -- 0:00:16
      737000 -- [-510.080] (-510.891) (-512.969) (-512.137) * (-513.032) (-509.720) (-510.745) [-511.500] -- 0:00:16
      737500 -- (-509.984) [-509.176] (-510.954) (-511.302) * (-512.643) [-509.478] (-510.536) (-511.260) -- 0:00:17
      738000 -- (-510.647) [-508.920] (-514.581) (-510.625) * [-510.261] (-508.330) (-509.713) (-513.894) -- 0:00:17
      738500 -- (-510.159) [-509.080] (-512.021) (-510.396) * [-510.451] (-508.996) (-510.170) (-514.137) -- 0:00:16
      739000 -- [-511.779] (-509.131) (-510.223) (-509.692) * (-511.000) (-510.014) [-510.097] (-510.325) -- 0:00:16
      739500 -- (-512.198) [-511.178] (-510.544) (-515.042) * (-516.952) [-509.643] (-509.839) (-509.976) -- 0:00:16
      740000 -- [-509.741] (-512.366) (-510.855) (-508.862) * (-508.712) (-512.896) [-509.861] (-510.882) -- 0:00:16

      Average standard deviation of split frequencies: 0.011044

      740500 -- (-514.059) (-511.933) (-509.312) [-511.053] * [-509.322] (-512.661) (-508.496) (-510.863) -- 0:00:16
      741000 -- [-511.705] (-510.892) (-510.264) (-510.549) * (-509.306) [-509.650] (-511.004) (-510.773) -- 0:00:16
      741500 -- (-512.681) (-513.439) (-511.148) [-510.202] * (-511.565) [-512.352] (-509.688) (-512.804) -- 0:00:16
      742000 -- (-511.295) (-510.388) (-509.776) [-511.169] * [-509.660] (-509.697) (-509.928) (-510.243) -- 0:00:16
      742500 -- (-514.427) [-511.951] (-508.688) (-509.050) * (-511.108) (-514.093) (-511.505) [-510.155] -- 0:00:16
      743000 -- (-511.167) (-511.414) (-510.079) [-515.572] * [-509.807] (-513.386) (-512.377) (-509.630) -- 0:00:16
      743500 -- [-511.471] (-510.069) (-512.800) (-513.491) * [-509.590] (-511.801) (-513.896) (-510.483) -- 0:00:16
      744000 -- (-512.744) [-510.740] (-512.546) (-513.667) * [-509.990] (-512.743) (-516.200) (-512.068) -- 0:00:16
      744500 -- [-510.716] (-511.826) (-510.648) (-509.462) * (-516.880) [-513.049] (-512.469) (-511.535) -- 0:00:16
      745000 -- (-513.278) [-510.073] (-511.549) (-510.205) * [-512.782] (-511.247) (-512.548) (-511.099) -- 0:00:16

      Average standard deviation of split frequencies: 0.010778

      745500 -- (-513.320) (-509.762) (-511.270) [-508.776] * (-513.938) [-512.405] (-510.511) (-511.132) -- 0:00:16
      746000 -- (-511.874) (-513.150) [-510.348] (-508.318) * (-509.869) (-514.721) (-518.723) [-511.326] -- 0:00:16
      746500 -- (-509.068) (-510.987) [-509.249] (-510.060) * (-509.250) (-511.897) (-511.324) [-510.507] -- 0:00:16
      747000 -- [-508.939] (-509.773) (-511.638) (-511.444) * (-511.549) (-511.308) [-508.642] (-510.248) -- 0:00:16
      747500 -- (-511.075) [-508.914] (-510.248) (-510.724) * (-513.482) [-510.282] (-510.924) (-509.234) -- 0:00:16
      748000 -- (-511.525) (-509.241) (-510.820) [-511.419] * (-521.031) [-511.779] (-512.242) (-510.312) -- 0:00:16
      748500 -- [-511.993] (-509.289) (-511.568) (-508.948) * (-511.524) (-512.844) [-511.159] (-511.315) -- 0:00:16
      749000 -- (-513.439) [-510.835] (-509.868) (-513.079) * (-511.417) [-509.780] (-511.591) (-513.598) -- 0:00:16
      749500 -- (-510.556) (-509.415) (-509.344) [-513.254] * (-508.182) (-508.936) (-512.237) [-509.480] -- 0:00:16
      750000 -- (-509.583) [-511.516] (-509.230) (-510.682) * (-509.290) (-509.706) [-509.331] (-511.963) -- 0:00:16

      Average standard deviation of split frequencies: 0.010479

      750500 -- (-509.134) (-512.858) [-510.500] (-510.361) * [-509.279] (-508.923) (-512.998) (-510.871) -- 0:00:15
      751000 -- (-510.867) (-509.069) [-509.451] (-509.674) * [-508.779] (-510.466) (-509.511) (-511.538) -- 0:00:15
      751500 -- (-512.134) (-509.598) [-512.172] (-509.349) * (-510.959) [-510.033] (-508.742) (-511.277) -- 0:00:15
      752000 -- [-511.144] (-513.628) (-510.014) (-510.033) * (-511.169) (-511.162) (-511.644) [-510.236] -- 0:00:15
      752500 -- (-511.809) (-510.613) (-508.256) [-509.212] * [-508.951] (-510.320) (-510.472) (-510.355) -- 0:00:15
      753000 -- (-509.552) (-509.273) [-509.020] (-511.046) * [-511.632] (-512.953) (-513.755) (-513.271) -- 0:00:15
      753500 -- (-510.164) (-510.554) [-509.479] (-511.986) * [-509.078] (-508.470) (-512.934) (-510.540) -- 0:00:16
      754000 -- (-512.578) [-509.743] (-509.349) (-509.541) * [-511.512] (-508.719) (-510.347) (-513.516) -- 0:00:15
      754500 -- (-511.081) (-509.743) [-509.178] (-510.020) * (-513.138) (-514.117) (-513.938) [-515.041] -- 0:00:15
      755000 -- (-511.191) (-511.173) (-511.727) [-509.590] * (-510.924) [-508.959] (-512.487) (-511.174) -- 0:00:15

      Average standard deviation of split frequencies: 0.010289

      755500 -- (-508.452) [-510.566] (-508.843) (-510.934) * (-512.692) (-509.386) [-509.393] (-509.274) -- 0:00:15
      756000 -- [-512.496] (-510.880) (-512.989) (-510.260) * (-514.698) [-513.581] (-509.695) (-509.609) -- 0:00:15
      756500 -- (-510.924) (-510.380) [-510.153] (-509.896) * (-514.561) [-511.020] (-511.103) (-511.454) -- 0:00:15
      757000 -- (-512.093) (-509.471) (-508.425) [-508.924] * (-514.574) (-510.159) (-510.712) [-509.935] -- 0:00:15
      757500 -- [-508.543] (-516.316) (-510.563) (-512.329) * [-513.864] (-511.327) (-512.117) (-510.961) -- 0:00:15
      758000 -- (-509.287) (-510.643) [-511.275] (-510.738) * (-510.015) [-509.206] (-516.392) (-508.732) -- 0:00:15
      758500 -- [-513.373] (-510.963) (-512.627) (-515.982) * (-513.624) (-511.398) (-509.849) [-508.545] -- 0:00:15
      759000 -- [-509.889] (-512.865) (-511.512) (-512.128) * (-508.702) (-508.642) (-509.492) [-511.276] -- 0:00:15
      759500 -- (-514.513) (-514.768) (-511.607) [-509.770] * [-509.642] (-510.793) (-509.793) (-510.607) -- 0:00:15
      760000 -- [-510.393] (-513.612) (-512.691) (-509.130) * (-509.342) (-513.885) (-509.697) [-511.891] -- 0:00:15

      Average standard deviation of split frequencies: 0.010754

      760500 -- [-512.367] (-515.331) (-510.108) (-510.704) * [-510.159] (-511.284) (-510.626) (-509.919) -- 0:00:15
      761000 -- (-517.864) (-511.407) (-510.241) [-508.783] * [-508.858] (-516.199) (-510.582) (-510.020) -- 0:00:15
      761500 -- (-514.595) (-510.910) [-510.446] (-510.256) * (-509.867) [-515.682] (-508.816) (-512.105) -- 0:00:15
      762000 -- (-513.026) (-511.484) (-509.281) [-510.262] * [-508.870] (-511.134) (-511.978) (-509.946) -- 0:00:15
      762500 -- (-508.468) (-510.711) (-510.110) [-512.810] * (-511.633) (-512.887) [-510.422] (-510.336) -- 0:00:15
      763000 -- (-508.483) (-510.892) [-509.948] (-510.779) * (-511.462) (-512.019) [-509.309] (-511.845) -- 0:00:15
      763500 -- (-511.400) (-510.846) (-508.901) [-511.174] * (-509.823) (-509.843) [-509.198] (-514.485) -- 0:00:15
      764000 -- (-509.386) (-513.780) [-511.222] (-512.059) * (-509.262) (-511.718) [-509.448] (-510.569) -- 0:00:15
      764500 -- (-509.265) (-515.520) (-512.189) [-509.926] * [-511.645] (-511.671) (-511.450) (-510.272) -- 0:00:15
      765000 -- (-509.264) [-512.010] (-509.253) (-513.417) * (-510.437) (-511.854) (-512.439) [-509.570] -- 0:00:15

      Average standard deviation of split frequencies: 0.010245

      765500 -- [-510.807] (-513.121) (-508.950) (-510.147) * (-511.092) [-515.083] (-510.576) (-509.956) -- 0:00:15
      766000 -- [-513.436] (-510.009) (-509.324) (-513.321) * [-510.032] (-509.285) (-512.601) (-509.509) -- 0:00:14
      766500 -- [-510.259] (-509.881) (-509.324) (-513.373) * (-509.434) (-509.349) [-511.625] (-511.362) -- 0:00:14
      767000 -- [-509.237] (-509.772) (-510.626) (-509.822) * (-510.378) [-512.896] (-509.848) (-511.561) -- 0:00:14
      767500 -- (-512.410) [-519.826] (-509.769) (-509.218) * [-510.073] (-511.344) (-509.712) (-510.827) -- 0:00:14
      768000 -- (-510.930) (-512.473) [-509.809] (-508.282) * (-510.679) [-508.675] (-510.416) (-515.479) -- 0:00:14
      768500 -- (-510.291) (-511.780) (-509.474) [-508.266] * (-510.298) [-509.534] (-509.611) (-509.950) -- 0:00:14
      769000 -- (-508.457) [-509.904] (-511.950) (-508.803) * (-510.556) (-513.975) (-509.617) [-514.676] -- 0:00:14
      769500 -- (-510.069) (-511.021) [-511.373] (-511.483) * [-509.766] (-511.471) (-512.936) (-513.247) -- 0:00:14